Премини към съдържанието

Архивирана тема

Темата е твърде стара и е архивирана. Не можете да добавяте нови отговори в нея, но винаги можете да публикувате нова тема, в която да продължи дискусията. Регистрирайте се или влезте във вашия профил за да публикувате нова тема.


Забавяне на компютъра

Препоръчан отговор

Здравейте на всички :)

Така, от доста време забелязвам, че компютъра се товари доста, бавно зарежда уиндолса, малко фпс в игри ;/

И реших да направим една проверка .. : )





DDS (Ver_2011-09-30.01) - NTFS_x86 Internet Explorer: 9.10.9200.16686  BrowserJavaVersion: 10.25.2 Run by User at 19:14:52 on 2013-10-07 Microsoft Windows 7 Enterprise 6.1.7601.1.1251.359.1026.18.1917.915 [GMT 3:00] . AV: Microsoft Security Essentials *Disabled/Updated* {641105E6-77ED-3F35-A304-765193BCB75F} SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46} SP: Microsoft Security Essentials *Disabled/Updated* {DF70E402-51D7-30BB-99B4-4D23E83BFDE2} . ============== Running Processes ================ . C:Windowssystem32wininit.exe C:Windowssystem32lsm.exe C:Program FilesMicrosoft Security ClientMsMpEng.exe C:WindowsSystem32spoolsv.exe C:Program FilesApplication UpdaterApplicationUpdater.exe C:PROGRA~1MYWEBS~1bar1.binmwssvc.exe C:Windowssystem32taskhost.exe C:Windowssystem32PnkBstrA.exe D:MCRazer Game BoosterRzKLService.exe C:ProgramDataSkypeToolbarsSkype C2C Servicec2c_service.exe C:Windowssystem32Dwm.exe C:WindowsExplorer.EXE C:Program FilesTeamViewerVersion8TeamViewer_Service.exe C:Program FilesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exe C:WindowsZSSnp211.exe C:Program FilesMicrosoft Security Clientmsseces.exe C:Program FilesAVG Secure Searchvprot.exe C:WindowsSystem32hkcmd.exe C:WindowsSystem32igfxpers.exe C:Program FilesCommon FilesJavaJava Updatejusched.exe C:Program FilesCommon FilesSpigotSearch SettingsSearchSettings.exe D:DownloadsmyНова папкаhamachi-2-ui.exe C:Program FilesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12loggingserver.exe C:Windowssystem32conhost.exe C:Windowssystem32driverssfuservice.exe D:DownloadsmyНова папкаLMIGuardianSvc.exe C:Program FilesCommon FilesMicrosoft SharedWindows LiveWLIDSVC.EXE C:Program FilesCommon FilesMicrosoft SharedWindows LiveWLIDSvcM.exe D:DownloadsmyНова папкаhamachi-2.exe D:DownloadsmyНова папкаLMIGuardianSvc.exe C:Program FilesWindows Sidebarsidebar.exe C:Windowssystem32SearchIndexer.exe C:WindowsMicrosoft.NetFrameworkv3.0WPFPresentationFontCache.exe C:UsersUserAppDataLocalAkamainetsession_win.exe C:UsersUserAppDataLocalAkamainetsession_win.exe C:WindowsSystem32WUDFHost.exe C:Program FilesWindows Media Playerwmpnetwk.exe C:Windowssystem32DllHost.exe C:Program FilesMozilla Firefoxfirefox.exe C:Program FilesMozilla Firefoxplugin-container.exe C:Windowssystem32MacromedFlashFlashPlayerPlugin_11_8_800_168.exe C:Windowssystem32MacromedFlashFlashPlayerPlugin_11_8_800_168.exe C:Windowssystem32wbemwmiprvse.exe C:Windowssystem32vssvc.exe C:Windowssystem32SearchProtocolHost.exe C:Windowssystem32SearchFilterHost.exe C:Windowssystem32conhost.exe C:Windowssystem32svchost.exe -k DcomLaunch C:Windowssystem32svchost.exe -k RPCSS C:WindowsSystem32svchost.exe -k LocalServiceNetworkRestricted C:WindowsSystem32svchost.exe -k LocalSystemNetworkRestricted C:Windowssystem32svchost.exe -k LocalService C:Windowssystem32svchost.exe -k netsvcs C:Windowssystem32svchost.exe -k NetworkService C:Windowssystem32svchost.exe -k LocalServiceNoNetwork C:Windowssystem32svchost.exe -k LocalServiceAndNoImpersonation C:Windowssystem32svchost.exe -k imgsvc C:Windowssystem32svchost.exe -k NetworkServiceNetworkRestricted C:WindowsSystem32svchost.exe -k LocalServicePeerNet C:WindowsSystem32svchost.exe -k swprv . ============== Pseudo HJT Report =============== . uProxyOverride = <local> uURLSearchHooks: YTD Toolbar: {F3FEE66E-E034-436a-86E4-9690573BEE8A} - uURLSearchHooks: {00A6FAF6-072E-44cf-8957-5838F569A31D} - <orphaned> BHO: privitize Helper Object: {1ACB5ABE-4890-4747-952C-F13BDB93FB75} - c:program filesindustriyaprivitize1.8.21.6bhprivitize.dll BHO: Groove GFS Browser Helper: {72853161-30C5-4D22-B7F9-0BBC1D38A37E} - c:program filesmicrosoft officeoffice14GROOVEEX.DLL BHO: Java Plug-In SSV Helper: {761497BB-D6F0-462C-B6EB-D4DAF1D92D43} - c:program filesjavajre7binssv.dll BHO: Windows Live ID Sign-in Helper: {9030D464-4C02-4ABF-8ECC-5164760863C6} - c:program filescommon filesmicrosoft sharedwindows liveWindowsLiveLogin.dll BHO: AVG Security Toolbar: {95B7759C-8C7F-4BF1-B163-73684A933233} - c:program filesavg secure search17.0.1.12AVG Secure Search_toolbar.dll BHO: Skype Browser Helper: {AE805869-2E5C-4ED4-8F7B-F1F7851A4497} - c:program filesskypetoolbarsinternet explorerskypeieplugin.dll BHO: Office Document Cache Handler: {B4F3A835-0E21-4959-BA22-42B3008E02FF} - c:program filesmicrosoft officeoffice14URLREDIR.DLL BHO: Java Plug-In 2 SSV Helper: {DBC80044-A445-435b-BC74-9C25C1C588A9} - c:program filesjavajre7binjp2ssv.dll BHO: YTD Toolbar: {F3FEE66E-E034-436a-86E4-9690573BEE8A} - TB: <No Name>: {E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39} - LocalServer32 - <no file> TB: AVG Security Toolbar: {95B7759C-8C7F-4BF1-B163-73684A933233} - c:program filesavg secure search17.0.1.12AVG Secure Search_toolbar.dll TB: privitize Toolbar: {1C46A0DD-D53E-46C4-A435-CA11103E255E} - c:program filesindustriyaprivitize1.8.21.6privitizeTlbr.dll TB: YTD Toolbar: {F3FEE66E-E034-436a-86E4-9690573BEE8A} - uRun: [DAEMON Tools Lite] "c:program filesdaemon tools liteDTLite.exe" -autorun uRun: [sidebar] c:program fileswindows sidebarsidebar.exe /autoRun uRun: [skype] "c:program filesskypephoneSkype.exe" /minimized /regrun uRun: [Clownfish] "c:program filesclownfishClownfish.exe" uRun: [Akamai NetSession Interface] "c:usersuserappdatalocalakamainetsession_win.exe" mRun: [bCSSync] "c:program filesmicrosoft officeoffice14BCSSync.exe" /DelayServices mRun: [ZSSnp211] c:windowsZSSnp211.exe mRun: [Google Desktop Search] "c:program filesgooglegoogle desktop searchGoogleDesktop.exe" /startup mRun: [MSC] "c:program filesmicrosoft security clientmsseces.exe" -hide -runkey mRun: [vProt] "c:program filesavg secure searchvprot.exe" mRun: [Driver Genius] <no file> mPolicies-System: ConsentPromptBehaviorUser = dword:3 mPolicies-System: EnableUIADesktopToggle = dword:0 IE: Download all by FlashGet3 - c:program filesflashget networkflashget 3GetAllUrl.htm IE: Download by FlashGet3 - c:program filesflashget networkflashget 3GetUrl.htm IE: E&xport to Microsoft Excel - c:progra~1micros~2office14EXCEL.EXE/3000 IE: Free YouTube Download - c:usersuserappdataroamingdvdvideosoftiehelpersfreeytvdownloader.htm IE: Free YouTube to MP3 Converter - c:usersuserappdataroamingdvdvideosoftiehelpersfreeyoutubetomp3converter.htm IE: Se&nd to OneNote - c:progra~1micros~2office14ONBttnIE.dll/105 IE: ????3?? - <no file> IE: ????3?????? - <no file> IE: {2670000A-7350-4f3c-8081-5663EE0C6C49} - {48E73304-E1D6-4330-914C-F5F514E3486C} - c:program filesmicrosoft officeoffice14ONBttnIE.dll IE: {789FE86F-6FC4-46A1-9849-EDE0DB0C95CA} - {FFFDC614-B694-4AE6-AB38-5D6374584B52} - c:program filesmicrosoft officeoffice14ONBttnIELinkedNotes.dll IE: {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - c:program filesskypetoolbarsinternet explorerskypeieplugin.dll Trusted Zone: clonewarsadventures.com Trusted Zone: freerealms.com Trusted Zone: soe.com Trusted Zone: sony.com TCP: NameServer = TCP: Interfaces{2C4E44DB-F385-4EEB-A10C-DCAB6B3D8099} : DHCPNameServer = Filter: text/xml - {807573E5-5146-11D5-A672-00B0D022E945} - c:program filescommon filesmicrosoft sharedoffice14MSOXMLMF.DLL Handler: skype-ie-addon-data - {91774881-D725-4E58-B298-07617B9B86A8} - c:program filesskypetoolbarsinternet explorerskypeieplugin.dll Handler: skype4com - {FFC8B962-9B40-4DFF-9458-1830C7DD7F5D} - c:program filescommon filesskypeSkype4COM.dll Handler: viprotocol - {B658800C-F66E-4EF3-AB85-6C0C227862A9} - c:program filescommon filesavg secure searchviprotocolinstaller17.0.12ViProtocol.dll Handler: wlpg - {E43EF6CD-A37A-4A9B-9E6F-83F89B8E6324} - c:program fileswindows livephoto galleryAlbumDownloadProtocolHandler.dll Notify: igfxcui - igfxdev.dll SSODL: WebCheck - <orphaned> SEH: Groove GFS Stub Execution Hook - {B5A7F190-DDA6-4420-B3BA-52453494E6CD} - c:program filesmicrosoft officeoffice14GROOVEEX.DLL LSA: Security Packages =  kerberos msv1_0 schannel wdigest tspkg pku2u livessp mASetup: {8A69D345-D564-463c-AFF1-A69D9E530F96} - "c:program filesgooglechromeapplication30.0.1599.69installerchrmstp.exe" --configure-user-settings --verbose-logging --system-level --multi-install --chrome . ================= FIREFOX =================== . FF - ProfilePath - c:usersuserappdataroamingmozillafirefoxprofilesptoklpuh.default FF - prefs.js: browser.search.defaulturl - FF - prefs.js: browser.search.selectedEngine - Search The Web (privitize) FF - plugin: c:progra~1micros~2office14NPAUTHZ.DLL FF - plugin: c:progra~1micros~2office14NPSPWRAP.DLL FF - plugin: c:program filescommon filesavg secure searchsitesafetyinstaller17.0.12npsitesafety.dll FF - plugin: c:program filesgooglegoogle earthpluginnpgeplugin.dll FF - plugin: c:program filesgoogleupdate1.3.21.153npGoogleUpdate3.dll FF - plugin: c:program filesjavajre7binplugin2npjp2.dll FF - plugin: c:program filesmicrosoft silverlight5.1.20513.0npctrlui.dll FF - plugin: c:program filesmywebsearchbar1.binNPMYWEBS.DLL FF - plugin: c:program filespando networksmedia boosternpPandoWebPlugin.dll FF - plugin: c:program fileswindows livephoto galleryNPWLPG.dll FF - plugin: c:programdatanexoneungmnpNxGameEU.dll FF - plugin: c:usersuserappdatalocalfacebookvideoskypenpFacebookVideoCalling.dll FF - plugin: c:windowssystem32macromedflashNPSWF32_11_8_800_168.dll FF - plugin: c:windowssystem32npDeployJava1.dll FF - plugin: c:windowssystem32npmproxy.dll . ---- FIREFOX POLICIES ---- FF - user.js: extensions.softonic_i.newTab - false FF - user.js: extensions.softonic_i.id - d65288460000000000002c27d72d77db FF - user.js: extensions.softonic_i.instlDay - 15401 FF - user.js: extensions.softonic_i.vrsn - FF - user.js: extensions.softonic_i.vrsni - FF - user.js: extensions.softonic_i.vrsnTs - FF - user.js: extensions.softonic_i.prtnrId - softonic FF - user.js: extensions.softonic_i.prdct - softonic FF - user.js: extensions.softonic_i.aflt - orgnl FF - user.js: extensions.softonic_i.smplGrp - eng7 FF - user.js: extensions.softonic_i.tlbrId - eng7 FF - user.js: extensions.softonic_i.instlRef - MON00001 FF - user.js: extensions.softonic_i.dfltLng - FF - user.js: extensions.softonic_i.excTlbr - false FF - user.js: extensions.privitize.id - d65288460000000000002c27d72d77db FF - user.js: extensions.privitize.appId - {301966DF-A84B-4255-AAB9-574B5CE237E4} FF - user.js: extensions.privitize.instlDay - 15876 FF - user.js: extensions.privitize.vrsn - FF - user.js: extensions.privitize.vrsni - FF - user.js: extensions.privitize.vrsnTs - FF - user.js: extensions.privitize.prtnrId - privitize FF - user.js: extensions.privitize.prdct - privitize FF - user.js: extensions.privitize.aflt - 5 FF - user.js: extensions.privitize.smplGrp - none FF - user.js: extensions.privitize.tlbrId - base FF - user.js: extensions.privitize.instlRef - FF - user.js: extensions.privitize.dfltLng - FF - user.js: extensions.privitize.excTlbr - false FF - user.js: extensions.privitize.ffxUnstlRst - false FF - user.js: extensions.privitize.admin - false FF - user.js: extensions.privitize.autoRvrt - false FF - user.js: extensions.privitize.rvrt - false FF - user.js: extensions.privitize.hmpg - true FF - user.js: extensions.privitize.dfltSrch - true FF - user.js: extensions.privitize.srchPrvdr - Search The Web (privitize) FF - user.js: extensions.privitize.dnsErr - true FF - user.js: extensions.privitize.newTab - true . ============= SERVICES / DRIVERS =============== . R0 MpFilter;Microsoft Malware Protection Driver;c:windowssystem32driversMpFilter.sys [2013-6-18 211560] R1 avgtp;avgtp;c:windowssystem32driversavgtpx86.sys [2012-7-22 37664] R1 dtsoftbus01;DAEMON Tools Virtual Bus Driver;c:windowssystem32driversdtsoftbus01.sys [2011-8-5 232512] R2 Application Updater;Application Updater;c:program filesapplication updaterApplicationUpdater.exe [2013-9-2 807800] R2 Hamachi2Svc;LogMeIn Hamachi Tunneling Engine;d:downloadsmyнова папкаhamachi-2.exe [2013-10-1 1612112] R2 MyWebSearchService;My Web Search Service;c:progra~1mywebs~1bar1.binmwssvc.exe [2011-9-19 34320] R2 RzKLService;RzKLService;d:mcrazer game boosterRzKLService.exe [2013-9-19 106472] R2 Skype C2C Service;Skype C2C Service;c:programdataskypetoolbarsskype c2c servicec2c_service.exe [2013-9-16 3273088] R2 TeamViewer8;TeamViewer 8;c:program filesteamviewerversion8TeamViewer_Service.exe [2013-8-16 4308320] R2 vToolbarUpdater17.0.12;vToolbarUpdater17.0.12;c:program filescommon filesavg secure searchvtoolbarupdater17.0.12ToolbarUpdater.exe [2013-10-2 1734680] R2 WindowsServices;Windows Debug Service;c:windowssystem32driverssfuservice.exe [2011-7-8 785920] R3 RTL8167;Realtek 8167 NT Driver;c:windowssystem32driversRt86win7.sys [2009-3-2 139776] S2 clr_optimization_v4.0.30319_32;Microsoft .NET Framework NGEN v4.0.30319_X86;c:windowsmicrosoft.netframeworkv4.0.30319mscorsvw.exe [2012-7-9 104912] S2 gupdate;Услуга на Google Актуализация (gupdate);c:program filesgoogleupdateGoogleUpdate.exe [2011-8-16 136176] S2 SkypeUpdate;Skype Updater;c:program filesskypeupdaterUpdater.exe [2013-6-21 162408] S3 AdobeFlashPlayerUpdateSvc;Adobe Flash Player Update Service;c:windowssystem32macromedflashFlashPlayerUpdateService.exe [2012-3-30 257416] S3 b57nd60x;Broadcom NetXtreme Gigabit Ethernet - NDIS 6.0;c:windowssystem32driversb57nd60x.sys [2009-7-14 229888] S3 dmvsc;dmvsc;c:windowssystem32driversdmvsc.sys [2010-11-21 62464] S3 GoogleDesktopManager-051210-111108;Диспечер на Google Desktop 5.9.1005.12335;c:program filesgooglegoogle desktop searchGoogleDesktop.exe [2011-9-10 30192] S3 gupdatem;Услуга на Google Актуализация (gupdatem);c:program filesgoogleupdateGoogleUpdate.exe [2011-8-16 136176] S3 Microsoft SharePoint Workspace Audit Service;Microsoft SharePoint Workspace Audit Service;c:program filesmicrosoft officeoffice14GROOVE.EXE [2012-9-20 30785672] S3 MozillaMaintenance;Mozilla Maintenance Service;c:program filesmozilla maintenance servicemaintenanceservice.exe [2012-7-22 118680] S3 NisDrv;Microsoft Network Inspection System;c:windowssystem32driversNisDrvWFP.sys [2011-4-27 107392] S3 NisSrv;Мрежова проверка на Microsoft;c:program filesmicrosoft security clientNisSrv.exe [2013-6-20 295376] S3 osppsvc;Office Software Protection Platform;c:program filescommon filesmicrosoft sharedofficesoftwareprotectionplatformOSPPSVC.EXE [2010-1-9 4640000] S3 RdpVideoMiniport;Remote Desktop Video Miniport Driver;c:windowssystem32driversrdpvideominiport.sys [2010-11-21 15872] S3 StorSvc;Storage Service;c:windowssystem32svchost.exe -k LocalSystemNetworkRestricted [2009-7-14 20992] S3 Synth3dVsc;Synth3dVsc;c:windowssystem32driversSynth3dVsc.sys [2010-11-21 77184] S3 terminpt;Microsoft Remote Desktop Input Driver;c:windowssystem32driversterminpt.sys [2010-11-21 25600] S3 TsUsbFlt;TsUsbFlt;c:windowssystem32driversTsUsbFlt.sys [2010-11-21 52224] S3 TsUsbGD;Remote Desktop Generic USB Device;c:windowssystem32driversTsUsbGD.sys [2010-11-21 27264] S3 tsusbhub;tsusbhub;c:windowssystem32driverstsusbhub.sys [2010-11-21 112640] S3 vvftav211;vvftav211;c:windowssystem32driversvvftav211.sys [2011-8-27 480128] S3 WatAdminSvc;Услуга на технологиите за активиране на Windows;c:windowssystem32watWatAdminSvc.exe [2011-8-5 1343400] S3 ZSMC30x;USB PC Camera Service ZSMC30x;c:windowssystem32driversZS211.sys [2011-8-27 1537024] . =============== Created Last 30 ================ . 2013-10-06 18:30:38  7328304  ----a-w-  c:programdatamicrosoftmicrosoft antimalwaredefinition updates{8127aff6-5691-460e-853c-9df99258f093}mpengine.dll 2013-10-05 17:39:19  --------  d-----w-  c:usersuserappdataroaming.minecraft 2013-10-05 17:28:55  7328304  ----a-w-  c:programdatamicrosoftmicrosoft antimalwaredefinition updatesbackupmpengine.dll 2013-10-03 10:17:21  --------  d-----w-  c:usersuserappdatalocalLogMeIn 2013-10-03 10:17:21  --------  d-----w-  c:programdataLogMeIn 2013-09-30 17:52:09  --------  d-----w-  c:program filesAcclaim Entertainment 2013-09-30 16:10:23  --------  d-----w-  c:program filesSimilarSites 2013-09-30 16:10:19  --------  d-----w-  c:usersuserappdataroamingSimilarSites 2013-09-11 17:49:49  --------  d-----w-  c:programdataNexon 2013-09-11 17:33:20  --------  d-----w-  c:programdataNexonEU 2013-09-11 16:49:56  --------  d-----w-  c:usersuserappdatalocalAkamai 2013-09-09 17:09:22  --------  d--h--w-  c:program filesTemp . ==================== Find3M  ==================== . 2013-10-02 15:06:23  37664  ----a-w-  c:windowssystem32driversavgtpx86.sys 2013-09-21 18:08:08  692616  ----a-w-  c:windowssystem32FlashPlayerApp.exe 2013-09-21 18:08:07  71048  ----a-w-  c:windowssystem32FlashPlayerCPLApp.cpl 2013-08-10 03:59:10  1767936  ----a-w-  c:windowssystem32wininet.dll 2013-08-10 03:58:09  2876928  ----a-w-  c:windowssystem32jscript9.dll 2013-08-10 03:58:06  61440  ----a-w-  c:windowssystem32iesetup.dll 2013-08-10 03:58:06  109056  ----a-w-  c:windowssystem32iesysprep.dll 2013-08-10 03:07:50  2706432  ----a-w-  c:windowssystem32mshtml.tlb 2013-08-10 02:17:19  71680  ----a-w-  c:windowssystem32RegisterIEPKEYs.exe 2013-08-08 01:03:07  2348544  ----a-w-  c:windowssystem32win32k.sys 2013-08-05 01:56:47  133056  ----a-w-  c:windowssystem32driversataport.sys 2013-08-02 01:50:36  169984  ----a-w-  c:windowssystem32winsrv.dll 2013-08-02 01:49:19  293376  ----a-w-  c:windowssystem32KernelBase.dll 2013-08-02 00:52:57  271360  ----a-w-  c:windowssystem32conhost.exe 2013-08-02 00:43:05  6144  ---ha-w-  c:windowssystem32api-ms-win-security-base-l1-1-0.dll 2013-08-02 00:43:05  4608  ---ha-w-  c:windowssystem32api-ms-win-core-threadpool-l1-1-0.dll 2013-08-02 00:43:05  3584  ---ha-w-  c:windowssystem32api-ms-win-core-xstate-l1-1-0.dll 2013-08-02 00:43:05  3072  ---ha-w-  c:windowssystem32api-ms-win-core-util-l1-1-0.dll 2013-07-25 08:57:27  1620992  ----a-w-  c:windowssystem32WMVDECOD.DLL 2013-07-19 01:41:01  2048  ----a-w-  c:windowssystem32tzres.dll . ============= FINISH: 19:15:00,70 ===============  








. UNLESS SPECIFICALLY INSTRUCTED, DO NOT POST THIS LOG. IF REQUESTED, ZIP IT UP & ATTACH IT . DDS (Ver_2011-09-30.01) . Microsoft Windows 7 Enterprise Boot Device: DeviceHarddiskVolume1 Install Date: 5.8.2011 г. 12:40:24 System Uptime: 7.10.2013 г. 18:14:02 (1 hours ago) . Motherboard: FOXCONN |  | 2A8C Processor: Pentium® Dual-Core  CPU   E5800  @ 3.20GHz | CPU 1 | 3203/800mhz . ==== Disk Partitions ========================= . C: is FIXED (NTFS) - 49 GiB total, 18,056 GiB free. D: is FIXED (NTFS) - 249 GiB total, 163,313 GiB free. E: is CDROM (CDFS) F: is CDROM () G: is Removable H: is CDROM () . ==== Disabled Device Manager Items ============= . ==== System Restore Points =================== . RP452: 6.10.2013 г. 21:30:22 - Windows Update . ==== Installed Programs ====================== .  toolbar   Фотогалерия на Windows Live µTorrent Русификатор Rettungswagen Simulator 2012 4x4 Hummer Ace of Spades Adobe AIR Adobe Download Assistant Adobe Flash Player 11 ActiveX Adobe Flash Player 11 Plugin Akamai NetSession Interface Animated Wallpaper - Snowy Desktop 3D Apple Software Update Bandisoft MPEG-1 Decoder BeamNG-Techdemo-0.3 (remove only) Cabela's 4x4 Off-Road Adventure  2 Call of Juarez Camtasia Studio 8 CCleaner ClipGrab Clownfish for Skype Combat Arms EU Counter-Strike 1.6 Counter-Strike 1.6 Escom 3d!7!0n - by AmaRelle v1.0 Counter-Strike 1.6: New Era Counter-Strike Mega Edition v2.0 Counter-Strike Source, версия 1765266 Craften Terminal 3.3.4897.28268 CSS_Update_from_v1765266_to_v1765266_210513 1.00 D3DX10 DAEMON Tools Lite Dead Space™ Decal Converter Deer Hunter 2004 - Legendary Hunting Definition Update for Microsoft Office 2010 (KB982726) 32-Bit Edition DJ Studio Pro Driver Genius Professional Edition Driver Sweeper version 3.2.0 Dxtory License Cracked Dxtory version 2.0.112 Euro Truck Simulator 2 Facebook Video Calling FIFA 11 FormatFactory 3.0.1 Fraps (remove only) Free Studio version GamersFirst LIVE! German Truck Simulator Google Земя Google Chrome Google Desktop Google Update Helper Grand Theft Auto Vice City GTA San Andreas Hero_Online Iminent IMinent Toolbar Intel Drivers Update Utility Intel® Graphics Media Accelerator Driver ItaEst - Taka e! Java 7 Update 25 Java Auto Updater Java 6 Update 31 JavaFX 2.1.1 K-Lite Codec Pack 7.5.0 (Standard) League of Legends LogMeIn Hamachi Magic The Gathering Tactics MagniPic Malwarebytes Anti-Malware, версия Medal of Honor Microsoft .NET Framework 1.1 Microsoft .NET Framework 4.5 Microsoft Antimalware Service BG-BG Language Pack Microsoft Application Error Reporting Microsoft Games for Windows - LIVE Microsoft Games for Windows - LIVE Redistributable Microsoft Office 2010 Service Pack 1 (SP1) Microsoft Office Access MUI (English) 2010 Microsoft Office Access Setup Metadata MUI (English) 2010 Microsoft Office Excel MUI (English) 2010 Microsoft Office Groove MUI (English) 2010 Microsoft Office InfoPath MUI (English) 2010 Microsoft Office OneNote MUI (English) 2010 Microsoft Office Outlook MUI (English) 2010 Microsoft Office PowerPoint MUI (English) 2010 Microsoft Office Professional Plus 2010 Microsoft Office Proof (English) 2010 Microsoft Office Proof (French) 2010 Microsoft Office Proof (Spanish) 2010 Microsoft Office Proofing (English) 2010 Microsoft Office Publisher MUI (English) 2010 Microsoft Office Shared MUI (English) 2010 Microsoft Office Shared Setup Metadata MUI (English) 2010 Microsoft Office Word MUI (English) 2010 Microsoft Security Client Microsoft Security Client BG-BG Language Pack Microsoft Security Essentials Microsoft Silverlight Microsoft SQL Server 2005 Compact Edition [ENU] Microsoft Visual C++ 2005 Redistributable Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.17 Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.6161 Microsoft XNA Framework Redistributable 4.0 Minecraft Minecraft 1.6.2 Minecraft1.6.2 Mozilla Firefox 24.0 (x86 bg) Mozilla Maintenance Service MSVCRT MSVCRT Redists MSXML 4.0 SP2 (KB954430) MSXML 4.0 SP2 (KB973688) MTA:SA v1.3.1 My Web Search (MyWebFace) Need For Speed™ World Nokia Connectivity Cable Driver NVIDIA PhysX OMSI - Der Omnibussimulator OpenAL Opera 12.14 Pando Media Booster PunkBuster Services Race Driver: GRID Razer Game Booster Realtek High Definition Audio Driver Recuva Revolt Safari Security Update for CAPICOM (KB931906) Security Update for Microsoft .NET Framework 4.5 (KB2737083) Security Update for Microsoft .NET Framework 4.5 (KB2742613) Security Update for Microsoft .NET Framework 4.5 (KB2789648) Security Update for Microsoft .NET Framework 4.5 (KB2804582) Security Update for Microsoft .NET Framework 4.5 (KB2833957) Security Update for Microsoft .NET Framework 4.5 (KB2840642v2) Security Update for Microsoft Excel 2010 (KB2597126) 32-Bit Edition Security Update for Microsoft Filter Pack 2.0 (KB2553501) 32-Bit Edition Security Update for Microsoft InfoPath 2010 (KB2687417) 32-Bit Edition Security Update for Microsoft InfoPath 2010 (KB2687422) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2553091) Security Update for Microsoft Office 2010 (KB2553096) Security Update for Microsoft Office 2010 (KB2553371) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2553447) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2589320) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2598243) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2687501) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2687510) 32-Bit Edition Security Update for Microsoft OneNote 2010 (KB2760600) 32-Bit Edition Security Update for Microsoft Visio 2010 (KB2760762) 32-Bit Edition Security Update for Microsoft Visio Viewer 2010 (KB2687505) 32-Bit Edition Security Update for Microsoft Word 2010 (KB2760410) 32-Bit Edition Skype Click to Call Skype™ 6.6 Speccy Steam System Requirements Lab CYRI System Requirements Lab for Intel TeamViewer 8 TOAoT-315-UTMod-v2 uGet, версия 2.0.6 Update for Microsoft .NET Framework 4.5 (KB2750147) Update for Microsoft .NET Framework 4.5 (KB2805221) Update for Microsoft .NET Framework 4.5 (KB2805226) Update for Microsoft Office 2010 (KB2494150) Update for Microsoft Office 2010 (KB2553065) Update for Microsoft Office 2010 (KB2553092) Update for Microsoft Office 2010 (KB2553181) 32-Bit Edition Update for Microsoft Office 2010 (KB2553267) 32-Bit Edition Update for Microsoft Office 2010 (KB2553310) 32-Bit Edition Update for Microsoft Office 2010 (KB2553378) 32-Bit Edition Update for Microsoft Office 2010 (KB2566458) Update for Microsoft Office 2010 (KB2596964) 32-Bit Edition Update for Microsoft Office 2010 (KB2598242) 32-Bit Edition Update for Microsoft Office 2010 (KB2687503) 32-Bit Edition Update for Microsoft Office 2010 (KB2687509) 32-Bit Edition Update for Microsoft Office 2010 (KB2760631) 32-Bit Edition Update for Microsoft Office 2010 (KB2767886) 32-Bit Edition Update for Microsoft OneNote 2010 (KB2553290) 32-Bit Edition Update for Microsoft Outlook 2010 (KB2597090) 32-Bit Edition Update for Microsoft Outlook 2010 (KB2687623) 32-Bit Edition Update for Microsoft Outlook Social Connector 2010 (KB2553406) 32-Bit Edition Update for Microsoft PowerPoint 2010 (KB2553145) 32-Bit Edition Update for Microsoft PowerPoint 2010 (KB2598240) 32-Bit Edition Update for Microsoft SharePoint Workspace 2010 (KB2589371) 32-Bit Edition Vegas Pro 10.0 Vegas Pro 11.0 VirtualDJ Home FREE Windows Live Communications Platform Windows Live Essentials Windows Live ID Sign-in Assistant Windows Live Installer Windows Live Movie Maker Windows Live Photo Common Windows Live Photo Gallery Windows Live PIMT Platform Windows Live SOXE Windows Live SOXE Definitions Windows Live UX Platform Windows Live UX Platform Language Pack WinRAR 4.01 (32-bit) WolfQuest World of Warcraft Trial YTD Toolbar v7.6 ZSMC USB PC Camera (ZS0211) . ==== Event Viewer Messages From Past Week ======== . 7.10.2013 г. 18:14:19, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 7.10.2013 г. 15:48:24, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 7.10.2013 г. 15:48:24, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 7.10.2013 г. 14:00:17, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 21:19:09, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 17:01:23, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 14:51:05, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 6.10.2013 г. 14:51:05, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 6.10.2013 г. 14:18:05, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 02:02:15, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 6.10.2013 г. 02:02:15, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 5.10.2013 г. 21:55:16, Error: volsnap [36]  - The shadow copies of volume C: were aborted because the shadow copy storage could not grow due to a user imposed limit. 5.10.2013 г. 21:29:31, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 5.10.2013 г. 20:07:11, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 5.10.2013 г. 20:07:11, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 5.10.2013 г. 18:58:06, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 5.10.2013 г. 14:12:14, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 5.10.2013 г. 12:45:09, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 4.10.2013 г. 22:51:38, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 4.10.2013 г. 19:20:14, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 4.10.2013 г. 19:20:14, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 4.10.2013 г. 17:06:51, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 4.10.2013 г. 17:06:51, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 4.10.2013 г. 16:37:10, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 4.10.2013 г. 16:37:09, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 4.10.2013 г. 15:27:47, Error: bowser [8003]  - The master browser has received a server announcement from the computer SKIOOOO-PC that believes that it is the master browser for the domain on transport NetBT_Tcpip_{86D84905-0331-4FB8-A5E0-AAB038C. The master browser is stopping or an election is being forced. 4.10.2013 г. 13:20:44, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 30.9.2013 г. 21:07:08, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 21:07:08, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 20:14:39, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 20:14:39, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 20:11:32, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 30.9.2013 г. 18:28:52, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 18:28:52, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 18:01:50, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 30.9.2013 г. 15:08:31, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 15:08:31, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 14:46:07, Error: bowser [8003]  - The master browser has received a server announcement from the computer SKIOOOO-PC that believes that it is the master browser for the domain on transport NetBT_Tcpip_{86D84905-0331-4FB8-A5E0-AAB038C. The master browser is stopping or an election is being forced. 30.9.2013 г. 14:43:25, Error: volsnap [36]  - The shadow copies of volume C: were aborted because the shadow copy storage could not grow due to a user imposed limit. 30.9.2013 г. 13:51:20, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 3.10.2013 г. 19:57:52, Error: bowser [8003]  - The master browser has received a server announcement from the computer SKIOOOO-PC that believes that it is the master browser for the domain on transport NetBT_Tcpip_{86D84905-0331-4FB8-A5E0-AAB038C. The master browser is stopping or an election is being forced. 3.10.2013 г. 15:14:42, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 3.10.2013 г. 15:14:42, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 3.10.2013 г. 14:56:51, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 3.10.2013 г. 14:56:51, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 3.10.2013 г. 14:18:33, Error: volsnap [36]  - The shadow copies of volume C: were aborted because the shadow copy storage could not grow due to a user imposed limit. 3.10.2013 г. 13:16:54, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 2.10.2013 г. 19:41:38, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 2.10.2013 г. 19:41:38, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 2.10.2013 г. 18:07:00, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга LogMeIn Hamachi Tunneling Engine да се свърже. 2.10.2013 г. 18:07:00, Error: Service Control Manager [7000]  - Услуга LogMeIn Hamachi Tunneling Engine не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 2.10.2013 г. 18:06:36, Error: Service Control Manager [7030]  - Услуга LogMeIn Hamachi Tunneling Engine е маркирана като интерактивна услуга. Обаче системата е конфигурирана да не допуска интерактивни услуги. Тази услуга може да не функционира правилно. 2.10.2013 г. 18:05:49, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 1.10.2013 г. 21:20:10, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 1.10.2013 г. 21:20:10, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 1.10.2013 г. 19:11:04, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 1.10.2013 г. 19:11:04, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 1.10.2013 г. 18:14:14, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 1.10.2013 г. 16:14:45, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 1.10.2013 г. 16:14:45, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 1.10.2013 г. 15:22:26, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. . ==== End Of File ===========================  

Сподели този отговор

Линк към този отговор
Сподели в други сайтове





# AdwCleaner v3.006 - Report created 08/10/2013 at 14:17:20
# Updated 01/10/2013 by Xplode
# Operating System : Windows 7 Enterprise Service Pack 1 (32 bits)
# Username : User - HP
# Running from : C:UsersUserDownloadsadwcleaner.exe
# Option : Clean

***** [ Services ] *****

Service Deleted : Application Updater
Service Deleted : MyWebSearchService

***** [ Files / Folders ] *****

Folder Deleted : C:ProgramDataAVG Secure Search
Folder Deleted : C:ProgramDataBabylon
Folder Deleted : C:ProgramDataclsoft ltd
Folder Deleted : C:ProgramDataIminent
Folder Deleted : C:ProgramDataPremium
Folder Deleted : C:ProgramDataMaginiPPicc
Folder Deleted : C:ProgramDataMicrosoftWindowsStart MenuProgramsTheBflix
Folder Deleted : C:ProgramDataMicrosoftWindowsStart MenuProgramsMaginiPPicc
Folder Deleted : C:Program FilesApplication Updater
Folder Deleted : C:Program FilesAVG Secure Search
Folder Deleted : C:Program FilesIndustriya
Folder Deleted : C:Program FilesMagniPic
Folder Deleted : C:Program FilesMyWebSearch
Folder Deleted : C:Program FilesSimilarSites
Folder Deleted : C:Program FilesCommon FilesAVG Secure Search
Folder Deleted : C:Program FilesCommon Filesspigot
Folder Deleted : C:UsersUserAppDataLocalAVG Secure Search
Folder Deleted : C:UsersUserAppDataLocalBabylon
Folder Deleted : C:UsersUserAppDataLocalLowAVG Secure Search
Folder Deleted : C:UsersUserAppDataLocalLowFunWebProducts
Folder Deleted : C:UsersUserAppDataLocalLowIndustriya
Folder Deleted : C:UsersUserAppDataLocalLowMyWebSearch
Folder Deleted : C:UsersUserAppDataLocalLowSearch Settings
Folder Deleted : C:UsersUserAppDataLocalLowTheBflix
Folder Deleted : C:UsersUserAppDataLocalLowMaginiPPicc
Folder Deleted : C:UsersUserAppDataRoamingdvdvideosoftiehelpers
Folder Deleted : C:UsersUserAppDataRoamingIminent
Folder Deleted : C:UsersUserAppDataRoamingIndustriya
Folder Deleted : C:UsersUserAppDataRoamingSimilarSites
File Deleted : C:END
File Deleted : C:Program FilesMozilla Firefoxsearchpluginsavg-secure-search.xml
File Deleted : C:Program FilesMozilla FirefoxsearchpluginsBabylon.xml
File Deleted : C:UsersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultsearchpluginsSearchTheWeb.xml
File Deleted : C:UsersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultuser.js

***** [ Shortcuts ] *****

***** [ Registry ] *****

Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [{ACAA314B-EEBA-48E4-AD47-84E31C44796C}]
Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [Avg@toolbar]
Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [m3ffxtbr@mywebsearch.com]
Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [webbooster@iminent.com]
Key Deleted : HKLMSOFTWAREGoogleChromeExtensionsigdhbblpcellaljokkpfhcjlagemhgjl
Key Deleted : HKLMSOFTWAREGoogleChromeExtensionsndibdjnfmopecpmkdieinmbadjfpblof
Key Deleted : HKLMSOFTWAREClassesAppIDescort.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDescortApp.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDescortEng.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDescorTlbr.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDesrv.EXE
Key Deleted : HKLMSOFTWAREClassesAppIDIminent.WebBooster.InternetExplorer.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDScriptHelper.EXE
Key Deleted : HKLMSOFTWAREClassesAppIDTbCommonUtils.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDTbHelper.EXE
Key Deleted : HKLMSOFTWAREClassesAppIDViProtocol.DLL
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.BrowserWndAPI
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.BrowserWndAPI.1
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.PugiObj
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.PugiObj.1
Key Deleted : HKLMSOFTWAREClassesbhoclass.bho.bhoclass.bho
Key Deleted : HKLMSOFTWAREClassesescort.escortIEPane
Key Deleted : HKLMSOFTWAREClassesescort.escortIEPane.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.DataControl
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.DataControl.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistoryKillerScheduler
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistoryKillerScheduler.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistorySwatterControlBar
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistorySwatterControlBar.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HTMLMenu
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HTMLMenu.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HTMLMenu.2
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.IECookiesManager
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.IECookiesManager.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.KillerObjManager
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.KillerObjManager.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterBarButton
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterBarButton.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterSettingsControl
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterSettingsControl.1
Key Deleted : HKLMSOFTWAREClassesIminent
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ChatSessionPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ChatSessionPlugin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.HTMLPanel
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.HTMLPanel.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.MultipleButton
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.MultipleButton.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.OutlookAddin
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.OutlookAddin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.PseudoTransparentPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.PseudoTransparentPlugin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ThirdPartyInstaller
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ThirdPartyInstaller.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.UrlAlertButton
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.UrlAlertButton.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.SettingsPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.SettingsPlugin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.ToolbarPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.ToolbarPlugin.1
Key Deleted : HKLMSOFTWAREClassesprivitize.privitizeHlpr
Key Deleted : HKLMSOFTWAREClassesprivitize.privitizeHlpr.1
Key Deleted : HKLMSOFTWAREClassesProd.cap
Key Deleted : HKLMSOFTWAREClassesprotocolshandlerviprotocol
Key Deleted : HKLMSOFTWAREClassesS
Key Deleted : HKLMSOFTWAREClassesScreenSaverControl.ScreenSaverInstaller
Key Deleted : HKLMSOFTWAREClassesScreenSaverControl.ScreenSaverInstaller.1
Key Deleted : HKLMSOFTWAREClassesScriptHelper.ScriptHelperApi
Key Deleted : HKLMSOFTWAREClassesScriptHelper.ScriptHelperApi.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbDownloadManager
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbDownloadManager.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbPropertyManager
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbPropertyManager.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbRequest
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbRequest.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbTask
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbTask.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.ToolbarHelper
Key Deleted : HKLMSOFTWAREClassesTbHelper.ToolbarHelper.1
Key Deleted : HKLMSOFTWAREClassesToolbar3.ContextMenuNotifier
Key Deleted : HKLMSOFTWAREClassesToolbar3.ContextMenuNotifier.1
Key Deleted : HKLMSOFTWAREClassesToolbar3.CustomInternetSecurityImpl
Key Deleted : HKLMSOFTWAREClassesToolbar3.CustomInternetSecurityImpl.1
Key Deleted : HKLMSOFTWAREClassesViProtocol.ViProtocolOLE
Key Deleted : HKLMSOFTWAREClassesViProtocol.ViProtocolOLE.1
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsRunDll32Policyf3ScrCtr.dll
Key Deleted : HKLMSOFTWAREMicrosoftMultimediaWMPlayerSchemesf3pss
Key Deleted : HKLMSOFTWAREMicrosoftOfficeOutlookAddinsMyWebSearch.OutlookAddin
Key Deleted : HKLMSOFTWAREMicrosoftOfficeWordAddinsMyWebSearch.OutlookAddin
Key Deleted : HKLMSOFTWAREMicrosoftShared ToolsMSConfigstartupregIminent
Key Deleted : HKLMSOFTWAREMicrosoftShared ToolsMSConfigstartupregIminentMessenger
Key Deleted : HKLMSOFTWAREMicrosoftTracingAskPIP_FF__RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingAskPIP_FF__RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingIminent_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingIminent_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingsoftonic_ggl_1_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingsoftonic_ggl_1_RASMANCS
Value Deleted : HKLMSOFTWAREMicrosoftWindows MediaWmsdkSources [F3PopularScreenSavers]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionInternet Settings5.0User AgentPost Platform [FunWebProducts]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionInternet SettingsUser Agentpost platform [FunWebProducts]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionRun [searchSettings]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionRun [vProt]
Key Deleted : HKLMSOFTWAREMozillaPlugins@avg.com/AVG SiteSafety plugin,version=,application/x-avg-sitesafety-plugin
Key Deleted : HKLMSOFTWAREMozillaPlugins@mywebsearch.com/Plugin
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstallSP_d8283021
Key Deleted : HKLMSOFTWAREClassesTBSB01620.IEToolbar
Key Deleted : HKLMSOFTWAREClassesTBSB01620.IEToolbar.1
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_brawl-busters_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_brawl-busters_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_c-medieval_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_c-medieval_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_camstudio_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_camstudio_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_everest_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_everest_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_flashget_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_flashget_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_format-factory_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_format-factory_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gravity-defied---trial-racing_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gravity-defied---trial-racing_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas(1)_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas(1)_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hamachi_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hamachi_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_happy-wheels_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_happy-wheels_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hero-online_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hero-online_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_league-of-legends_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_league-of-legends_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_microsoft-flight-simulator_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_microsoft-flight-simulator_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_san-andreas-multiplayer_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_san-andreas-multiplayer_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_second-life_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_second-life_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_sony-vegas-video_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_sony-vegas-video_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_tactical-ops-assault-on-terror_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_tactical-ops-assault-on-terror_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_talking-tom-cat_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_talking-tom-cat_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_virtual-families_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_virtual-families_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_world-of-warcraft_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_world-of-warcraft_RASMANCS
Key Deleted : HKLMSOFTWAREClassesAppID{01994268-3C10-4044-A1EA-7A9C1B739A11}
Key Deleted : HKLMSOFTWAREClassesAppID{09C554C3-109B-483C-A06B-F14172F1A947}
Key Deleted : HKLMSOFTWAREClassesAppID{1FDFF5A2-7BB1-48E1-8081-7236812B12B2}
Key Deleted : HKLMSOFTWAREClassesAppID{4CE516A7-F7AC-4628-B411-8F886DC5733E}
Key Deleted : HKLMSOFTWAREClassesAppID{4E1E9D45-8BF9-4139-915C-9F83CC3D5921}
Key Deleted : HKLMSOFTWAREClassesAppID{628F3201-34D0-49C0-BB9A-82A26AEFB291}
Key Deleted : HKLMSOFTWAREClassesAppID{B12E99ED-69BD-437C-86BE-C862B9E5444D}
Key Deleted : HKLMSOFTWAREClassesAppID{BB711CB0-C70B-482E-9852-EC05EBD71DBB}
Key Deleted : HKLMSOFTWAREClassesAppID{D7EE8177-D51E-4F89-92B6-83EA2EC40800}
Key Deleted : HKLMSOFTWAREClassesCLSID{02054E11-5113-4BE3-8153-AA8DFB5D3761}
Key Deleted : HKLMSOFTWAREClassesCLSID{02C9C7B0-C7C8-4AAC-A9E4-55295BF60F8F}
Key Deleted : HKLMSOFTWAREClassesCLSID{0398B101-6DA7-473F-A290-17D2FBC88CC0}
Key Deleted : HKLMSOFTWAREClassesCLSID{08858AF6-42AD-4914-95D2-AC3AB0DC8E28}
Key Deleted : HKLMSOFTWAREClassesCLSID{0CC36196-8589-4B80-A771-D659411D7F90}
Key Deleted : HKLMSOFTWAREClassesCLSID{0F8ECF4F-3646-4C3A-8881-8E138FFCAF70}
Key Deleted : HKLMSOFTWAREClassesCLSID{143D96F9-EB64-48B3-B192-91C2C41A1F43}
Key Deleted : HKLMSOFTWAREClassesCLSID{147A976F-EEE1-4377-8EA7-4716E4CDD239}
Key Deleted : HKLMSOFTWAREClassesCLSID{14F7D91F-F669-45C9-9F42-BACBFDB86EAD}
Key Deleted : HKLMSOFTWAREClassesCLSID{187A6488-6E71-4A2A-B118-7BEFBFE58257}
Key Deleted : HKLMSOFTWAREClassesCLSID{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKLMSOFTWAREClassesCLSID{25560540-9571-4D7B-9389-0F166788785A}
Key Deleted : HKLMSOFTWAREClassesCLSID{2D065204-A024-4C39-8A38-EE7078EC7ACF}
Key Deleted : HKLMSOFTWAREClassesCLSID{30F5476C-677B-4DB0-B397-51F5BFD86840}
Key Deleted : HKLMSOFTWAREClassesCLSID{3223F2FB-D9B9-45FC-9D66-CD717FFA4EE5}
Key Deleted : HKLMSOFTWAREClassesCLSID{351798B1-C1D2-45AB-92B4-4D6C2D6AB5AF}
Key Deleted : HKLMSOFTWAREClassesCLSID{35B8892D-C3FB-4D88-990D-31DB2EBD72BD}
Key Deleted : HKLMSOFTWAREClassesCLSID{3AEA1BEF-6195-46F4-ACA2-0ED14F7EFA1B}
Key Deleted : HKLMSOFTWAREClassesCLSID{3D7F9AC3-BAC3-4E51-81D7-D121D79E550A}
Key Deleted : HKLMSOFTWAREClassesCLSID{3DC201FB-E9C9-499C-A11F-23C360D7C3F8}
Key Deleted : HKLMSOFTWAREClassesCLSID{3E720452-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesCLSID{4498C5E9-93C6-4142-B6BE-F0C6DC48B77A}
Key Deleted : HKLMSOFTWAREClassesCLSID{479BF2D6-E362-4A99-B1AB-BC764D7B97AE}
Key Deleted : HKLMSOFTWAREClassesCLSID{492A108F-51D0-4BD8-899D-AD4AB2893064}
Key Deleted : HKLMSOFTWAREClassesCLSID{4B6D6E60-FBD2-4E79-BF4B-886BC98F1797}
Key Deleted : HKLMSOFTWAREClassesCLSID{4E92DB5F-AAD9-49D3-8EAB-B40CBE5B1FF7}
Key Deleted : HKLMSOFTWAREClassesCLSID{60893E02-2E5B-43F9-A93A-BAD60C2DF6EF}
Key Deleted : HKLMSOFTWAREClassesCLSID{63D0ED2C-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREClassesCLSID{67FA02C4-AB30-4E77-A640-78EE8EC8673B}
Key Deleted : HKLMSOFTWAREClassesCLSID{6D39931F-451E-4BDD-BAF4-37FB96DBBA5D}
Key Deleted : HKLMSOFTWAREClassesCLSID{7473D292-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{7473D294-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{7473D296-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{76C684D2-C35D-4284-976A-D862F53ADB81}
Key Deleted : HKLMSOFTWAREClassesCLSID{796D822A-C3F9-4A97-BAAB-42FE7628EA63}
Key Deleted : HKLMSOFTWAREClassesCLSID{799391D3-EB86-4BAC-9BD3-CBFEA58A0E15}
Key Deleted : HKLMSOFTWAREClassesCLSID{79EF3691-EC1A-4705-A01A-D2E36EC11758}
Key Deleted : HKLMSOFTWAREClassesCLSID{819FFE22-35C7-4925-8CDA-4E0E2DB94302}
Key Deleted : HKLMSOFTWAREClassesCLSID{82F41418-8E64-47EB-A7F1-4702A974D289}
Key Deleted : HKLMSOFTWAREClassesCLSID{84DA4FDF-A1CF-4195-8688-3E961F505983}
Key Deleted : HKLMSOFTWAREClassesCLSID{85D920CE-63A7-46DC-8992-41D1D2E07FAD}
Key Deleted : HKLMSOFTWAREClassesCLSID{895ED5E8-ABB4-40C3-A0CA-2571964268E2}
Key Deleted : HKLMSOFTWAREClassesCLSID{898EA8C8-E7FF-479B-8935-AEC46303B9E5}
Key Deleted : HKLMSOFTWAREClassesCLSID{8AAC123A-1959-4A45-BFC5-E2D50783098A}
Key Deleted : HKLMSOFTWAREClassesCLSID{8E6F1832-9607-4440-8530-13BE7C4B1D14}
Key Deleted : HKLMSOFTWAREClassesCLSID{933B95E2-E7B7-4AD9-B952-7AC336682AE3}
Key Deleted : HKLMSOFTWAREClassesCLSID{938AA51A-996C-4884-98CE-80DD16A5C9DA}
Key Deleted : HKLMSOFTWAREClassesCLSID{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKLMSOFTWAREClassesCLSID{98D9753D-D73B-42D5-8C85-4469CDA897AB}
Key Deleted : HKLMSOFTWAREClassesCLSID{9AFB8248-617F-460D-9366-D71CDEDA3179}
Key Deleted : HKLMSOFTWAREClassesCLSID{9FF05104-B030-46FC-94B8-81276E4E27DF}
Key Deleted : HKLMSOFTWAREClassesCLSID{A07956CD-81F8-4A03-B524-5D87E690DC83}
Key Deleted : HKLMSOFTWAREClassesCLSID{A4730EBE-43A6-443E-9776-36915D323AD3}
Key Deleted : HKLMSOFTWAREClassesCLSID{A9571378-68A1-443D-B082-284F960C6D17}
Key Deleted : HKLMSOFTWAREClassesCLSID{ADB01E81-3C79-4272-A0F1-7B2BE7A782DC}
Key Deleted : HKLMSOFTWAREClassesCLSID{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKLMSOFTWAREClassesCLSID{B25AEDC4-8086-41E3-8349-328223FA9FCB}
Key Deleted : HKLMSOFTWAREClassesCLSID{B5E3B26B-6E5C-4865-A63D-58D04B10E245}
Key Deleted : HKLMSOFTWAREClassesCLSID{B658800C-F66E-4EF3-AB85-6C0C227862A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{B813095C-81C0-4E40-AA14-67520372B987}
Key Deleted : HKLMSOFTWAREClassesCLSID{B84D2DC5-42B2-4E5E-BF61-7B48152FF8EF}
Key Deleted : HKLMSOFTWAREClassesCLSID{B89D5309-0367-4494-A92F-3D4C94F88307}
Key Deleted : HKLMSOFTWAREClassesCLSID{C014EBF8-8854-448B-B5A4-557C4090EDCE}
Key Deleted : HKLMSOFTWAREClassesCLSID{C31191DB-2F64-464C-B97C-6AC81ACB7AAC}
Key Deleted : HKLMSOFTWAREClassesCLSID{C342C7A7-F622-4EF3-8B7F-ABB9FBE73F14}
Key Deleted : HKLMSOFTWAREClassesCLSID{C4765B07-BC2F-477B-925C-B2BF24887823}
Key Deleted : HKLMSOFTWAREClassesCLSID{C875C0A1-09E3-48D5-9F8E-BD337796FD14}
Key Deleted : HKLMSOFTWAREClassesCLSID{C9D7BE3E-141A-4C85-8CD6-32461F3DF2C7}
Key Deleted : HKLMSOFTWAREClassesCLSID{CD126DA6-FF5B-4181-AC13-54A62240D2FA}
Key Deleted : HKLMSOFTWAREClassesCLSID{CFF4CE82-3AA2-451F-9B77-7165605FB835}
Key Deleted : HKLMSOFTWAREClassesCLSID{D858DAFC-9573-4811-B323-7011A3AA7E61}
Key Deleted : HKLMSOFTWAREClassesCLSID{D9FFFB27-D62A-4D64-8CEC-1FF006528805}
Key Deleted : HKLMSOFTWAREClassesCLSID{DD438708-AAB4-422D-A322-B619589F5680}
Key Deleted : HKLMSOFTWAREClassesCLSID{DE9028D0-5FFA-4E69-94E3-89EE8741F468}
Key Deleted : HKLMSOFTWAREClassesCLSID{E79DFBCA-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesCLSID{E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39}
Key Deleted : HKLMSOFTWAREClassesCLSID{E812AE43-7799-4E67-8CF8-4104297A2D16}
Key Deleted : HKLMSOFTWAREClassesCLSID{F0BAAEC7-9AE0-49FF-9C4B-86E774FF397F}
Key Deleted : HKLMSOFTWAREClassesCLSID{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKLMSOFTWAREClassesCLSID{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKLMSOFTWAREClassesCLSID{F92193FD-2243-4401-9ACC-49FF30885898}
Key Deleted : HKLMSOFTWAREClassesCLSID{FD21B8A2-910B-45AC-9C10-45E6A8B84984}
Key Deleted : HKLMSOFTWAREClassesInterface{01947140-417F-46B6-8751-A3A2B8345E1A}
Key Deleted : HKLMSOFTWAREClassesInterface{021B4049-F57D-4565-A693-FD3B04786BFA}
Key Deleted : HKLMSOFTWAREClassesInterface{0362AA09-808D-48E9-B360-FB51A8CBCE09}
Key Deleted : HKLMSOFTWAREClassesInterface{03E2A1F3-4402-4121-8B35-733216D61217}
Key Deleted : HKLMSOFTWAREClassesInterface{06844020-CD0B-3D3D-A7FE-371153013E49}
Key Deleted : HKLMSOFTWAREClassesInterface{07B18EAC-A523-4961-B6BB-170DE4475CCA}
Key Deleted : HKLMSOFTWAREClassesInterface{0ADC01BB-303B-3F8E-93DA-12C140E85460}
Key Deleted : HKLMSOFTWAREClassesInterface{1093995A-BA37-41D2-836E-091067C4AD17}
Key Deleted : HKLMSOFTWAREClassesInterface{10D3722F-23E6-3901-B6C1-FF6567121920}
Key Deleted : HKLMSOFTWAREClassesInterface{120927BF-1700-43BC-810F-FAB92549B390}
Key Deleted : HKLMSOFTWAREClassesInterface{1675E62B-F911-3B7B-A046-EB57261212F3}
Key Deleted : HKLMSOFTWAREClassesInterface{17DE5E5E-BFE3-4E83-8E1F-8755795359EC}
Key Deleted : HKLMSOFTWAREClassesInterface{192929F2-9273-3894-91B0-F54671C4C861}
Key Deleted : HKLMSOFTWAREClassesInterface{1F52A5FA-A705-4415-B975-88503B291728}
Key Deleted : HKLMSOFTWAREClassesInterface{247A115F-06C2-4FB3-967D-2D62D3CF4F0A}
Key Deleted : HKLMSOFTWAREClassesInterface{2932897E-3036-43D9-8A64-B06447992065}
Key Deleted : HKLMSOFTWAREClassesInterface{2DE92D29-A042-3C37-BFF8-07C7D8893EFA}
Key Deleted : HKLMSOFTWAREClassesInterface{2E3537FC-CF2F-4F56-AF54-5A6A3DD375CC}
Key Deleted : HKLMSOFTWAREClassesInterface{2E9937FC-CF2F-4F56-AF54-5A6A3DD375CC}
Key Deleted : HKLMSOFTWAREClassesInterface{31E3BC75-2A09-4CFF-9C92-8D0ED8D1DC0F}
Key Deleted : HKLMSOFTWAREClassesInterface{32B80AD6-1214-45F4-994E-78A5D482C000}
Key Deleted : HKLMSOFTWAREClassesInterface{3A8E103F-B2B7-3BEF-B3B0-88E29B2420E4}
Key Deleted : HKLMSOFTWAREClassesInterface{3E1656ED-F60E-4597-B6AA-B6A58E171495}
Key Deleted : HKLMSOFTWAREClassesInterface{3E53E2CB-86DB-4A4A-8BD9-FFEB7A64DF82}
Key Deleted : HKLMSOFTWAREClassesInterface{3E720451-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesInterface{3E720453-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesInterface{3F607E46-0D3C-4442-B1DE-DE7FA4768F5C}
Key Deleted : HKLMSOFTWAREClassesInterface{478CE5D3-D38E-3FFE-8DBE-8C4A0F1C4D8D}
Key Deleted : HKLMSOFTWAREClassesInterface{48B7DA4E-69ED-39E3-BAD5-3E3EFF22CFB0}
Key Deleted : HKLMSOFTWAREClassesInterface{4E92DB5F-AAD9-49D3-8EAB-B40CBE5B1FF7}
Key Deleted : HKLMSOFTWAREClassesInterface{5982F405-44E4-3BBB-BAC4-CF8141CBBC5C}
Key Deleted : HKLMSOFTWAREClassesInterface{5D8C3CC3-3C05-38A1-B244-924A23115FE9}
Key Deleted : HKLMSOFTWAREClassesInterface{63D0ED2B-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREClassesInterface{63D0ED2D-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREClassesInterface{641593AF-D9FD-30F7-B783-36E16F7A2E08}
Key Deleted : HKLMSOFTWAREClassesInterface{6E74766C-4D93-4CC0-96D1-47B8E07FF9CA}
Key Deleted : HKLMSOFTWAREClassesInterface{711FC48A-1356-3932-94D8-A8B733DBC7E4}
Key Deleted : HKLMSOFTWAREClassesInterface{72227B7F-1F02-3560-95F5-592E68BACC0C}
Key Deleted : HKLMSOFTWAREClassesInterface{72EE7F04-15BD-4845-A005-D6711144D86A}
Key Deleted : HKLMSOFTWAREClassesInterface{741DE825-A6F0-4497-9AA6-8023CF9B0FFF}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D291-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D293-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D295-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D297-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{79FB5FC8-44B9-4AF5-BADD-CCE547F953E5}
Key Deleted : HKLMSOFTWAREClassesInterface{7B5E8CE3-4722-4C0E-A236-A6FF731BEF37}
Key Deleted : HKLMSOFTWAREClassesInterface{819FFE21-35C7-4925-8CDA-4E0E2DB94302}
Key Deleted : HKLMSOFTWAREClassesInterface{890D4F59-5ED0-3CB4-8E0E-74A5A86E7ED0}
Key Deleted : HKLMSOFTWAREClassesInterface{8C68913C-AC3C-4494-8B9C-984D87C85003}
Key Deleted : HKLMSOFTWAREClassesInterface{8D019513-083F-4AA5-933F-7D43A6DA82C4}
Key Deleted : HKLMSOFTWAREClassesInterface{90449521-D834-4703-BB4E-D3AA44042FF8}
Key Deleted : HKLMSOFTWAREClassesInterface{923F6FB8-A390-370E-A0D2-DD505432481D}
Key Deleted : HKLMSOFTWAREClassesInterface{991AAC62-B100-47CE-8B75-253965244F69}
Key Deleted : HKLMSOFTWAREClassesInterface{9BBB26EF-B178-35D6-9D3D-B485F4279FE5}
Key Deleted : HKLMSOFTWAREClassesInterface{9E3B11F6-4179-4603-A71B-A55F4BCB0BEC}
Key Deleted : HKLMSOFTWAREClassesInterface{A626CDBD-3D13-4F78-B819-440A28D7E8FC}
Key Deleted : HKLMSOFTWAREClassesInterface{A62DDBE0-8D2A-339A-B089-8CBCC5CD322A}
Key Deleted : HKLMSOFTWAREClassesInterface{A82AD04D-0B8E-3A49-947B-6A69A8A9C96D}
Key Deleted : HKLMSOFTWAREClassesInterface{ADEB3CC9-A05D-4FCC-BD09-9025456AA3EA}
Key Deleted : HKLMSOFTWAREClassesInterface{B06D4521-D09C-3F41-8E39-9D784CCA2A75}
Key Deleted : HKLMSOFTWAREClassesInterface{BBABDC90-F3D5-4801-863A-EE6AE529862D}
Key Deleted : HKLMSOFTWAREClassesInterface{BF921DD3-732A-4A11-933B-A5EA49F2FD2C}
Key Deleted : HKLMSOFTWAREClassesInterface{C06DAD42-6F39-4CE1-83CC-9A8B9105E556}
Key Deleted : HKLMSOFTWAREClassesInterface{C2E799D0-43A5-3477-8A98-FC5F3677F35C}
Key Deleted : HKLMSOFTWAREClassesInterface{C401D2CE-DC27-45C7-BC0C-8E6EA7F085D6}
Key Deleted : HKLMSOFTWAREClassesInterface{CF54BE1C-9359-4395-8533-1657CF209CFE}
Key Deleted : HKLMSOFTWAREClassesInterface{D16107CD-2AD5-46A8-BA59-303B7C32C500}
Key Deleted : HKLMSOFTWAREClassesInterface{D25B101F-8188-3B43-9D85-201F372BC205}
Key Deleted : HKLMSOFTWAREClassesInterface{D2BA7595-5E44-3F1E-880F-03B3139FA5ED}
Key Deleted : HKLMSOFTWAREClassesInterface{D35F5C81-17D9-3E1C-A1FC-4472542E1D25}
Key Deleted : HKLMSOFTWAREClassesInterface{D6FF3684-AD3B-48EB-BBB4-B9E6C5A355C1}
Key Deleted : HKLMSOFTWAREClassesInterface{D83B296A-2FA6-425B-8AE8-A1F33D99FBD6}
Key Deleted : HKLMSOFTWAREClassesInterface{D8FA96CA-B250-312C-AF34-4FF1DD72589D}
Key Deleted : HKLMSOFTWAREClassesInterface{DAFC1E63-3359-416D-9BC2-E7DCA6F7B0F3}
Key Deleted : HKLMSOFTWAREClassesInterface{DC5E5C44-80FD-3697-9E65-9F286D92F3E7}
Key Deleted : HKLMSOFTWAREClassesInterface{DE38C398-B328-4F4C-A3AD-1B5E4ED93477}
Key Deleted : HKLMSOFTWAREClassesInterface{E1B4C9DE-D741-385F-981E-6745FACE6F01}
Key Deleted : HKLMSOFTWAREClassesInterface{E342AF55-B78A-4CD0-A2BB-DA7F52D9D25E}
Key Deleted : HKLMSOFTWAREClassesInterface{E342AF55-B78A-4CD0-A2BB-DA7F52D9D25F}
Key Deleted : HKLMSOFTWAREClassesInterface{E79DFBC9-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesInterface{E79DFBCB-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesInterface{E7B623F5-9715-3F9F-A671-D1485A39F8A2}
Key Deleted : HKLMSOFTWAREClassesInterface{EB9E5C1C-B1F9-4C2B-BE8A-27D6446FDAF8}
Key Deleted : HKLMSOFTWAREClassesInterface{ED916A7B-7C68-3198-B87D-2DABC30A5587}
Key Deleted : HKLMSOFTWAREClassesInterface{EFA1BDB2-BB3D-3D9A-8EB5-D0D22E0F64F4}
Key Deleted : HKLMSOFTWAREClassesInterface{F4CBF4DD-F8FE-35BA-BB7E-68304DAAB70B}
Key Deleted : HKLMSOFTWAREClassesInterface{FC32005D-E27C-32E0-ADFA-152F598B75E7}
Key Deleted : HKLMSOFTWAREClassesInterface{FE0273D1-99DF-4AC0-87D5-1371C6271785}
Key Deleted : HKLMSOFTWAREClassesTypeLib{0D26BC71-A633-4E71-AD31-EADC3A1B6A3A}
Key Deleted : HKLMSOFTWAREClassesTypeLib{13ABD093-D46F-40DF-A608-47E162EC799D}
Key Deleted : HKLMSOFTWAREClassesTypeLib{29D67D3C-509A-4544-903F-C8C1B8236554}
Key Deleted : HKLMSOFTWAREClassesTypeLib{2BF2028E-3F3C-4C05-AB45-B2F1DCFE0759}
Key Deleted : HKLMSOFTWAREClassesTypeLib{3E720450-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesTypeLib{4E1E9D45-8BF9-4139-915C-9F83CC3D5921}
Key Deleted : HKLMSOFTWAREClassesTypeLib{7473D290-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesTypeLib{74FB6AFD-DD77-4CEB-83BD-AB2B63E63C93}
Key Deleted : HKLMSOFTWAREClassesTypeLib{819FFE20-35C7-4925-8CDA-4E0E2DB94302}
Key Deleted : HKLMSOFTWAREClassesTypeLib{8CA01F0E-987C-49C3-B852-2F1AC4A7094C}
Key Deleted : HKLMSOFTWAREClassesTypeLib{8E6F1830-9607-4440-8530-13BE7C4B1D14}
Key Deleted : HKLMSOFTWAREClassesTypeLib{8FFDF636-0D87-4B33-B9E9-79A53F6E1DAE}
Key Deleted : HKLMSOFTWAREClassesTypeLib{93E3D79C-0786-48FF-9329-93BC9F6DC2B3}
Key Deleted : HKLMSOFTWAREClassesTypeLib{9C049BA6-EA47-4AC3-AED6-A66D8DC9E1D8}
Key Deleted : HKLMSOFTWAREClassesTypeLib{C2AC8A0E-E48E-484B-A71C-C7A937FAAB94}
Key Deleted : HKLMSOFTWAREClassesTypeLib{C8CECDE3-1AE1-4C4A-AD82-6D5B00212144}
Key Deleted : HKLMSOFTWAREClassesTypeLib{D518921A-4A03-425E-9873-B9A71756821E}
Key Deleted : HKLMSOFTWAREClassesTypeLib{D7EE8177-D51E-4F89-92B6-83EA2EC40800}
Key Deleted : HKLMSOFTWAREClassesTypeLib{DB538320-D3C5-433C-BCA9-C4081A054FCF}
Key Deleted : HKLMSOFTWAREClassesTypeLib{E2343056-CC08-46AC-B898-BFC7ACF4E755}
Key Deleted : HKLMSOFTWAREClassesTypeLib{E47CAEE0-DEEA-464A-9326-3F2801535A4D}
Key Deleted : HKLMSOFTWAREClassesTypeLib{E79DFBC0-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesTypeLib{F42228FB-E84E-479E-B922-FBBD096E792C}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{07B18EAB-A523-4961-B6BB-170DE4475CCA}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{116BA71C-8187-4F15-9A1F-C9D6289155D1}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{2974C985-8151-4DE5-B23C-B875F0A8522F}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{07B18EAB-A523-4961-B6BB-170DE4475CCA}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{08858AF6-42AD-4914-95D2-AC3AB0DC8E28}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{25560540-9571-4D7B-9389-0F166788785A}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{3DC201FB-E9C9-499C-A11F-23C360D7C3F8}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{3E720452-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{63D0ED2C-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{7473D294-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{98D9753D-D73B-42D5-8C85-4469CDA897AB}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{9FF05104-B030-46FC-94B8-81276E4E27DF}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{C6FDD0C3-266A-4DC3-B459-28C697C44CDC}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{E79DFBCA-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerExtensions{898EA8C8-E7FF-479B-8935-AEC46303B9E5}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{59C7FC09-1C83-4648-B3E6-003D2BBC7481}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{628F3201-34D0-49C0-BB9A-82A26AEFB291}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{68AF847F-6E91-45DD-9B68-D6A12C30E5D7}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{9170B96C-28D4-4626-8358-27E6CAEEF907}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{D1A71FA0-FF48-48DD-9B6D-7A13A3E42127}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{DDB1968E-EAD6-40FD-8DAE-FF14757F60C7}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{F138D901-86F0-4383-99B6-9CDD406036DA}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKCUSoftwareMicrosoftInternet ExplorerSearchScopes{0ECDF796-C2DC-4D79-A620-CCE0C0A66CC9}
Key Deleted : HKCUSoftwareMicrosoftInternet ExplorerSearchScopes{70D46D94-BF1E-45ED-B567-48701376298E}
Key Deleted : HKCUSoftwareMicrosoftInternet ExplorerSearchScopes{95B7759C-8C7F-4BF1-B163-73684A933233}
Value Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerToolbar [{07B18EA9-A523-4961-B6BB-170DE4475CCA}]
Value Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerToolbar [{95B7759C-8C7F-4BF1-B163-73684A933233}]
Value Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerToolbar [{F3FEE66E-E034-436A-86E4-9690573BEE8A}]
Value Deleted : HKCUSoftwareMicrosoftInternet ExplorerToolbarWebBrowser [{E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39}]
Value Deleted : HKCUSoftwareMicrosoftInternet ExplorerURLSearchHooks [{00A6FAF6-072E-44CF-8957-5838F569A31D}]
Value Deleted : HKCUSoftwareMicrosoftInternet ExplorerURLSearchHooks [{F3FEE66E-E034-436A-86E4-9690573BEE8A}]
Key Deleted : HKCUSoftwareAPN PIP
Key Deleted : HKCUSoftwareAVG Secure Search
Key Deleted : HKCUSoftwareIGearSettings
Key Deleted : HKCUSoftwareMyWebSearch
Key Deleted : HKCUSoftwarePIP
Key Deleted : HKCUSoftwarePrivitizeVPNInstallDates
Key Deleted : HKCUSoftwareSearch Settings
Key Deleted : HKCUSoftwareSoftonic
Key Deleted : HKCUSoftwareStartSearch
Key Deleted : HKCUSoftwareAppDataLowSoftwareFun Web Products
Key Deleted : HKCUSoftwareAppDataLowSoftwareFunWebProducts
Key Deleted : HKCUSoftwareAppDataLowSoftwareMyWebSearch
Key Deleted : HKCUSoftwareAppDataLowSoftwareSearch Settings
Key Deleted : HKLMSoftwareApplication Updater
Key Deleted : HKLMSoftwareAVG Secure Search
Key Deleted : HKLMSoftwareAVG Security Toolbar
Key Deleted : HKLMSoftwareBabylon
Key Deleted : HKLMSoftwareFocusInteractive
Key Deleted : HKLMSoftwareFun Web Products
Key Deleted : HKLMSoftwareIminent
Key Deleted : HKLMSoftwareMyWebSearch
Key Deleted : HKLMSoftwarePIP
Key Deleted : HKLMSoftwareSearch Settings
Key Deleted : HKLMSoftwareSP Global
Key Deleted : HKLMSoftwareSProtector
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstall{A76AA284-E52D-47E6-9E4F-B85DBF8E35C3}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstall{A92DAB39-4E2C-4304-9AB6-BC44E68B55E2}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstall{F7CF0E9A-D48B-4942-9537-259ED0568DF4}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstallmywebsearch bar uninstall
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstallSearchTheWebARP
Data Deleted : HKLMSOFTWAREMicrosoftWindows NTCurrentVersionWindows [AppInit_DLLs] - c:progra~1magnipicsprote~1.dll
Product Deleted : IMinent Toolbar

***** [ Browsers ] *****

- Internet Explorer v10.0.9200.16686

Setting Restored : HKCUSoftwareMicrosoftInternet ExplorerMain [start Page]

- Mozilla Firefox v24.0 (bg)

[ File : C:UsersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultprefs.js ]

Line Deleted : user_pref("aol_toolbar.default.homepage.check", false);
Line Deleted : user_pref("aol_toolbar.default.search.check", false);
Line Deleted : user_pref("browser.babylon.HPOnNewTab", "search.babylon.com");
Line Deleted : user_pref("browser.search.defaultenginename", "Search The Web (privitize)");
Line Deleted : user_pref("browser.search.order.1", "Search The Web (privitize)");
Line Deleted : user_pref("browser.search.selectedEngine", "Search The Web (privitize)");
Line Deleted : user_pref("dom.ipc.plugins.enabled.npmywebs.dll", false);
Line Deleted : user_pref("extensions.5159a25736caa.scode", "(function(){try{if('aol.com,mail.google.com,premiumreports.info,search.babylon.com,search.gboxapp.com'.indexOf(window.self.location.hostname)>-1) return;}c[...]
Line Deleted : user_pref("extensions.BabylonToolbar.prtkDS", 0);
Line Deleted : user_pref("extensions.BabylonToolbar.prtkHmpg", 0);
Line Deleted : user_pref("extensions.BabylonToolbar_i.newTab", true);

Line Deleted : user_pref("extensions.privitize.srchPrvdr", "Search The Web (privitize)");
Line Deleted : user_pref("extensions.softonic.admin", false);
Line Deleted : user_pref("extensions.softonic.aflt", "orgnl");
Line Deleted : user_pref("extensions.softonic.dfltLng", "");
Line Deleted : user_pref("extensions.softonic.dfltSrch", false);
Line Deleted : user_pref("extensions.softonic.excTlbr", false);
Line Deleted : user_pref("extensions.softonic.hmpg", false);
Line Deleted : user_pref("extensions.softonic.id", "d65288460000000000002c27d72d77db");
Line Deleted : user_pref("extensions.softonic.instlDay", "15401");
Line Deleted : user_pref("extensions.softonic.instlRef", "MON00001");
Line Deleted : user_pref("extensions.softonic.lastVrsnTs", "");
Line Deleted : user_pref("extensions.softonic.newTab", false);
Line Deleted : user_pref("extensions.softonic.noFFXTlbr", false);
Line Deleted : user_pref("extensions.softonic.prdct", "softonic");
Line Deleted : user_pref("extensions.softonic.prtnrId", "softonic");
Line Deleted : user_pref("extensions.softonic.smplGrp", "eng7");
Line Deleted : user_pref("extensions.softonic.tlbrId", "eng7");

Line Deleted : user_pref("extensions.softonic.vrsn", "");
Line Deleted : user_pref("extensions.softonic.vrsnTs", "");
Line Deleted : user_pref("extensions.softonic.vrsni", "");
Line Deleted : user_pref("extensions.softonic_i.aflt", "orgnl");
Line Deleted : user_pref("extensions.softonic_i.dfltLng", "");
Line Deleted : user_pref("extensions.softonic_i.excTlbr", false);
Line Deleted : user_pref("extensions.softonic_i.id", "d65288460000000000002c27d72d77db");
Line Deleted : user_pref("extensions.softonic_i.instlDay", "15401");
Line Deleted : user_pref("extensions.softonic_i.instlRef", "MON00001");
Line Deleted : user_pref("extensions.softonic_i.newTab", false);
Line Deleted : user_pref("extensions.softonic_i.prdct", "softonic");
Line Deleted : user_pref("extensions.softonic_i.prtnrId", "softonic");
Line Deleted : user_pref("extensions.softonic_i.smplGrp", "eng7");
Line Deleted : user_pref("extensions.softonic_i.tlbrId", "eng7");

Line Deleted : user_pref("extensions.softonic_i.vrsn", "");
Line Deleted : user_pref("extensions.softonic_i.vrsnTs", "");
Line Deleted : user_pref("extensions.softonic_i.vrsni", "");
Line Deleted : user_pref("sweetim.toolbar.previous.browser.search.defaultenginename", "");
Line Deleted : user_pref("sweetim.toolbar.previous.browser.search.selectedEngine", "");
Line Deleted : user_pref("sweetim.toolbar.previous.browser.startup.homepage", "");
Line Deleted : user_pref("sweetim.toolbar.previous.keyword.URL", "");
Line Deleted : user_pref("sweetim.toolbar.scripts.1.domain-blacklist", "");
Line Deleted : user_pref("sweetim.toolbar.searchguard.UserRejectedGuard_DS", "");
Line Deleted : user_pref("sweetim.toolbar.searchguard.UserRejectedGuard_HP", "");
Line Deleted : user_pref("sweetim.toolbar.searchguard.enable", "");

- Google Chrome v30.0.1599.69

[ File : C:UsersUserAppDataLocalGoogleChromeUser DataDefaultpreferences ]


AdwCleaner[R0].txt - [42354 octets] - [08/10/2013 14:16:42]
AdwCleaner[s0].txt - [43150 octets] - [08/10/2013 14:17:20]

########## EOF - C:AdwCleanerAdwCleaner[s0].txt - [43211 octets] ##########







Junkware Removal Tool (JRT) by Thisisu
Version: 6.0.4 (10.06.2013:1)
OS: Windows 7 Enterprise x86
Ran by User on ўв 08.10.2013 Ј. at 14:21:51,90

~~~ Services

~~~ Registry Values

Successfully deleted: [Registry Value] HKEY_LOCAL_MACHINESoftwareMicrosoftWindowsCurrentVersionRundriver genius
Successfully deleted: [Registry Value] HKEY_LOCAL_MACHINESoftwareMicrosoftInternet ExplorerToolbar{1C46A0DD-D53E-46C4-A435-CA11103E255E}
Successfully repaired: [Registry Value] HKEY_LOCAL_MACHINESoftwareMicrosoftInternet ExplorerAboutURLsTabs

~~~ Registry Keys

Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_1_rasapi32
Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_1_rasmancs
Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_rasapi32
Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_rasmancs
Successfully deleted: [Registry Key] HKEY_CURRENT_USERSoftwareMicrosoftInternet ExplorerSearchScopes{C0A82207-8344-41F1-A040-BEBAA81FEE54}

~~~ Files

Successfully deleted: [File] C:Windowssystem32RENA6DE.tmp
Successfully deleted: [File] C:Windowssystem32RENA6DF.tmp

~~~ Folders

Successfully deleted: [Folder] "C:UsersUserappdatalocallowytd"
Successfully deleted: [Folder] "C:Windowssystem32ai_recyclebin"
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{1CFCDD62-6187-4378-8E2D-24833D1CCB5B}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{3DB399A4-5370-40A7-83EF-75CA91C3AFCE}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{7D560449-D69C-4CCA-9FFC-D1E3CE3CC7F6}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{A18883CF-114E-49F7-9963-DAE6FDDEFEE9}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{CDCD390C-BDB3-40B6-BF5C-0EE64591247B}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{DBCD12A3-7171-4FA6-AD55-4E2088D6EB5B}

~~~ FireFox

Successfully deleted: [File] C:UsersUserAppDataRoamingmozillafirefoxprofilesptoklpuh.defaultsearchpluginsprivitize.xml
Successfully deleted the following from C:UsersUserAppDataRoamingmozillafirefoxprofilesptoklpuh.defaultprefs.js

user_pref("extensions.privitize.admin", false);
user_pref("extensions.privitize.aflt", "5");
user_pref("extensions.privitize.appId", "{301966DF-A84B-4255-AAB9-574B5CE237E4}");
user_pref("extensions.privitize.autoRvrt", "false");
user_pref("extensions.privitize.dfltLng", "");
user_pref("extensions.privitize.dfltSrch", true);
user_pref("extensions.privitize.dnsErr", true);
user_pref("extensions.privitize.excTlbr", false);
user_pref("extensions.privitize.ffxUnstlRst", false);
user_pref("extensions.privitize.hmpg", true);

user_pref("extensions.privitize.id", "d65288460000000000002c27d72d77db");
user_pref("extensions.privitize.instlDay", "15876");
user_pref("extensions.privitize.instlRef", "");

user_pref("extensions.privitize.newTab", true);

user_pref("extensions.privitize.prdct", "privitize");
user_pref("extensions.privitize.prtnrId", "privitize");
user_pref("extensions.privitize.rvrt", "false");
user_pref("extensions.privitize.smplGrp", "none");
user_pref("extensions.privitize.tlbrId", "base");

user_pref("extensions.privitize.vrsn", "");
user_pref("extensions.privitize.vrsnTs", "");
user_pref("extensions.privitize.vrsni", "");

Emptied folder: C:UsersUserAppDataRoamingmozillafirefoxprofilesptoklpuh.defaultminidumps [1016 files]

~~~ Event Viewer Logs were cleared

Scan was completed on ўв 08.10.2013 Ј. at 14:24:01,13
End of JRT log



Malwarebytes Anti-Malware





Malwarebytes Anti-Malware

Database version: v2013.10.08.04

Windows 7 Service Pack 1 x86 NTFS
Internet Explorer 10.0.9200.16686
User :: HP [administrator]

8.10.2013 г. 14:30:19 ч.
MBAM-log-2013-10-08 (15-53-04).txt

Scan type: Full scan (C:|D:|)
Scan options enabled: Memory | Startup | Registry | File System | Heuristics/Extra | Heuristics/Shuriken | PUP | PUM
Scan options disabled: P2P
Objects scanned: 377679
Time elapsed: 1 hour(s), 20 minute(s), 49 second(s)

Memory Processes Detected: 0
(No malicious items detected)

Memory Modules Detected: 0
(No malicious items detected)

Registry Keys Detected: 0
(No malicious items detected)

Registry Values Detected: 0
(No malicious items detected)

Registry Data Items Detected: 0
(No malicious items detected)

Folders Detected: 0
(No malicious items detected)

Files Detected: 6
C:UsersUserAppDataLocalTempfUgRjIO1.zip.part (Trojan.Agent.HE) -> No action taken.
C:UsersUserDesktopНова папкаCDHackcdhack.dll (Trojan.Agent.H) -> No action taken.
D:DownloadsmarketSoftonicDownloader_for_tactical-ops-assault-on-terror.exe (PUP.Optional.Softonic.A) -> No action taken.
D:DownloadstalismanMedal.of.Honor.2010.Multi3.RU.RepackAutorun.exe (Trojan.Agent) -> No action taken.
D:DownloadstalismanMedal.of.Honor.2010.Multi3.RU.RepackMedal of HonorBinariesloader.dll (Riskware.Tool.CK) -> No action taken.
D:LFSLFSip-patch.exe (Backdoor.Bifrose) -> No action taken.


Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Сканирайте отново с Malwarebytes Anti-Malware но този път маркирайте всички намерени обекти и натиснете Публикувано изображение .
..след това..:


Публикувано изображение Изтеглете ComboFix Публикувано изображение от тук и го запазете на десктопа си
Изключете вашата антивирусна и антишпионска програма, обикновено това става чрез натискане на десния бутон на мишката върху иконата на програма в системния трей.
Бележка: Ако не можете я спрете или не сте сигурни коя програма да изключите, моля прегледайте информацията от този линк: How to disable your security applications by amateur

Стартирайте Combo-Fix.com Публикувано изображение и следвайте инструкциите.
Бележка: ComboFix ще се стартира без инсталирана Recovery Console.
Като част от неговата работа, ComboFix ще провери дали Microsoft Windows Recovery Console е инсталирана. Предвид бързо развиващия се зловреден софтуер е силно препоръчително да бъде инсталирана преди премахването на зловредния софтуер. Това ще Ви позволи да влезете в специален recovery/repai режим, който ще ни позволи по-лесно да решите проблем, който би могъл да възникне при премахване на зловредния софтуер.

  • [*]Следвайте инструкциите, за да позволите на
ComboFix да изтегли и инсталира Microsoft Windows Recovery Console.В един момент ще бъдете попитани дали сте съгласни с лицензното споразумение. Необходимо е да потвърдите, че сте съгласни, за да инсталирате Microsoft Windows Recovery Console.

** Забележете: Ако Microsoft Windows Recovery Console е вече инсталирана, ComboFix ще продължи към процеса по премахване на зловредния софтуер.
Публикувано изображение
След като Microsoft Windows Recovery Console е инсталирана, използвайки ComboFix, Вие ще видите следното съобщение:
Публикувано изображение


Изберете Yes, за да продължи сканирането за зловреден софтуер.

Когато процесът приключи успешно, инструментът ще създаде лог файл. Моля, включете съдържанието на C:ComboFix.txt в следващия Ви коментар в тази тема.
Публикувано изображение Моля, не прикачвайте лог файла/овете от програмата, а го/ги копирайте и поставете в следващия Ви коментар в тази тема.

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Malwarebytes Anti-Malware го оправих но не ми са създаде лог :no-no:

ако може да ми обясните пораженията по системата .. :)

ето лога от  ComboFix


ComboFix 13-10-08.01 - User 10.2013 г.  16:26:31.1.2 - x86
Microsoft Windows 7 Enterprise 6.1.7601.1.1251.359.1026.18.1917.1251 [GMT 3:00]
Running from: c:usersUserDownloadsComboFix.exe
AV: Microsoft Security Essentials *Disabled/Updated* {641105E6-77ED-3F35-A304-765193BCB75F}
SP: Microsoft Security Essentials *Disabled/Updated* {DF70E402-51D7-30BB-99B4-4D23E83BFDE2}
SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
 * Created a new restore point
((((((((((((((((((((((((((((((((((((((( Other Deletions )))))))))))))))))))))))))))))))))))))))))))))))))
c:usersUserAppDataLocalGoogleChromeUser DataDefaultPreferences
((((((((((((((((((((((((((((((((((((((( Drivers/Services )))))))))))))))))))))))))))))))))))))))))))))))))
((((((((((((((((((((((((( Files Created from 2013-09-09 to 2013-10-09  )))))))))))))))))))))))))))))))
2013-10-08 11:29 . 2013-10-08 11:29  --------  d-----w-  c:program filesMalwarebytes' Anti-Malware
2013-10-08 11:29 . 2013-04-04 11:50  22856  ----a-w-  c:windowssystem32driversmbam.sys
2013-10-08 11:21 . 2013-10-08 11:21  --------  d-----w-  c:windowsERUNT
2013-10-08 11:14 . 2013-10-08 11:17  --------  d-----w-  C:AdwCleaner
2013-10-05 17:39 . 2013-10-08 18:07  --------  d-----w-  c:usersUserAppDataRoaming.minecraft
2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:usersUserAppDataLocalLogMeIn
2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:programdataLogMeIn
2013-09-30 17:52 . 2013-09-30 17:52  --------  d-----w-  c:program filesAcclaim Entertainment
2013-09-11 17:49 . 2013-09-11 17:49  --------  d-----w-  c:programdataNexon
2013-09-11 16:49 . 2013-09-11 16:50  --------  d-----w-  c:usersUserAppDataLocalAkamai
2013-09-09 17:09 . 2013-09-09 17:09  --------  d--h--w-  c:program filesTemp
(((((((((((((((((((((((((((((((((((((((( Find3M Report ))))))))))))))))))))))))))))))))))))))))))))))))))))
2013-10-09 13:23 . 2013-10-09 13:23  40392  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{2757D113-8F0B-4D07-B3E8-681947E139C5}MpKsl70dd4d28.sys
2013-10-09 13:08 . 2012-03-30 11:00  692616  ----a-w-  c:windowssystem32FlashPlayerApp.exe
2013-10-09 13:08 . 2011-08-07 14:11  71048  ----a-w-  c:windowssystem32FlashPlayerCPLApp.cpl
2013-10-02 15:06 . 2012-07-21 23:29  37664  ----a-w-  c:windowssystem32driversavgtpx86.sys
2013-09-06 17:07 . 2013-09-06 17:07  718712  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{A791E496-9C9C-4EC1-BCB5-B6B12246FAC6}gapaengine.dll
2013-09-05 05:02 . 2013-10-09 11:31  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{2757D113-8F0B-4D07-B3E8-681947E139C5}mpengine.dll
2013-09-05 05:02 . 2013-10-08 11:31  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesBackupmpengine.dll
2013-08-22 18:02 . 2011-08-11 08:57  697992  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesNISBackupgapaengine.dll
2013-07-25 08:57 . 2013-08-14 11:25  1620992  ----a-w-  c:windowssystem32WMVDECOD.DLL
2013-07-19 01:41 . 2013-08-14 11:25  2048  ----a-w-  c:windowssystem32tzres.dll
2011-09-10 00:24 . 2013-10-01 15:48  119808  ----a-w-  c:program filesmozilla firefoxcomponentsGoogleDesktopMozilla.dll
((((((((((((((((((((((((((((((((((((( Reg Loading Points ))))))))))))))))))))))))))))))))))))))))))))))))))
*Note* empty entries & legit default entries are not shown
"DAEMON Tools Lite"="c:program filesDAEMON Tools LiteDTLite.exe" [2011-08-02 4910912]
"Sidebar"="c:program filesWindows Sidebarsidebar.exe" [2010-11-20 1174016]
"Skype"="c:program filesSkypePhoneSkype.exe" [2013-07-25 20684656]
"Akamai NetSession Interface"="c:usersUserAppDataLocalAkamainetsession_win.exe" [2013-06-04 4489472]
"BCSSync"="c:program filesMicrosoft OfficeOffice14BCSSync.exe" [2010-03-13 91520]
"ZSSnp211"="c:windowsZSSnp211.exe" [2007-04-06 57344]
"Google Desktop Search"="c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe" [2011-09-10 30192]
"MSC"="c:program filesMicrosoft Security Clientmsseces.exe" [2013-06-20 995176]
"IgfxTray"="c:windowssystem32igfxtray.exe" [2012-11-13 138784]
"HotKeysCmds"="c:windowssystem32hkcmd.exe" [2012-11-13 172064]
"Persistence"="c:windowssystem32igfxpers.exe" [2012-11-13 173600]
"SunJavaUpdateSched"="c:program filesCommon FilesJavaJava Updatejusched.exe" [2013-03-12 253816]
"LogMeIn Hamachi Ui"="d:downloadsmyНова папкаhamachi-2-ui.exe" [2013-10-01 2345296]
"ConsentPromptBehaviorUser"= 3 (0x3)
"EnableUIADesktopToggle"= 0 (0x0)
[HKEY_LOCAL_MACHINEsoftwaremicrosoftwindows ntcurrentversionwindows]
[HKLM~startupfolderC:^Users^User^AppData^Roaming^Microsoft^Windows^Start Menu^Programs^Startup^GamersFirst LIVE!.lnk]
path=c:usersUserAppDataRoamingMicrosoftWindowsStart MenuProgramsStartupGamersFirst LIVE!.lnk
backup=c:windowspssGamersFirst LIVE!.lnk.Startup
[HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregDomino]
2006-08-18 13:58  49152  ----a-w-  c:windowsDomino.exe
[HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregFacebook Update]
2012-07-11 20:44  138096  ----atw-  c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe
R2 SkypeUpdate;Skype Updater;c:program filesSkypeUpdaterUpdater.exe [2013-07-25 162672]
R2 vToolbarUpdater17.0.12;vToolbarUpdater17.0.12;c:program filesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exe [x]
R3 dmvsc;dmvsc;c:windowssystem32driversdmvsc.sys [2010-11-20 62464]
R3 EagleXNt;EagleXNt;c:windowssystem32driversEagleXNt.sys [x]
R3 FairplayKD;FairplayKD;c:programdataMTA San Andreas All1.3tempFairplayKD.sys [x]
R3 GoogleDesktopManager-051210-111108;Диспечер на Google Desktop 5.9.1005.12335;c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe [2011-09-10 30192]
R3 NisDrv;Microsoft Network Inspection System;c:windowssystem32DRIVERSNisDrvWFP.sys [2013-06-18 107392]
R3 NisSrv;Мрежова проверка на Microsoft;c:program filesMicrosoft Security ClientNisSrv.exe [2013-06-20 295376]
R3 RdpVideoMiniport;Remote Desktop Video Miniport Driver;c:windowssystem32driversrdpvideominiport.sys [2010-11-20 15872]
R3 Synth3dVsc;Synth3dVsc;c:windowssystem32driverssynth3dvsc.sys [2010-11-20 77184]
R3 terminpt;Microsoft Remote Desktop Input Driver;c:windowssystem32driversterminpt.sys [2010-11-20 25600]
R3 TsUsbFlt;TsUsbFlt;c:windowssystem32driverstsusbflt.sys [2010-11-20 52224]
R3 TsUsbGD;Remote Desktop Generic USB Device;c:windowssystem32driversTsUsbGD.sys [2010-11-20 27264]
R3 tsusbhub;tsusbhub;c:windowssystem32driverstsusbhub.sys [2010-11-20 112640]
R3 VGPU;VGPU;c:windowssystem32driversrdvgkmd.sys [x]
R3 vvftav211;vvftav211;c:windowssystem32driversvvftav211.sys [2007-12-10 480128]
R3 WatAdminSvc;Услуга на технологиите за активиране на Windows;c:windowssystem32WatWatAdminSvc.exe [2011-08-05 1343400]
R3 WinRing0_1_2_0;WinRing0_1_2_0;d:mcRazer Game BoosterDriverWinRing0.sys [x]
R3 XDva394;XDva394;c:windowssystem32XDva394.sys [x]
R3 XDva397;XDva397;c:windowssystem32XDva397.sys [x]
R3 XDva399;XDva399;c:windowssystem32XDva399.sys [x]
R3 XDva401;XDva401;c:windowssystem32XDva401.sys [x]
R3 ZSMC30x;USB PC Camera Service ZSMC30x;c:windowssystem32DriversZS211.sys [2007-12-05 1537024]
S1 avgtp;avgtp;c:windowssystem32driversavgtpx86.sys [2013-10-02 37664]
S1 dtsoftbus01;DAEMON Tools Virtual Bus Driver;c:windowssystem32DRIVERSdtsoftbus01.sys [2011-08-05 232512]
S1 MpKsl70dd4d28;MpKsl70dd4d28;c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{2757D113-8F0B-4D07-B3E8-681947E139C5}MpKsl70dd4d28.sys [2013-10-09 40392]
S2 Hamachi2Svc;LogMeIn Hamachi Tunneling Engine;d:downloadsmyНова папкаhamachi-2.exe [2013-10-01 1612112]
S2 RzKLService;RzKLService;d:mcRazer Game BoosterRzKLService.exe [2013-09-18 106472]
S2 Skype C2C Service;Skype C2C Service;c:programdataSkypeToolbarsSkype C2C Servicec2c_service.exe [2013-09-16 3273088]
S2 TeamViewer8;TeamViewer 8;c:program filesTeamViewerVersion8TeamViewer_Service.exe [2013-08-07 4308320]
S3 RTL8167;Realtek 8167 NT Driver;c:windowssystem32DRIVERSRt86win7.sys [2009-03-01 139776]
--- Other Services/Drivers In Memory ---
*NewlyCreated* - WS2IFSL
[HKEY_LOCAL_MACHINEsoftwaremicrosoftactive setupinstalled components{8A69D345-D564-463c-AFF1-A69D9E530F96}]
2013-10-06 11:22  1185744  ----a-w-  c:program filesGoogleChromeApplication30.0.1599.69Installerchrmstp.exe
Contents of the 'Scheduled Tasks' folder
2013-10-09 c:windowsTasksAdobe Flash Player Updater.job
- c:windowssystem32MacromedFlashFlashPlayerUpdateService.exe [2012-03-30 13:08]
2013-10-05 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000Core.job
- c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44]
2013-10-09 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000UA.job
- c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44]
2013-10-09 c:windowsTasksGoogleUpdateTaskMachineCore.job
- c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14]
2013-10-09 c:windowsTasksGoogleUpdateTaskMachineUA.job
- c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14]
------- Supplementary Scan -------

uInternet Settings,ProxyOverride = <local>
IE: Download all by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm
IE: Download by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm
IE: E&xport to Microsoft Excel - c:progra~1MICROS~2Office14EXCEL.EXE/3000
IE: Free YouTube Download - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeytvdownloader.htm
IE: Free YouTube to MP3 Converter - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeyoutubetomp3converter.htm
IE: Se&nd to OneNote - c:progra~1MICROS~2Office14ONBttnIE.dll/105
IE: ????3?? - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm
IE: ????3?????? - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm
Trusted Zone: clonewarsadventures.com
Trusted Zone: freerealms.com
Trusted Zone: soe.com
Trusted Zone: sony.com
FF - ProfilePath - c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.default
FF - prefs.js: browser.search.defaulturl -

FF - ExtSQL: 2013-09-30 19:10; WebSiteRecommendation@weliketheweb.com; c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultextensionsWebSiteRecommendation@weliketheweb.com
- - - - ORPHANS REMOVED - - - -
HKCU-Run-Clownfish - c:program filesClownfishClownfish.exe
MSConfigStartUp-Clownfish - c:program filesClownfishClownfish.exe
MSConfigStartUp-Steam - c:program filesSteamSteam.exe
AddRemove-Clownfish - c:program filesClownfishuninstall.exe
AddRemove-Driver Genius Professional Edition_is1 - d:downloadskamioniDriverGeniusunins000.exe
AddRemove-Minecraft 1.6.2 - c:usersUserAppDataRoaming.minecraftUninstal.exe
AddRemove-Minecraft1.6.2 - c:usersUserAppDataRoaming.minecraftminecraft launcherUninstall.exe
AddRemove-privitize - c:program filesIndustriyaprivitize1.8.21.6uninstall.exe
AddRemove-BeamNG-Techdemo-0.3 - d:mda eBeamNG-Techdemo-0.3uninst-BeamNG-Techdemo-0.3.exe
AddRemove-Counter-Strike 1.6 Escom 3d!7!0n - by AmaRelle v1.0 - d:downloadsskiiUninstal.exe
AddRemove-GamersFirst LIVE! - c:usersUserAppDataLocalGamersFirstLIVE!uninstall.exe
AddRemove-SOE-Magic The Gathering Tactics - d:downloadsНова папкаUninstaller.exe
AddRemove-World of Warcraft Trial - c:usersPublicDocumentsBlizzard EntertainmentWorld of Warcraft Trial (2)Uninstall.exe
--------------------- LOCKED REGISTRY KEYS ---------------------
[HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}Џ]
@Allowed: (Read) (RestrictedCode)
@="c:Program FilesFlashGet NetworkFlashGet 3GetUrl.htm"
[HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}ЏhQиђю”Ґc]
@Allowed: (Read) (RestrictedCode)
@="c:Program FilesFlashGet NetworkFlashGet 3GetAllUrl.htm"
@Denied: (A) (Users)
@Denied: (A) (Everyone)
@Allowed: (B 1 2 3 4 5) (S-1-5-20)
@Denied: (Full) (Everyone)
------------------------ Other Running Processes ------------------------
c:program filesMicrosoft Security ClientMsMpEng.exe
c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSVC.EXE
c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSvcM.exe
c:program filesWindows Media Playerwmpnetwk.exe
Completion time: 2013-10-09  16:37:58 - machine was rebooted
ComboFix-quarantined-files.txt  2013-10-09 13:37
Pre-Run: 19 964 141 568 bytes free
Post-Run: 19 761 917 952 bytes free
- - End Of File - - B349F3FA563916209B179A5B0B6BCCD9

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Копирайте текста в карето на notepad и го запазвате с име CFScript.txt на десктопа си:

KILLALL::ClearJavaCache::File::c:windowssystem32driversavgtpx86.sysc:program filesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exeFolder::c:usersUserAppDataRoaming.minecraftDriver::vToolbarUpdater17.0.12avgtpDDS::Trusted Zone: clonewarsadventures.comTrusted Zone: freerealms.comTrusted Zone: soe.comTrusted Zone: sony.com

След съхранението преместете  CFScript.txt на иконата на ComboFix.exe

Публикувано изображение

Генерирания рапорт копирайте  и го поставете в следващия си коментар...!

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Ето лога






ComboFix 13-10-08.01 - User 10.2013 г.  16:48:42.2.2 - x86 Microsoft Windows 7 Enterprise 6.1.7601.1.1251.359.1026.18.1917.1130 [GMT 3:00] Running from: c:usersUserDownloadsComboFix.exe Command switches used :: c:usersUserDownloadsCFScript.txt.txt AV: Microsoft Security Essentials *Disabled/Updated* {641105E6-77ED-3F35-A304-765193BCB75F} SP: Microsoft Security Essentials *Disabled/Updated* {DF70E402-51D7-30BB-99B4-4D23E83BFDE2} SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}  * Created a new restore point . FILE :: "c:program filesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exe" "c:windowssystem32driversavgtpx86.sys" . . ((((((((((((((((((((((((((((((((((((((( Other Deletions ))))))))))))))))))))))))))))))))))))))))))))))))) . . c:usersUserAppDataLocalGoogleChromeUser DataDefaultPreferences c:usersUserAppDataRoaming.minecraft c:usersUserAppDataRoaming.minecraftassetsiconsicon_16x16.png c:usersUserAppDataRoaming.minecraftassetsiconsicon_32x32.png c:usersUserAppDataRoaming.minecraftassetsiconsminecraft.icns c:usersUserAppDataRoaming.minecraftassetslangaf_ZA.lang c:usersUserAppDataRoaming.minecraftassetslangar_SA.lang c:usersUserAppDataRoaming.minecraftassetslangbg_BG.lang c:usersUserAppDataRoaming.minecraftassetslangca_ES.lang c:usersUserAppDataRoaming.minecraftassetslangcs_CZ.lang c:usersUserAppDataRoaming.minecraftassetslangcy_GB.lang c:usersUserAppDataRoaming.minecraftassetslangda_DK.lang c:usersUserAppDataRoaming.minecraftassetslangde_DE.lang c:usersUserAppDataRoaming.minecraftassetslangel_GR.lang c:usersUserAppDataRoaming.minecraftassetslangen_AU.lang c:usersUserAppDataRoaming.minecraftassetslangen_CA.lang c:usersUserAppDataRoaming.minecraftassetslangen_GB.lang c:usersUserAppDataRoaming.minecraftassetslangen_PT.lang c:usersUserAppDataRoaming.minecraftassetslangeo_UY.lang c:usersUserAppDataRoaming.minecraftassetslanges_AR.lang c:usersUserAppDataRoaming.minecraftassetslanges_ES.lang c:usersUserAppDataRoaming.minecraftassetslanges_MX.lang c:usersUserAppDataRoaming.minecraftassetslanges_UY.lang c:usersUserAppDataRoaming.minecraftassetslanges_VE.lang c:usersUserAppDataRoaming.minecraftassetslanget_EE.lang c:usersUserAppDataRoaming.minecraftassetslangeu_ES.lang c:usersUserAppDataRoaming.minecraftassetslangfi_FI.lang c:usersUserAppDataRoaming.minecraftassetslangfr_CA.lang c:usersUserAppDataRoaming.minecraftassetslangfr_FR.lang c:usersUserAppDataRoaming.minecraftassetslangga_IE.lang c:usersUserAppDataRoaming.minecraftassetslanggl_ES.lang c:usersUserAppDataRoaming.minecraftassetslanghe_IL.lang c:usersUserAppDataRoaming.minecraftassetslanghi_IN.lang c:usersUserAppDataRoaming.minecraftassetslanghr_HR.lang c:usersUserAppDataRoaming.minecraftassetslanghu_HU.lang c:usersUserAppDataRoaming.minecraftassetslanghy_AM.lang c:usersUserAppDataRoaming.minecraftassetslangid_ID.lang c:usersUserAppDataRoaming.minecraftassetslangis_IS.lang c:usersUserAppDataRoaming.minecraftassetslangit_IT.lang c:usersUserAppDataRoaming.minecraftassetslangja_JP.lang c:usersUserAppDataRoaming.minecraftassetslangka_GE.lang c:usersUserAppDataRoaming.minecraftassetslangko_KR.lang c:usersUserAppDataRoaming.minecraftassetslangkw_GB.lang c:usersUserAppDataRoaming.minecraftassetslangky_KG.lang c:usersUserAppDataRoaming.minecraftassetslangla_LA.lang c:usersUserAppDataRoaming.minecraftassetslanglt_LT.lang c:usersUserAppDataRoaming.minecraftassetslanglv_LV.lang c:usersUserAppDataRoaming.minecraftassetslangmi_NZ.lang c:usersUserAppDataRoaming.minecraftassetslangms_MY.lang c:usersUserAppDataRoaming.minecraftassetslangmt_MT.lang c:usersUserAppDataRoaming.minecraftassetslangnb_NO.lang c:usersUserAppDataRoaming.minecraftassetslangnl_NL.lang c:usersUserAppDataRoaming.minecraftassetslangnn_NO.lang c:usersUserAppDataRoaming.minecraftassetslangno_NO.lang c:usersUserAppDataRoaming.minecraftassetslangoc_FR.lang c:usersUserAppDataRoaming.minecraftassetslangpl_PL.lang c:usersUserAppDataRoaming.minecraftassetslangpt_BR.lang c:usersUserAppDataRoaming.minecraftassetslangpt_PT.lang c:usersUserAppDataRoaming.minecraftassetslangqya_AA.lang c:usersUserAppDataRoaming.minecraftassetslangro_RO.lang c:usersUserAppDataRoaming.minecraftassetslangru_RU.lang c:usersUserAppDataRoaming.minecraftassetslangsk_SK.lang c:usersUserAppDataRoaming.minecraftassetslangsl_SI.lang c:usersUserAppDataRoaming.minecraftassetslangsr_SP.lang c:usersUserAppDataRoaming.minecraftassetslangsv_SE.lang c:usersUserAppDataRoaming.minecraftassetslangth_TH.lang c:usersUserAppDataRoaming.minecraftassetslangtlh_AA.lang c:usersUserAppDataRoaming.minecraftassetslangtr_TR.lang c:usersUserAppDataRoaming.minecraftassetslanguk_UA.lang c:usersUserAppDataRoaming.minecraftassetslangvi_VN.lang c:usersUserAppDataRoaming.minecraftassetslangzh_CN.lang c:usersUserAppDataRoaming.minecraftassetslangzh_TW.lang c:usersUserAppDataRoaming.minecraftassetsmusiccalm1.ogg c:usersUserAppDataRoaming.minecraftassetsmusiccalm2.ogg c:usersUserAppDataRoaming.minecraftassetsmusiccalm3.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal1.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal2.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal3.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal4.ogg c:usersUserAppDataRoaming.minecraftassetsmusicnuance1.ogg c:usersUserAppDataRoaming.minecraftassetsmusicnuance2..ogg c:usersUserAppDataRoaming.minecraftassetsmusicnuance2.ogg c:usersUserAppDataRoaming.minecraftassetsmusicpiano1.ogg c:usersUserAppDataRoaming.minecraftassetsmusicpiano2.ogg c:usersUserAppDataRoaming.minecraftassetsmusicpiano3.ogg c:usersUserAppDataRoaming.minecraftassetspack.mcmeta c:usersUserAppDataRoaming.minecraftassetsREAD_ME_I_AM_VERY_IMPORTANT c:usersUserAppDataRoaming.minecraftassetsrecords11.ogg c:usersUserAppDataRoaming.minecraftassetsrecords13.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsblocks.ogg c:usersUserAppDataRoaming.minecraftassetsrecordscat.ogg c:usersUserAppDataRoaming.minecraftassetsrecordschirp.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsfar.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsmall.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsmellohi.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsstal.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsstrad.ogg c:usersUserAppDataRoaming.minecraftassetsrecordswait.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsward.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave1.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave10.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave11.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave12.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave13.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave2.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave3.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave4.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave5.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave6.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave7.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave8.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave9.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain1.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain2.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain3.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain4.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherthunder1.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherthunder2.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherthunder3.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagefallbig.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagefallsmall.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagehit1.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagehit2.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagehit3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth4.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass1.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass2.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass3.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass4.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel1.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel2.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel3.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundfirefire.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireignite.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworksblast_far1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworksblast1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkslargeBlast_far1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkslargeBlast1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkslaunch1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkstwinkle_far1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkstwinkle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidlava.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidlavapop.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidsplash.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidsplash2.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim1.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim2.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim3.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim4.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidwater.ogg c:usersUserAppDataRoaming.minecraftassetssoundminecartbase.ogg c:usersUserAppDataRoaming.minecraftassetssoundminecartinside.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatloop.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbattakeoff.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathiss1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathiss2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathiss3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathitt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathitt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathitt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurr1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurr2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurr3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurreow1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurreow2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenplop.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickensay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickensay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickensay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreeperdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonend.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermendeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenportal.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenportal2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenstare.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastaffectionate_scream.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastcharge.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastfireball4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan7.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseangry1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsearmor.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsebreathe1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsebreathe2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsebreathe3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyangry1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyangry2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeydeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsejump.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseland.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseleather.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletondeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombieidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombieidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombieidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemthrow.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepshear.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishkill.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletondeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimeattack1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimeattack2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhaggle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhaggle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhaggle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageridle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageridle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageridle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerno1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerno2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerno3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageryes1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageryes2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageryes3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwithershoot.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherspawn.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfbark1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfbark2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfbark3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfgrowl1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfgrowl2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfgrowl3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhowl1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhowl2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfpanting.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfshake.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfwhine.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiehurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiehurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombieinfect.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiemetal1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiemetal2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiemetal3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombieremedy.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiesay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiesay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiesay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombieunfect.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewoodbreak.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpighurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpighurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotebass.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotebassattack.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotebd.ogg c:usersUserAppDataRoaming.minecraftassetssoundnoteharp.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotehat.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotepling.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotesnare.ogg c:usersUserAppDataRoaming.minecraftassetssoundportalportal.ogg c:usersUserAppDataRoaming.minecraftassetssoundportaltravel.ogg c:usersUserAppDataRoaming.minecraftassetssoundportaltrigger.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomanvil_break.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomanvil_land.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomanvil_use.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombow.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombreak.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombreath.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomburp.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomchestclosed.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomchestopen.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomclassic_hurt.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomclick.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomdoor_close.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomdoor_open.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomdrink.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomeat1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomeat2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomeat3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode4.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomfizz.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomfuse.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomglass1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomglass2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomglass3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomlevelup.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomorb.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandompop.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomsplash.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomsuccessful_hit.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomwood_click.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass6.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone6.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood6.ogg c:usersUserAppDataRoaming.minecraftassetssoundtilepistonin.ogg c:usersUserAppDataRoaming.minecraftassetssoundtilepistonout.ogg c:usersUserAppDataRoaming.minecraftgamefiles.zip c:usersUserAppDataRoaming.minecrafths_err_pid1008.log c:usersUserAppDataRoaming.minecrafths_err_pid3184.log c:usersUserAppDataRoaming.minecrafths_err_pid4160.log c:usersUserAppDataRoaming.minecraftlauncheroptions.txt c:usersUserAppDataRoaming.minecraftlibrariesargo-2.25_fixed.jar c:usersUserAppDataRoaming.minecraftlibrariesasm-all-4.1.jar c:usersUserAppDataRoaming.minecraftlibrariesbcprov-jdk15on-1.47.jar c:usersUserAppDataRoaming.minecraftlibrariescodecjorbis-20101023.jar c:usersUserAppDataRoaming.minecraftlibrariescodecwav-20101023.jar c:usersUserAppDataRoaming.minecraftlibrariescommons-io-2.4.jar c:usersUserAppDataRoaming.minecraftlibrariescommons-lang3-3.1.jar c:usersUserAppDataRoaming.minecraftlibrariesgson-2.2.2.jar c:usersUserAppDataRoaming.minecraftlibrariesguava-14.0.jar c:usersUserAppDataRoaming.minecraftlibrariesjinput-2.0.5.jar c:usersUserAppDataRoaming.minecraftlibrariesjinput-platform-2.0.5-natives-windows.jar c:usersUserAppDataRoaming.minecraftlibrariesjopt-simple-4.5.jar c:usersUserAppDataRoaming.minecraftlibrariesjutils-1.0.0.jar c:usersUserAppDataRoaming.minecraftlibrarieslibraryjavasound-20101123.jar c:usersUserAppDataRoaming.minecraftlibrarieslibrarylwjglopenal-20100824.jar c:usersUserAppDataRoaming.minecraftlibrarieslwjgl-2.9.0.jar c:usersUserAppDataRoaming.minecraftlibrarieslwjgl-platform-2.9.0-natives-windows.jar c:usersUserAppDataRoaming.minecraftlibrarieslwjgl_util-2.9.0.jar c:usersUserAppDataRoaming.minecraftlibrarieslzma-0.0.1.jar c:usersUserAppDataRoaming.minecraftlibrariessoundsystem-20120107.jar c:usersUserAppDataRoaming.minecraftMinecraft.exe c:usersUserAppDataRoaming.minecraftoptions.txt c:usersUserAppDataRoaming.minecraftoptionsof.txt c:usersUserAppDataRoaming.minecraftoutput-client.log c:usersUserAppDataRoaming.minecraftoutput-client.log.1 c:usersUserAppDataRoaming.minecraftoutput-client.log.2 c:usersUserAppDataRoaming.minecraftoutput-client.log.3 c:usersUserAppDataRoaming.minecraftoutput-server.log c:usersUserAppDataRoaming.minecraftoutput-server.log.1 c:usersUserAppDataRoaming.minecraftoutput-server.log.1.lck c:usersUserAppDataRoaming.minecraftoutput-server.log.2 c:usersUserAppDataRoaming.minecraftresourcepacks1.6_Flows_HD_128x_beta.zip c:usersUserAppDataRoaming.minecraftsavesasddataMineshaft.dat c:usersUserAppDataRoaming.minecraftsavesasddatavillages.dat c:usersUserAppDataRoaming.minecraftsavesasdlevel.dat c:usersUserAppDataRoaming.minecraftsavesasdlevel.dat_mcr c:usersUserAppDataRoaming.minecraftsavesasdlevel.dat_old c:usersUserAppDataRoaming.minecraftsavesasdplayershippnozis.dat c:usersUserAppDataRoaming.minecraftsavesasdregionr.-1.-1.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.-1.0.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.-2.-1.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.-2.0.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.0.-1.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.0.0.mca c:usersUserAppDataRoaming.minecraftsavesasdsession.lock c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISdataMineshaft.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISdatavillages.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISlevel.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISlevel.dat_mcr c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISlevel.dat_old c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISplayershippnozis.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.-1.-1.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.-1.0.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.0.-1.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.0.0.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISsession.lock c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdataMineshaft.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdataStronghold.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdataTemple.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdatavillages.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGlevel.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGlevel.dat_mcr c:usersUserAppDataRoaming.minecraftsaveshippnozisBGlevel.dat_old c:usersUserAppDataRoaming.minecraftsaveshippnozisBGplayershippnozis.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-1.-1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-1.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-2.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-2.1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-2.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.3.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-4.1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-4.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-4.3.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-5.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-5.3.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.0.-1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.0.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGsession.lock c:usersUserAppDataRoaming.minecraftscreenshots2013-10-05_20.44.58.png c:usersUserAppDataRoaming.minecraftscreenshots2013-10-05_20.59.59.png c:usersUserAppDataRoaming.minecraftstatsstats_hippnozis_unsent.dat c:usersUserAppDataRoaming.minecraftstatsstats_hippnozis_unsent.old c:usersUserAppDataRoaming.minecraftversions1. c:usersUserAppDataRoaming.minecraftversions1.6.4Optifine1.6.4Optifine.jar c:usersUserAppDataRoaming.minecraftversionsnativesjinput-dx8.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-dx8_64.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-raw.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-raw_64.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-wintab.dll c:usersUserAppDataRoaming.minecraftversionsnativeslwjgl.dll c:usersUserAppDataRoaming.minecraftversionsnativeslwjgl64.dll c:usersUserAppDataRoaming.minecraftversionsnativesOpenAL32.dll c:usersUserAppDataRoaming.minecraftversionsnativesOpenAL64.dll c:windowssystem32driversavgtpx86.sys c:windowssystem32frapsvid.dll . . ((((((((((((((((((((((((((((((((((((((( Drivers/Services ))))))))))))))))))))))))))))))))))))))))))))))))) . . -------Legacy_AVGTP -------Service_avgtp . . ((((((((((((((((((((((((( Files Created from 2013-09-10 to 2013-10-10  ))))))))))))))))))))))))))))))) . . 2013-10-08 11:29 . 2013-10-08 11:29  --------  d-----w-  c:program filesMalwarebytes' Anti-Malware 2013-10-08 11:29 . 2013-04-04 11:50  22856  ----a-w-  c:windowssystem32driversmbam.sys 2013-10-08 11:21 . 2013-10-08 11:21  --------  d-----w-  c:windowsERUNT 2013-10-08 11:14 . 2013-10-08 11:17  --------  d-----w-  C:AdwCleaner 2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:usersUserAppDataLocalLogMeIn 2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:programdataLogMeIn 2013-09-30 17:52 . 2013-09-30 17:52  --------  d-----w-  c:program filesAcclaim Entertainment 2013-09-11 17:49 . 2013-09-11 17:49  --------  d-----w-  c:programdataNexon 2013-09-11 16:49 . 2013-09-11 16:50  --------  d-----w-  c:usersUserAppDataLocalAkamai . . . (((((((((((((((((((((((((((((((((((((((( Find3M Report )))))))))))))))))))))))))))))))))))))))))))))))))))) . 2013-10-10 13:45 . 2013-10-10 13:45  40392  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{22508C58-C50A-41F9-89D2-F57EA351158A}MpKsl83bfdb04.sys 2013-10-09 13:08 . 2012-03-30 11:00  692616  ----a-w-  c:windowssystem32FlashPlayerApp.exe 2013-10-09 13:08 . 2011-08-07 14:11  71048  ----a-w-  c:windowssystem32FlashPlayerCPLApp.cpl 2013-09-06 17:07 . 2013-09-06 17:07  718712  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{A791E496-9C9C-4EC1-BCB5-B6B12246FAC6}gapaengine.dll 2013-09-05 05:02 . 2013-10-09 16:59  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{22508C58-C50A-41F9-89D2-F57EA351158A}mpengine.dll 2013-09-05 05:02 . 2013-10-09 14:55  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesBackupmpengine.dll 2013-08-22 18:02 . 2011-08-11 08:57  697992  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesNISBackupgapaengine.dll 2013-07-25 08:57 . 2013-08-14 11:25  1620992  ----a-w-  c:windowssystem32WMVDECOD.DLL 2013-07-19 01:41 . 2013-08-14 11:25  2048  ----a-w-  c:windowssystem32tzres.dll 2011-09-10 00:24 . 2013-10-01 15:48  119808  ----a-w-  c:program filesmozilla firefoxcomponentsGoogleDesktopMozilla.dll . . ((((((((((((((((((((((((((((((((((((( Reg Loading Points )))))))))))))))))))))))))))))))))))))))))))))))))) . . *Note* empty entries & legit default entries are not shown REGEDIT4 . [HKEY_CURRENT_USERSOFTWAREMicrosoftWindowsCurrentVersionRun] "DAEMON Tools Lite"="c:program filesDAEMON Tools LiteDTLite.exe" [2011-08-02 4910912] "Sidebar"="c:program filesWindows Sidebarsidebar.exe" [2010-11-20 1174016] "Skype"="c:program filesSkypePhoneSkype.exe" [2013-10-02 20472992] "Akamai NetSession Interface"="c:usersUserAppDataLocalAkamainetsession_win.exe" [2013-06-04 4489472] . [HKEY_LOCAL_MACHINESOFTWAREMicrosoftWindowsCurrentVersionRun] "BCSSync"="c:program filesMicrosoft OfficeOffice14BCSSync.exe" [2010-03-13 91520] "ZSSnp211"="c:windowsZSSnp211.exe" [2007-04-06 57344] "Google Desktop Search"="c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe" [2011-09-10 30192] "MSC"="c:program filesMicrosoft Security Clientmsseces.exe" [2013-06-20 995176] "IgfxTray"="c:windowssystem32igfxtray.exe" [2012-11-13 138784] "HotKeysCmds"="c:windowssystem32hkcmd.exe" [2012-11-13 172064] "Persistence"="c:windowssystem32igfxpers.exe" [2012-11-13 173600] "SunJavaUpdateSched"="c:program filesCommon FilesJavaJava Updatejusched.exe" [2013-03-12 253816] "LogMeIn Hamachi Ui"="d:downloadsmyНова папкаhamachi-2-ui.exe" [2013-10-01 2345296] . [HKEY_LOCAL_MACHINEsoftwaremicrosoftwindowscurrentversionpoliciessystem] "ConsentPromptBehaviorUser"= 3 (0x3) "EnableUIADesktopToggle"= 0 (0x0) . [HKEY_LOCAL_MACHINEsoftwaremicrosoftwindows ntcurrentversionwindows] "AppInit_DLLs"=c:progra~1GoogleGOOGLE~2GoogleDesktopNetwork3.dll . [HKEY_LOCAL_MACHINESYSTEMCurrentControlSetControlSafeBootMinimalMsMpSvc] @="Service" . [HKLM~startupfolderC:^Users^User^AppData^Roaming^Microsoft^Windows^Start Menu^Programs^Startup^GamersFirst LIVE!.lnk] path=c:usersUserAppDataRoamingMicrosoftWindowsStart MenuProgramsStartupGamersFirst LIVE!.lnk backup=c:windowspssGamersFirst LIVE!.lnk.Startup backupExtension=.Startup . [HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregDomino] 2006-08-18 13:58  49152  ----a-w-  c:windowsDomino.exe . [HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregFacebook Update] 2012-07-11 20:44  138096  ----atw-  c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe . R2 SkypeUpdate;Skype Updater;c:program filesSkypeUpdaterUpdater.exe [2013-09-05 171680] R3 dmvsc;dmvsc;c:windowssystem32driversdmvsc.sys [2010-11-20 62464] R3 EagleXNt;EagleXNt;c:windowssystem32driversEagleXNt.sys [x] R3 FairplayKD;FairplayKD;c:programdataMTA San Andreas All1.3tempFairplayKD.sys [x] R3 GoogleDesktopManager-051210-111108;Диспечер на Google Desktop 5.9.1005.12335;c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe [2011-09-10 30192] R3 NisDrv;Microsoft Network Inspection System;c:windowssystem32DRIVERSNisDrvWFP.sys [2013-06-18 107392] R3 NisSrv;Мрежова проверка на Microsoft;c:program filesMicrosoft Security ClientNisSrv.exe [2013-06-20 295376] R3 RdpVideoMiniport;Remote Desktop Video Miniport Driver;c:windowssystem32driversrdpvideominiport.sys [2010-11-20 15872] R3 Synth3dVsc;Synth3dVsc;c:windowssystem32driverssynth3dvsc.sys [2010-11-20 77184] R3 terminpt;Microsoft Remote Desktop Input Driver;c:windowssystem32driversterminpt.sys [2010-11-20 25600] R3 TsUsbFlt;TsUsbFlt;c:windowssystem32driverstsusbflt.sys [2010-11-20 52224] R3 TsUsbGD;Remote Desktop Generic USB Device;c:windowssystem32driversTsUsbGD.sys [2010-11-20 27264] R3 tsusbhub;tsusbhub;c:windowssystem32driverstsusbhub.sys [2010-11-20 112640] R3 VGPU;VGPU;c:windowssystem32driversrdvgkmd.sys [x] R3 vvftav211;vvftav211;c:windowssystem32driversvvftav211.sys [2007-12-10 480128] R3 WatAdminSvc;Услуга на технологиите за активиране на Windows;c:windowssystem32WatWatAdminSvc.exe [2011-08-05 1343400] R3 WinRing0_1_2_0;WinRing0_1_2_0;d:mcRazer Game BoosterDriverWinRing0.sys [x] R3 XDva394;XDva394;c:windowssystem32XDva394.sys [x] R3 XDva397;XDva397;c:windowssystem32XDva397.sys [x] R3 XDva399;XDva399;c:windowssystem32XDva399.sys [x] R3 XDva401;XDva401;c:windowssystem32XDva401.sys [x] R3 ZSMC30x;USB PC Camera Service ZSMC30x;c:windowssystem32DriversZS211.sys [2007-12-05 1537024] S1 dtsoftbus01;DAEMON Tools Virtual Bus Driver;c:windowssystem32DRIVERSdtsoftbus01.sys [2011-08-05 232512] S1 MpKsl83bfdb04;MpKsl83bfdb04;c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{22508C58-C50A-41F9-89D2-F57EA351158A}MpKsl83bfdb04.sys [2013-10-10 40392] S2 Hamachi2Svc;LogMeIn Hamachi Tunneling Engine;d:downloadsmyНова папкаhamachi-2.exe [2013-10-01 1612112] S2 RzKLService;RzKLService;d:mcRazer Game BoosterRzKLService.exe [2013-09-18 106472] S2 Skype C2C Service;Skype C2C Service;c:programdataSkypeToolbarsSkype C2C Servicec2c_service.exe [2013-09-16 3273088] S2 TeamViewer8;TeamViewer 8;c:program filesTeamViewerVersion8TeamViewer_Service.exe [2013-08-07 4308320] S3 RTL8167;Realtek 8167 NT Driver;c:windowssystem32DRIVERSRt86win7.sys [2009-03-01 139776] . . [HKEY_LOCAL_MACHINEsoftwaremicrosoftactive setupinstalled components{8A69D345-D564-463c-AFF1-A69D9E530F96}] 2013-10-06 11:22  1185744  ----a-w-  c:program filesGoogleChromeApplication30.0.1599.69Installerchrmstp.exe . Contents of the 'Scheduled Tasks' folder . 2013-10-10 c:windowsTasksAdobe Flash Player Updater.job - c:windowssystem32MacromedFlashFlashPlayerUpdateService.exe [2012-03-30 13:08] . 2013-10-05 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000Core.job - c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44] . 2013-10-10 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000UA.job - c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44] . 2013-10-10 c:windowsTasksGoogleUpdateTaskMachineCore.job - c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14] . 2013-10-10 c:windowsTasksGoogleUpdateTaskMachineUA.job - c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14] . . ------- Supplementary Scan ------- . uInternet Settings,ProxyOverride = <local> IE: Download all by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm IE: Download by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm IE: E&xport to Microsoft Excel - c:progra~1MICROS~2Office14EXCEL.EXE/3000 IE: Free YouTube Download - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeytvdownloader.htm IE: Free YouTube to MP3 Converter - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeyoutubetomp3converter.htm IE: Se&nd to OneNote - c:progra~1MICROS~2Office14ONBttnIE.dll/105 IE: ????3?? - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm IE: ????3?????? - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm FF - ProfilePath - c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.default FF - prefs.js: browser.search.defaulturl - FF - ExtSQL: 2013-09-30 19:10; WebSiteRecommendation@weliketheweb.com; c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultextensionsWebSiteRecommendation@weliketheweb.com . . --------------------- LOCKED REGISTRY KEYS --------------------- . [HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}Џ] @Allowed: (Read) (RestrictedCode) @="c:Program FilesFlashGet NetworkFlashGet 3GetUrl.htm" "contexts"=dword:00000022 . [HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}ЏhQиђю”Ґc] @Allowed: (Read) (RestrictedCode) @="c:Program FilesFlashGet NetworkFlashGet 3GetAllUrl.htm" "contexts"=dword:000000f3 . [HKEY_LOCAL_MACHINESYSTEMControlSet001ControlClass{4D36E96D-E325-11CE-BFC1-08002BE10318}0000AllUserSettings] @Denied: (A) (Users) @Denied: (A) (Everyone) @Allowed: (B 1 2 3 4 5) (S-1-5-20) "BlindDial"=dword:00000000 . [HKEY_LOCAL_MACHINESYSTEMControlSet001ControlPCWSecurity] @Denied: (Full) (Everyone) . ------------------------ Other Running Processes ------------------------ . c:program filesMicrosoft Security ClientMsMpEng.exe c:windowssystem32PnkBstrA.exe c:windowssystem32taskhost.exe c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSVC.EXE c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSvcM.exe d:downloadsmyd:downloadsmyd:downloadsmyd:downloadsmyc:windowssystem32svchost.exe c:windowsSystem32WUDFHost.exe c:windowssystem32conhost.exe c:windowssystem32DllHost.exe c:windowssystem32sppsvc.exe c:program filesWindows Media Playerwmpnetwk.exe c:windowssystem32taskhost.exe . ************************************************************************** . Completion time: 2013-10-10  17:00:57 - machine was rebooted ComboFix-quarantined-files.txt  2013-10-10 14:00 ComboFix2.txt  2013-10-09 13:37 . Pre-Run: 20 357 251 072 bytes free Post-Run: 20 209 168 384 bytes free . - - End Of File - - 393043544EF5FC5DEAE02717291FDDBF A36C5E4F47E84449FF07ED3517B43A31  

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Какво е положението със системата ви след процедурите до тук..? Наблюдавате ли първоначалните проблеми...?

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Системата се държи доста добре.Имам чувството че все едно е преинсталирана .. :)

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Системата се държи доста добре.Имам чувството че все едно е преинсталирана .. :)


Радвам се ,че съм бил полезен..! :)



Деинсталирайте ComboFix така:

[*]Натиснете Start ==> Run ==> въведете командата Combofix /Uninstall ==> OK

[*]Публикувано изображение

[*]Моля, следвайте инструкциите, за да деинсталирате ComboFix. Ще получите съобщение, в което се казва ComboFix е деинсталиран успешно.


Публикувано изображение Изтеглете Delfix.exe и го стартирайте. Сложете отметка пред Remove disinfection tools => натиснете бутона Run Инструмента ще се самоизтрие след като приключи своята задача!


Публикувано изображение Деинсталирайте adwcleaner.exe

[*]Моля, затворете всички отворени програми и интернет браузъри.

[*]Кликнете два пъти върху adwcleaner.exe за да стартирате инструмента.

[*]Кликнете върху Uninstall .

[*]Щракнете върху Yes за да деинсталирате Adwcleaner


Публикувано изображение Изтрийте всичко друго което е останало след процедурите (използвано в лечението).Препоръчвам програмата Malwarebytes' Anti-Malware  да остане на вашия компютър и периодично да сканирате системата си с нея (поне един -два пъти в седмицата),като не забравяйте да обновите дефинициите и преди всяко сканиране..!


Стартирайте PatchMyPC и инсталирайте всички ъпдейти, които инструмента ви предложи.


Ако няма други проблеми,маркирам случая за "РЕШЕН"..Бъдете здрави и ви пожелавам безопасен интернет..! :)

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

  • Разглеждащи това в момента   0 потребители

    Няма регистрирани потребители разглеждащи тази страница.

  • Горещи теми в момента

  • Подобни теми

    • от Йорданка Т. Иванова
      Здравейте, при опит за възстановяване на системата към предишна дата, Avast направи пълно сканиране на компютъра и ми премести в клетка заразените файлове.
      Има ли възможност да се почисти компютъра от въпросните заплахи и съответно да си възстановя файловете, най-вече тези /ако има такива/, които са необходими за правилното функциониране на системата.
      П.П.: Пълен лаик съм на тема антивирусни програми.
      Нов Microsoft Office PowerPoint Presentation.pptx

      Ето го резултата от файла FRST
      Scan result of Farbar Recovery Scan Tool (FRST) (x64) Version: 24.10.2018
      Ran by Rosko (administrator) on ROSKO-PC (28-10-2018 14:36:09)
      Running from C:\Users\Rosko\Downloads
      Loaded Profiles: Rosko (Available Profiles: Rosko)
      Platform: Windows 7 Ultimate (X64) Language: Български (България)
      Internet Explorer Version 8 (Default browser: Chrome)
      Boot Mode: Normal
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      (Intel Corporation) C:\Windows\System32\igfxCUIService.exe
      (AVAST Software) C:\Program Files\AVAST Software\Avast\AvastSvc.exe
      (Windows (R) Win 7 DDK provider) C:\Program Files (x86)\Qualcomm Atheros\Bluetooth Suite\AdminService.exe
      (Baidu, Inc.) C:\Program Files (x86)\Baidu Security\Baidu Antivirus\\BAVSvc.exe
      (Baidu, Inc.) C:\Program Files (x86)\Baidu Security\Baidu Antivirus\\BHipsSvc.exe
      (Intel) C:\Program Files (x86)\Intel Driver Update Utility\DSAService.exe
      (Qualcomm®Atheros®) C:\Program Files (x86)\Qualcomm Atheros\Bluetooth Suite\BtvStack.exe
      (Synaptics Incorporated) C:\Program Files\Synaptics\SynTP\SynTPEnh.exe
      (Realtek Semiconductor) C:\Program Files\Realtek\Audio\HDA\RAVCpl64.exe
      (Intel(R) Corporation) C:\Program Files\Intel\iCLS Client\HeciServer.exe
      (Baidu, Inc.) C:\Program Files (x86)\Baidu Security\Baidu Antivirus\\BavTray.exe
      (Intel) C:\Program Files (x86)\Intel Driver Update Utility\DSATray.exe
      (AVAST Software) C:\Program Files\AVAST Software\Avast\AvastUI.exe
      () C:\Program Files\Intel Driver Update Utility\SUR\SurSvc.exe
      (TeamViewer GmbH) C:\Program Files (x86)\TeamViewer\TeamViewer_Service.exe
      () C:\Program Files (x86)\CalendarTool\\CalendarServ.exe
      () C:\Program Files (x86)\CalendarTool\\calendar.exe
      (Microsoft Corporation) C:\Windows\Microsoft.NET\Framework64\v3.0\WPF\PresentationFontCache.exe
      (Baidu, Inc.) C:\Program Files (x86)\Baidu Security\Baidu Antivirus\\bavhm.exe
      (Intel Corporation) C:\Windows\System32\igfxEM.exe
      (Intel Corporation) C:\Windows\System32\igfxHK.exe
      (Synaptics Incorporated) C:\Program Files\Synaptics\SynTP\SynTPHelper.exe
      () C:\Program Files\Intel\SUR\QUEENCREEK\esrv.exe
      (Intel Corporation) C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\DAL\jhi_service.exe
      (Intel Corporation) C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\LMS\LMS.exe
      () C:\Program Files\Intel\SUR\QUEENCREEK\esrv_svc.exe
      () C:\Program Files\Intel\SUR\QUEENCREEK\esrv.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Baidu Inc.) C:\Program Files (x86)\Baidu Security\Baidu Antivirus\bavadvtools2\8C8AEEC1-5166-4CE7-BBAD-7C37409D0C73\tool\bdMiniDownloaderGB_BAV-Mini_32_1002.exe
      (Baidu Inc.) C:\Users\Rosko\AppData\Local\MiniService\MiniService.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Viber Media S.à r.l.) C:\Users\Rosko\AppData\Local\Viber\Viber.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      () C:\Program Files\Realtek\Audio\HDA\FMAPP.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [SynTPEnh] => C:\Program Files\Synaptics\SynTP\SynTPEnh.exe [2778352 2014-01-24] (Synaptics Incorporated)
      HKLM\...\Run: [RTHDVCPL] => C:\Program Files\Realtek\Audio\HDA\RAVCpl64.exe [13672304 2014-03-21] (Realtek Semiconductor)
      HKLM\...\Run: [AvastUI.exe] => C:\Program Files\AVAST Software\Avast\AvLaunch.exe [242392 2018-10-18] (AVAST Software)
      HKLM-x32\...\Run: [Baidu Antivirus] => C:\Program Files (x86)\Baidu Security\Baidu Antivirus\\BavTray.exe [2553328 2015-07-14] (Baidu, Inc.)
      HKLM-x32\...\Run: [DSATray] => C:\Program Files (x86)\Intel Driver Update Utility\DsaTray.exe [132856 2017-05-18] (Intel)
      HKLM\...\Policies\Explorer\Run: [BtvStack] => C:\Program Files (x86)\Qualcomm Atheros\Bluetooth Suite\BtvStack.exe [133760 2013-12-24] (Qualcomm®Atheros®)
      HKU\S-1-5-21-749869763-3409154425-2811610640-1000\...\Run: [Viber] => C:\Users\Rosko\AppData\Local\Viber\Viber.exe [36762184 2018-10-22] (Viber Media S.à r.l.)
      HKU\S-1-5-21-749869763-3409154425-2811610640-1000\...\MountPoints2: {c4a92fbb-e173-11e7-9426-f8a963743fcb} - G:\LG_PC_Programs.exe
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      Tcpip\Parameters: [DhcpNameServer]
      Tcpip\..\Interfaces\{2FB69C23-4CBD-4252-994A-27D31EDC0D6D}: [DhcpNameServer]
      Internet Explorer:
      HKLM\Software\Microsoft\Internet Explorer\Main,Start Page = about:blank
      HKLM\Software\Wow6432Node\Microsoft\Internet Explorer\Main,Start Page = about:blank
      HKLM\Software\Microsoft\Internet Explorer\Main,Default_Page_URL = 
      HKLM\Software\Wow6432Node\Microsoft\Internet Explorer\Main,Default_Page_URL = 
      HKU\S-1-5-21-749869763-3409154425-2811610640-1000\Software\Microsoft\Internet Explorer\Main,Search Page = hxxp://www.microsoft.com/isapi/redir.dll?prd=ie&ar=iesearch
      HKU\S-1-5-21-749869763-3409154425-2811610640-1000\Software\Microsoft\Internet Explorer\Main,Start Page = about:blank
      HKU\S-1-5-21-749869763-3409154425-2811610640-1000\Software\Microsoft\Internet Explorer\Main,Start Page Redirect Cache = hxxp://www.msn.com/?ocid=iehp
      Filter: deflate - {8f6b0360-b80d-11d0-a9b3-006097942311} - C:\Windows\system32\urlmon.dll [2009-07-14] (Microsoft Corporation)
      Filter-x32: deflate - {8f6b0360-b80d-11d0-a9b3-006097942311} - C:\Windows\SysWOW64\urlmon.dll [2009-07-14] (Microsoft Corporation)
      Filter: gzip - {8f6b0360-b80d-11d0-a9b3-006097942311} - C:\Windows\system32\urlmon.dll [2009-07-14] (Microsoft Corporation)
      Filter-x32: gzip - {8f6b0360-b80d-11d0-a9b3-006097942311} - C:\Windows\SysWOW64\urlmon.dll [2009-07-14] (Microsoft Corporation)
      FF DefaultProfile: 2csmqmsd.default
      FF ProfilePath: C:\Users\Rosko\AppData\Roaming\Mozilla\Firefox\Profiles\2csmqmsd.default [2018-07-05]
      FF Homepage: Mozilla\Firefox\Profiles\2csmqmsd.default -> about:blank
      FF Extension: (Avast SafePrice) - C:\Users\Rosko\AppData\Roaming\Mozilla\Firefox\Profiles\2csmqmsd.default\Extensions\sp@avast.com.xpi [2018-10-18]
      FF Extension: (Avast Online Security) - C:\Users\Rosko\AppData\Roaming\Mozilla\Firefox\Profiles\2csmqmsd.default\Extensions\wrc@avast.com.xpi [2018-10-18]
      FF Plugin: @adobe.com/FlashPlayer -> C:\Windows\system32\Macromed\Flash\NPSWF64_31_0_0_122.dll [2018-10-09] ()
      FF Plugin-x32: @adobe.com/FlashPlayer -> C:\Windows\SysWOW64\Macromed\Flash\NPSWF32_31_0_0_122.dll [2018-10-09] ()
      FF Plugin-x32: @intel-webapi.intel.com/Intel WebAPI ipt;version=4.0.5 -> C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\IPT\npIntelWebAPIIPT.dll [2013-12-10] (Intel Corporation)
      FF Plugin-x32: @intel-webapi.intel.com/Intel WebAPI updater -> C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\IPT\npIntelWebAPIUpdater.dll [2013-12-10] (Intel Corporation)
      FF Plugin-x32: @java.com/JavaPlugin -> C:\Program Files (x86)\Java\jre6\bin\new_plugin\npjp2.dll [2015-08-18] (Sun Microsystems, Inc.)
      FF Plugin-x32: @tools.google.com/Google Update;version=3 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [2018-05-19] (Google Inc.)
      FF Plugin-x32: @tools.google.com/Google Update;version=9 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [2018-05-19] (Google Inc.)
      FF Plugin-x32: @videolan.org/vlc,version=2.2.4 -> C:\Program Files (x86)\VideoLAN\VLC\npvlc.dll [2016-06-01] (VideoLAN)
      FF Plugin-x32: Adobe Reader -> C:\Program Files (x86)\Adobe\Acrobat Reader DC\Reader\AIR\nppdf32.dll [2018-09-20] (Adobe Systems Inc.)
      FF ExtraCheck: C:\Program Files (x86)\mozilla firefox\defaults\pref\enpsysau.js [2017-09-10]
      CHR DefaultProfile: Default
      CHR Profile: C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default [2018-10-28]
      CHR Extension: (Презентации) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default\Extensions\aapocclcgogkmnckokdopfmhonfmgoek [2018-10-02]
      CHR Extension: (Документи) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default\Extensions\aohghmighlieiainnegkcijnfilokake [2018-10-02]
      CHR Extension: (Google Диск) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default\Extensions\apdfllckaahabafndbhieahigkjlhalf [2018-10-02]
      CHR Extension: (YouTube) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default\Extensions\blpcfgokakmgnkcojhhkbfbldkacnbeo [2018-10-02]
      CHR Extension: (Adobe Acrobat) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default\Extensions\efaidnbmnnnibpcajpcglclefindmkaj [2018-10-02]
      CHR Extension: (Avast SafePrice | Сравнение, сделки, купони) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default\Extensions\eofcbnmajmjmplflapaojjnihcjkigck [2018-10-19]
      CHR Extension: (Таблици) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default\Extensions\felcaaldnbdncclmgdcncolpebgiejap [2018-10-02]
      CHR Extension: (Google Документи офлайн) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default\Extensions\ghbmnnjooekpmoecnnnilnnbdlolhkhi [2018-10-08]
      CHR Extension: (АБВ Уведомител) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default\Extensions\glkfpmcniebkbeakjdpobddpjghbapec [2018-10-28]
      CHR Extension: (Avast Online Security) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default\Extensions\gomekmidlodglbbmalcneegieacbdmki [2018-10-18]
      CHR Extension: (Плащания в уеб магазина на Chrome) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default\Extensions\nmmhkkegccagdldgiimedpiccmgmieda [2018-10-02]
      CHR Extension: (Gmail) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default\Extensions\pjkljhegncpnkpknbcohdijeoejaedia [2018-10-02]
      CHR Extension: (Chrome Media Router) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\Default\Extensions\pkedcjkdefgpdelpbcmbmeomcjbeemfm [2018-10-28]
      CHR Profile: C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey [2018-10-28] <==== ATTENTION
      CHR Extension: (Презентации) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\aapocclcgogkmnckokdopfmhonfmgoek [2017-10-23]
      CHR Extension: (Документи) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\aohghmighlieiainnegkcijnfilokake [2017-10-23]
      CHR Extension: (Google Диск) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\apdfllckaahabafndbhieahigkjlhalf [2015-10-22]
      CHR Extension: (YouTube) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\blpcfgokakmgnkcojhhkbfbldkacnbeo [2015-09-24]
      CHR Extension: (Google Търсене) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\coobgpohoikkiipiblmjeljniedjpjpf [2015-11-02]
      CHR Extension: (АБВ Уведомител) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\cpbekonjicgkldkmopnamgglbfaiojje [2015-11-25]
      CHR Extension: (Adobe Acrobat) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\efaidnbmnnnibpcajpcglclefindmkaj [2017-03-08]
      CHR Extension: (Таблици) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\felcaaldnbdncclmgdcncolpebgiejap [2017-11-11]
      CHR Extension: (Farmville2 X-Press) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\gbgjpdhhnbgmnafojckjmjogcpoinlim [2018-10-24]
      CHR Extension: (Google Документи офлайн) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\ghbmnnjooekpmoecnnnilnnbdlolhkhi [2018-08-21]
      CHR Extension: (Avast Online Security) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\gomekmidlodglbbmalcneegieacbdmki [2018-10-18]
      CHR Extension: (Плащания в уеб магазина на Chrome) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\nmmhkkegccagdldgiimedpiccmgmieda [2018-04-12]
      CHR Extension: (Gmail) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\pjkljhegncpnkpknbcohdijeoejaedia [2015-04-23]
      CHR Extension: (Chrome Media Router) - C:\Users\Rosko\AppData\Local\Google\Chrome\User Data\lejutplovshprohey\Extensions\pkedcjkdefgpdelpbcmbmeomcjbeemfm [2018-10-01]
      CHR HKU\S-1-5-21-749869763-3409154425-2811610640-1000\SOFTWARE\Google\Chrome\Extensions\...\Chrome\Extension: [efaidnbmnnnibpcajpcglclefindmkaj] - hxxps://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [eofcbnmajmjmplflapaojjnihcjkigck] - hxxps://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [gomekmidlodglbbmalcneegieacbdmki] - hxxps://clients2.google.com/service/update2/crx
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      S3 aswbIDSAgent; C:\Program Files\AVAST Software\Avast\x64\aswidsagenta.exe [8188768 2018-10-18] (AVAST Software)
      R2 AtherosSvc; C:\Program Files (x86)\Qualcomm Atheros\Bluetooth Suite\adminservice.exe [318592 2013-12-24] (Windows (R) Win 7 DDK provider) [File not signed]
      R2 avast! Antivirus; C:\Program Files\AVAST Software\Avast\AvastSvc.exe [325024 2018-10-18] (AVAST Software)
      R2 BavSvc; C:\Program Files (x86)\Baidu Security\Baidu Antivirus\\BavSvc.exe [2805208 2015-07-14] (Baidu, Inc.)
      S3 BdSandboxSrv; C:\Program Files (x86)\Baidu Security\Baidu Antivirus\\BdSandboxSrv64.exe [490480 2015-04-29] (Baidu, Inc.)
      R2 BHipsSvc; C:\Program Files (x86)\Baidu Security\Baidu Antivirus\\BHipsSvc.exe [544032 2015-07-14] (Baidu, Inc.)
      S3 BsrSvc; C:\Program Files (x86)\Baidu Security\Baidu Antivirus\BavAdvTools2\128B4BEC-5D89-43AD-BAA8-207084AA0E4F\tool\BsrSvc.exe [3503416 2015-07-08] (Baidu, Inc.)
      R2 DSAService; C:\Program Files (x86)\Intel Driver Update Utility\DSAService.exe [21240 2017-05-18] (Intel)
      R2 ESRV_SVC_QUEENCREEK; C:\Program Files\Intel\SUR\QUEENCREEK\esrv_svc.exe [824592 2017-03-07] ()
      R2 igfxCUIService1.0.0.0; C:\Windows\system32\igfxCUIService.exe [355232 2015-08-09] (Intel Corporation)
      R2 Intel(R) Capability Licensing Service Interface; C:\Program Files\Intel\iCLS Client\HeciServer.exe [747520 2013-08-27] (Intel(R) Corporation) [File not signed]
      S3 Intel(R) Capability Licensing Service TCP IP Interface; C:\Program Files\Intel\iCLS Client\SocketHeciServer.exe [828376 2013-08-27] (Intel(R) Corporation)
      R2 jhi_service; C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\DAL\jhi_service.exe [169432 2013-12-10] (Intel Corporation)
      R2 MiniService; C:\Users\Rosko\AppData\Local\MiniService\MiniService.exe [103616 2018-10-28] (Baidu Inc.) [File not signed] <==== ATTENTION
      R2 SystemUsageReportSvc_QUEENCREEK; C:\Program Files\Intel Driver Update Utility\SUR\SurSvc.exe [157456 2017-03-07] ()
      R2 TeamViewer; C:\Program Files (x86)\TeamViewer\TeamViewer_Service.exe [11644656 2018-09-10] (TeamViewer GmbH)
      R2 TheCalendarService; C:\Program Files (x86)\CalendarTool\\CalendarServ.exe [152720 2017-08-09] ()
      S3 USER_ESRV_SVC_QUEENCREEK; C:\Program Files\Intel\SUR\QUEENCREEK\esrv_svc.exe [824592 2017-03-07] ()
      R2 WinDefend; C:\Program Files\Windows Defender\mpsvc.dll [1011712 2009-07-14] (Microsoft Corporation)
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      S3 aswArPot; C:\Windows\System32\drivers\aswArPot.sys [201408 2018-10-18] (AVAST Software)
      S3 aswbidsdriver; C:\Windows\System32\drivers\aswbidsdrivera.sys [230512 2018-10-18] (AVAST Software)
      S3 aswbidsh; C:\Windows\System32\drivers\aswbidsha.sys [201928 2018-10-18] (AVAST Software)
      S3 aswblog; C:\Windows\System32\drivers\aswbloga.sys [346760 2018-10-18] (AVAST Software)
      S3 aswbuniv; C:\Windows\System32\drivers\aswbuniva.sys [59664 2018-10-18] (AVAST Software)
      R1 aswHdsKe; C:\Windows\System32\drivers\aswHdsKe.sys [185240 2018-10-18] (AVAST Software)
      S3 aswHwid; C:\Windows\System32\drivers\aswHwid.sys [47064 2018-10-18] (AVAST Software)
      R1 aswKbd; C:\Windows\System32\drivers\aswKbd.sys [42456 2018-10-18] (AVAST Software)
      R2 aswMonFlt; C:\Windows\System32\drivers\aswMonFlt.sys [163376 2018-10-18] (AVAST Software)
      S3 aswRdr; C:\Windows\System32\drivers\aswRdr2.sys [111968 2018-10-18] (AVAST Software)
      R0 aswRvrt; C:\Windows\System32\drivers\aswRvrt.sys [88112 2018-10-18] (AVAST Software)
      S3 aswSnx; C:\Windows\System32\drivers\aswSnx.sys [1028840 2018-10-18] (AVAST Software)
      R1 aswSP; C:\Windows\System32\drivers\aswSP.sys [467904 2018-10-18] (AVAST Software)
      S3 aswStm; C:\Windows\System32\drivers\aswStm.sys [208640 2018-10-18] (AVAST Software)
      S3 aswVmm; C:\Windows\System32\drivers\aswVmm.sys [381144 2018-10-18] (AVAST Software)
      U3 BdApiUtil; C:\Program Files (x86)\Baidu Security\Baidu Antivirus\\BdApiUtil64.sys [116936 2015-07-14] (Baidu, Inc.)
      R3 bdark64; C:\Windows\system32\drivers\bdark64.sys [78792 2015-04-20] ()
      U3 BdCameraProtect; C:\Program Files (x86)\Baidu Security\Baidu Antivirus\\BdCameraProtect64.sys [25000 2015-07-14] (Baidu, Inc.)
      S3 BdSandbox; C:\Windows\System32\drivers\BdSandbox.sys [235976 2015-04-29] (Baidu, Inc.)
      R1 Bfilter; C:\Windows\System32\drivers\Bfilter.sys [62920 2015-07-14] (Baidu, Inc.)
      R1 Bfmon; C:\Windows\System32\drivers\Bfmon.sys [38344 2015-07-14] (Baidu, Inc.)
      R1 Bnbase; C:\Windows\System32\drivers\bnbasex64.sys [62792 2015-07-14] (Baidu, Inc.)
      R1 Bndef; C:\Windows\System32\drivers\bndef64.sys [487144 2015-07-14] (Baidu, Inc.)
      R3 Bnmon; C:\Program Files (x86)\Baidu Security\Baidu Antivirus\\Bnmon64.sys [82376 2015-07-14] (Baidu, Inc.)
      R1 Bprotect; C:\Windows\System32\drivers\Bprotect.sys [171464 2015-07-14] (Baidu, Inc.)
      S3 BTATH_LWFLT; C:\Windows\System32\DRIVERS\btath_lwflt.sys [77464 2013-12-24] (Qualcomm Atheros)
      R1 HWiNFO32; C:\Windows\SysWOW64\drivers\HWiNFO64A.SYS [27552 2016-08-08] (REALiX(tm))
      R3 MEIx64; C:\Windows\System32\DRIVERS\TeeDriverx64.sys [100312 2013-12-10] (Intel Corporation)
      R3 RTSPER; C:\Windows\System32\DRIVERS\RtsPer.sys [466136 2014-01-14] (Realsil Semiconductor Corporation)
      R3 semav6msr64; C:\Windows\system32\drivers\semav6msr64.sys [21984 2016-10-18] ()
      U3 aswbdisk; no ImagePath
      U0 Partizan; system32\drivers\Partizan.sys [X]
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-10-28 14:35 - 2018-10-28 14:36 - 000000000 ____D C:\FRST
      2018-10-28 14:35 - 2018-10-28 14:35 - 002414592 _____ (Farbar) C:\Users\Rosko\Downloads\FRST64.exe
      2018-10-28 14:28 - 2018-10-28 14:36 - 000021836 _____ C:\Users\Rosko\Downloads\FRST.txt
      2018-10-28 14:26 - 2018-10-28 14:27 - 000020080 _____ C:\Users\Rosko\Downloads\Addition.txt
      2018-10-28 13:34 - 2018-10-28 13:34 - 000000000 ____D C:\Users\Rosko\AppData\Local\MiniService
      2018-10-28 13:29 - 2018-10-28 13:32 - 000000000 ____D C:\ProgramData\BsrSvc_exe
      2018-10-28 13:19 - 2018-10-28 13:20 - 000617400 _____ C:\Users\Rosko\Desktop\Нов Microsoft Office PowerPoint Presentation.pptx
      2018-10-28 12:40 - 2018-10-28 13:16 - 000000000 ____D C:\ProgramData\BavSvc_exe
      2018-10-28 12:37 - 2018-10-28 12:37 - 000000000 ____D C:\Users\Rosko\AppData\Local\Viber
      2018-10-28 09:17 - 2018-10-28 11:16 - 000000000 ____D C:\Users\Rosko\Desktop\официялни споразумения 2018-2019г
      2018-10-26 17:03 - 2018-10-26 17:03 - 000102327 _____ C:\Users\Rosko\Downloads\П-03001718127835-177-001_archive (1).zip
      2018-10-24 10:41 - 2018-10-24 10:41 - 000000000 ____D C:\Users\Rosko\AppData\Roaming\AVAST Software
      2018-10-24 10:39 - 2018-10-24 10:39 - 000611358 _____ C:\Users\Rosko\Downloads\379984975 (1).pdf
      2018-10-24 10:32 - 2018-10-28 12:37 - 000000000 ____D C:\Users\Rosko\AppData\Local\AVAST Software
      2018-10-22 15:05 - 2018-10-22 15:06 - 000103383 _____ C:\Users\Rosko\Downloads\П-03001718185275-040-001_archive.zip
      2018-10-20 07:48 - 2018-10-20 07:48 - 000230931 _____ C:\Users\Rosko\Downloads\ЗП Ростислав Недков 19.10 (1).pdf
      2018-10-20 07:40 - 2018-10-20 07:40 - 000230931 _____ C:\Users\Rosko\Downloads\ЗП Ростислав Недков 19.10.pdf
      2018-10-19 08:51 - 2018-10-19 08:51 - 002437339 _____ C:\Users\Rosko\Downloads\dec92_2016_1010_баркод_с_ръководство_за_потребителя.rar
      2018-10-18 18:17 - 2018-10-18 18:17 - 000665976 _____ C:\Users\Rosko\Downloads\Re6enie_VAS_27.02.2018 (1).pdf
      2018-10-18 11:52 - 2018-10-18 11:52 - 000039854 _____ C:\Users\Rosko\Downloads\nlnazadyljenia[1] (1).pdf
      2018-10-18 10:16 - 2018-10-18 10:16 - 000001922 _____ C:\Users\Public\Desktop\Avast Free Antivirus.lnk
      2018-10-18 10:16 - 2018-10-18 10:16 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\AVAST Software
      2018-10-18 10:15 - 2018-10-18 10:15 - 000000000 ____D C:\Windows\System32\Tasks\Avast Software
      2018-10-18 10:14 - 2018-10-26 00:45 - 000004168 _____ C:\Windows\System32\Tasks\Avast Emergency Update
      2018-10-18 10:13 - 2018-10-18 10:13 - 001142072 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ucrtbase.dll
      2018-10-18 10:13 - 2018-10-18 10:13 - 000467904 _____ (AVAST Software) C:\Windows\system32\Drivers\aswSP.sys
      2018-10-18 10:13 - 2018-10-18 10:13 - 000381144 _____ (AVAST Software) C:\Windows\system32\Drivers\aswVmm.sys
      2018-10-18 10:13 - 2018-10-18 10:13 - 000378584 _____ (AVAST Software) C:\Windows\system32\aswBoot.exe
      2018-10-18 10:13 - 2018-10-18 10:13 - 000208640 _____ (AVAST Software) C:\Windows\system32\Drivers\aswStm.sys
      2018-10-18 10:13 - 2018-10-18 10:13 - 000201408 _____ (AVAST Software) C:\Windows\system32\Drivers\aswArPot.sys
      2018-10-18 10:13 - 2018-10-18 10:13 - 000163376 _____ (AVAST Software) C:\Windows\system32\Drivers\aswMonFlt.sys
      2018-10-18 10:13 - 2018-10-18 10:13 - 000111968 _____ (AVAST Software) C:\Windows\system32\Drivers\aswRdr2.sys
      2018-10-18 10:13 - 2018-10-18 10:13 - 000088112 _____ (AVAST Software) C:\Windows\system32\Drivers\aswRvrt.sys
      2018-10-18 10:13 - 2018-10-18 10:13 - 000047064 _____ (AVAST Software) C:\Windows\system32\Drivers\aswHwid.sys
      2018-10-18 10:13 - 2018-10-18 10:13 - 000000000 ____D C:\Program Files\Common Files\AVAST Software
      2018-10-18 10:13 - 2018-10-18 10:12 - 001028840 _____ (AVAST Software) C:\Windows\system32\Drivers\aswSnx.sys
      2018-10-18 10:13 - 2018-10-18 10:12 - 001001272 _____ (Microsoft Corporation) C:\Windows\system32\ucrtbase.dll
      2018-10-18 10:13 - 2018-10-18 10:12 - 000346760 _____ (AVAST Software) C:\Windows\system32\Drivers\aswbloga.sys
      2018-10-18 10:13 - 2018-10-18 10:12 - 000230512 _____ (AVAST Software) C:\Windows\system32\Drivers\aswbidsdrivera.sys
      2018-10-18 10:13 - 2018-10-18 10:12 - 000201928 _____ (AVAST Software) C:\Windows\system32\Drivers\aswbidsha.sys
      2018-10-18 10:13 - 2018-10-18 10:12 - 000185240 _____ (AVAST Software) C:\Windows\system32\Drivers\aswHdsKe.sys
      2018-10-18 10:13 - 2018-10-18 10:12 - 000059664 _____ (AVAST Software) C:\Windows\system32\Drivers\aswbuniva.sys
      2018-10-18 10:13 - 2018-10-18 10:12 - 000042456 _____ (AVAST Software) C:\Windows\system32\Drivers\aswKbd.sys
      2018-10-18 10:11 - 2018-10-18 11:43 - 000000000 ____D C:\ProgramData\AVAST Software
      2018-10-18 10:11 - 2018-10-18 10:11 - 000000000 ____D C:\Program Files\AVAST Software
      2018-10-18 10:09 - 2018-10-18 16:40 - 000000000 ____D C:\Users\Rosko\Documents\ViberDownloads
      2018-10-18 10:09 - 2018-10-18 10:09 - 000000000 ____D C:\Users\Rosko\AppData\Local\Viber Media S.à r.l
      2018-10-18 10:08 - 2018-10-28 13:47 - 000000000 ____D C:\Users\Rosko\AppData\Roaming\ViberPC
      2018-10-18 10:08 - 2018-10-18 10:08 - 000000956 _____ C:\Users\Rosko\AppData\Roaming\Microsoft\Windows\Start Menu\Viber.lnk
      2018-10-18 10:08 - 2018-10-18 10:08 - 000000954 _____ C:\Users\Rosko\Desktop\Viber.lnk
      2018-10-18 10:08 - 2018-10-18 10:08 - 000000000 ____D C:\Users\Rosko\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Viber
      2018-10-18 10:08 - 2018-10-18 10:08 - 000000000 ____D C:\Users\Rosko\AppData\Local\cache
      2018-10-18 10:07 - 2018-10-18 10:07 - 000000000 ____D C:\Users\Rosko\AppData\Local\Package Cache
      2018-10-18 10:06 - 2018-10-18 10:07 - 089186064 _____ (Viber Media Inc.) C:\Users\Rosko\Downloads\ViberSetup.exe
      2018-10-17 22:33 - 2018-10-17 22:33 - 000267977 _____ C:\Users\Rosko\Downloads\danuchno_oblagane_vnoski_na_zemedelski_proizvoditeli (4).pdf
      2018-10-17 22:08 - 2018-10-17 22:09 - 000749389 _____ C:\Users\Rosko\Downloads\Нов Презентация на Microsoft PowerPoint (2).pptx
      2018-10-17 21:41 - 2018-10-17 21:41 - 000749389 _____ C:\Users\Rosko\Downloads\Нов Презентация на Microsoft PowerPoint (1).pptx
      2018-10-17 21:14 - 2018-10-17 21:14 - 000267977 _____ C:\Users\Rosko\Downloads\danuchno_oblagane_vnoski_na_zemedelski_proizvoditeli (3).pdf
      2018-10-17 16:19 - 2018-10-17 16:19 - 000289368 _____ C:\Windows\Minidump\101718-14539-01.dmp
      2018-10-17 15:07 - 2018-10-17 15:07 - 003833305 _____ C:\Users\Rosko\Downloads\dec50_2017_19.03.2018.rar
      2018-10-17 14:45 - 2018-10-17 14:45 - 004074946 _____ C:\Users\Rosko\Downloads\dec50_2016_баркод_с_ръководство_за_потребителя.rar
      2018-10-17 12:55 - 2018-10-17 12:55 - 000648847 _____ C:\Users\Rosko\Downloads\DOM (2).pdf
      2018-10-17 07:52 - 2018-10-17 07:52 - 000012846 _____ C:\Users\Rosko\Downloads\Spravka vazstanovqvane (4).ods
      2018-10-17 07:52 - 2018-10-17 07:52 - 000000165 ____H C:\Users\Rosko\Downloads\~$Spravka vazstanovqvane (4).ods
      2018-10-16 13:59 - 2018-10-16 13:59 - 070935933 _____ C:\Users\Rosko\Downloads\wetransfer-a3a156.zip
      2018-10-16 12:10 - 2018-10-16 12:10 - 001266784 _____ C:\Users\Rosko\Downloads\statement (21).pdf
      2018-10-16 12:09 - 2018-10-16 12:09 - 001105420 _____ C:\Users\Rosko\Downloads\statement (20).pdf
      2018-10-16 10:58 - 2018-10-16 10:58 - 000648847 _____ C:\Users\Rosko\Downloads\DOM (1).pdf
      2018-10-16 08:14 - 2018-10-16 08:14 - 001939889 _____ C:\Users\Rosko\Downloads\95_09.pdf
      2018-10-15 16:01 - 2018-10-15 16:01 - 000749389 _____ C:\Users\Rosko\Downloads\Нов Презентация на Microsoft PowerPoint.pptx
      2018-10-15 15:57 - 2018-10-15 15:57 - 000102327 _____ C:\Users\Rosko\Downloads\П-03001718127835-177-001_archive.zip
      2018-10-15 13:54 - 2018-10-15 13:54 - 000648847 _____ C:\Users\Rosko\Downloads\Ползване на данъчни облекчения и наличие на задължения.pdf
      2018-10-15 13:47 - 2018-10-15 13:47 - 000648847 _____ C:\Users\Rosko\Downloads\DOM.pdf
      2018-10-12 13:49 - 2018-10-12 13:49 - 000009969 _____ C:\Users\Rosko\Downloads\РОСТИСЛАВ НЕДКОВ БОРИСОВ_2019_ЮПЕР.ZIP
      2018-10-12 13:49 - 2018-10-12 13:49 - 000001382 _____ C:\Users\Rosko\Downloads\НЕДКО БОРИСОВ КОЛЕВ_2019_ЮПЕР.ZIP
      2018-10-12 13:48 - 2018-10-12 13:48 - 000001499 _____ C:\Users\Rosko\Downloads\НЕДКО БОРИСОВ КОЛЕВ_2019_БОЖУРОВО.ZIP
      2018-10-12 09:23 - 2018-10-12 09:23 - 000075048 _____ C:\Users\Rosko\Downloads\Crystal Reports - sp_invoice_text_only_2007_5_l.rpt (1).pdf
      2018-10-10 12:50 - 2018-10-10 12:50 - 004808921 _____ C:\Users\Rosko\Downloads\П-03001718168660-004-001_archive.zip
      2018-10-06 15:09 - 2018-10-06 15:09 - 000611358 _____ C:\Users\Rosko\Downloads\379984975.pdf
      2018-10-04 13:28 - 2018-10-04 13:28 - 000156030 _____ C:\Users\Rosko\Downloads\П-03001718168660-040-001_archive.zip
      2018-10-01 18:27 - 2018-10-01 18:27 - 000143428 _____ C:\Users\Rosko\Downloads\Информационна брошура за бъдещите майки.pdf
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-10-28 14:23 - 2009-07-14 06:45 - 000016624 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-1.C7483456-A289-439d-8115-601632D005A0
      2018-10-28 14:23 - 2009-07-14 06:45 - 000016624 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-0.C7483456-A289-439d-8115-601632D005A0
      2018-10-28 14:19 - 2009-07-14 05:20 - 000000000 ____D C:\PerfLogs
      2018-10-28 14:11 - 2017-08-24 12:56 - 000000000 ____D C:\Users\Rosko\AppData\Roaming\CalendarTool
      2018-10-28 12:42 - 2009-07-14 07:13 - 000781298 _____ C:\Windows\system32\PerfStringBackup.INI
      2018-10-28 12:42 - 2009-07-14 05:20 - 000000000 ____D C:\Windows\inf
      2018-10-28 12:36 - 2017-06-10 14:47 - 000000000 __SHD C:\Users\Rosko\IntelGraphicsProfiles
      2018-10-28 12:36 - 2015-04-23 13:38 - 000000000 ____D C:\Program Files (x86)\TeamViewer
      2018-10-28 12:35 - 2009-07-14 07:08 - 000000006 ____H C:\Windows\Tasks\SA.DAT
      2018-10-28 11:44 - 2016-08-08 17:51 - 000000000 ___HD C:\Program Files (x86)\m3yE3E0
      2018-10-28 10:43 - 2015-04-23 12:58 - 000000000 ____D C:\Users\Rosko\AppData\Local\Microsoft Help
      2018-10-28 10:29 - 2017-01-10 10:04 - 000000000 ____D C:\Users\Rosko\AppData\Local\CrashDumps
      2018-10-27 19:48 - 2009-07-14 05:20 - 000000000 ____D C:\Windows\tracing
      2018-10-24 07:25 - 2015-04-24 13:10 - 000000000 ____D C:\Users\Rosko\AppData\Roaming\Skype
      2018-10-23 08:18 - 2017-02-01 21:07 - 000002441 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Acrobat Reader DC.lnk
      2018-10-18 09:43 - 2018-07-09 15:03 - 000000971 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\TeamViewer 13.lnk
      2018-10-18 09:43 - 2016-02-04 18:11 - 000002998 _____ C:\Windows\wininit.ini
      2018-10-17 16:19 - 2015-06-12 12:20 - 000000000 ____D C:\Windows\Minidump
      2018-10-17 16:18 - 2015-06-12 12:20 - 375178840 _____ C:\Windows\MEMORY.DMP
      2018-10-15 10:59 - 2009-07-14 07:08 - 000032534 _____ C:\Windows\Tasks\SCHEDLGU.TXT
      2018-10-09 21:41 - 2018-03-14 11:33 - 000004462 _____ C:\Windows\System32\Tasks\Adobe Flash Player NPAPI Notifier
      2018-10-09 21:41 - 2017-02-01 18:37 - 000842240 _____ (Adobe Systems Incorporated) C:\Windows\SysWOW64\FlashPlayerApp.exe
      2018-10-09 21:41 - 2017-02-01 18:37 - 000175104 _____ (Adobe Systems Incorporated) C:\Windows\SysWOW64\FlashPlayerCPLApp.cpl
      2018-10-09 21:41 - 2017-02-01 18:37 - 000004312 _____ C:\Windows\System32\Tasks\Adobe Flash Player Updater
      2018-10-09 21:41 - 2017-02-01 18:37 - 000000000 ____D C:\Windows\SysWOW64\Macromed
      2018-10-09 21:41 - 2017-02-01 18:37 - 000000000 ____D C:\Windows\system32\Macromed
      2018-10-04 13:28 - 2015-11-03 22:05 - 000000000 ____D C:\Users\Rosko\AppData\LocalLow\Adobe
      2018-10-01 21:10 - 2015-04-23 13:18 - 000000000 ____D C:\KMPlayer
      2018-10-01 08:27 - 2009-07-14 05:20 - 000000000 ____D C:\Windows\system32\NDF
      ==================== Files in the root of some directories =======
      2015-10-10 07:33 - 2015-10-10 07:33 - 000229019 _____ () C:\ProgramData\KTLVGTHRCQSO.dat
      2017-06-08 17:31 - 2017-06-08 17:31 - 000000017 _____ () C:\Users\Rosko\AppData\Local\resmon.resmoncfg
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\Windows\system32\winlogon.exe => File is digitally signed
      C:\Windows\system32\wininit.exe => File is digitally signed
      C:\Windows\SysWOW64\wininit.exe => File is digitally signed
      C:\Windows\explorer.exe => File is digitally signed
      C:\Windows\SysWOW64\explorer.exe => File is digitally signed
      C:\Windows\system32\svchost.exe => File is digitally signed
      C:\Windows\SysWOW64\svchost.exe => File is digitally signed
      C:\Windows\system32\services.exe => File is digitally signed
      C:\Windows\system32\User32.dll => File is digitally signed
      C:\Windows\SysWOW64\User32.dll => File is digitally signed
      C:\Windows\system32\userinit.exe => File is digitally signed
      C:\Windows\SysWOW64\userinit.exe => File is digitally signed
      C:\Windows\system32\rpcss.dll => File is digitally signed
      C:\Windows\system32\dnsapi.dll => File is digitally signed
      C:\Windows\SysWOW64\dnsapi.dll => File is digitally signed
      C:\Windows\system32\Drivers\volsnap.sys => File is digitally signed
      LastRegBack: 2018-10-26 08:40
      ==================== End of FRST.txt ============================
    • от Magnolia D
      От два - три дни интернет връзката ми се влоши драматично - почти невъзможно беше да се зареди каквато и да е страница (отнемаше минути, ако въобще успееше да го направи). Анти вирусната показа, че има Троянец(нещо си ) - може би е трябвало да запомня какво точно нещо си, но аз просто натиснах да го изтрие. Повторната проверка показа, че всичко е наред, но не мисля че е точно така. Сега зарежда малко по-бързо, но като цяло е изключително бавно и не мисля, че е от връзката. Предполагам, че се разбира, че знанието за компютрите не е една от най-силните ми страни, но за всеки случай ще го подчертая, за да се опитам да оправдая глупостите , които евентуално съм направила  и елементарния си "компютърен изказ". Относно стъпките за публикуване - нямам диск с операционната система, прикачвам другите два файла. П.С. Предварително благодаря за времето и съдействието!
      Scan result of Farbar Recovery Scan Tool (FRST) (x86) Version: 11.11.2018
      Ran by Grigorovi (administrator) on DIDI (13-11-2018 15:39:12)
      Running from D:\Instal
      Loaded Profiles: Grigorovi (Available Profiles: Grigorovi)
      Platform: Microsoft Windows 7 Ultimate  Service Pack 1 (X86) Language: Български (България)
      Internet Explorer Version 11 (Default browser: Chrome)
      Boot Mode: Normal
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      (SurfRight B.V.) C:\Program Files\HitmanPro.Alert\hmpalert.exe
      (Microsoft Corporation) C:\Program Files\Microsoft Security Client\Antimalware\MsMpEng.exe
      (SurfRight B.V.) C:\Program Files\HitmanPro\hmpsched.exe
      (SurfRight B.V.) C:\Program Files\HitmanPro.Alert\hmpalert.exe
      (Malwarebytes) C:\Program Files\Malwarebytes\Anti-Malware\MBAMService.exe
      (Microsoft Corporation) C:\Program Files\Microsoft Security Client\msseces.exe
      (Google Inc.) C:\Program Files\Google\Update\\GoogleCrashHandler.exe
      (Microsoft Corporation) C:\Program Files\Microsoft Security Client\Antimalware\NisSrv.exe
      (Malwarebytes) C:\Program Files\Malwarebytes\Anti-Malware\mbamtray.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Microsoft Corporation) C:\Windows\System32\dllhost.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [CL-22-D39888C9-D725-485F-B4A2-1AD9369147B7] => "C:\Program Files\Common Files\Bitdefender\SetupInformation\CL-22-4DEB32A9-F15E-4B9A-A7FB-125105229440\setuplauncher.exe" /run:"C:\Program Files\Common Files\Bitdefender\SetupInformation\CL-22-4DEB32A (the data entry has 44 more characters).
      HKLM\...\Run: [MSC] => C:\Program Files\Microsoft Security Client\msseces.exe [997920 2011-06-15] (Microsoft Corporation)
      HKU\S-1-5-21-2744073735-3007959217-1321240149-1000\Control Panel\Desktop\\SCRNSAVE.EXE -> 
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      Hosts: There are more than one entry in Hosts. See Hosts section of Addition.txt
      Tcpip\Parameters: [DhcpNameServer]
      Tcpip\..\Interfaces\{3247EA78-9C23-40D4-AF6B-21088034F9BF}: [DhcpNameServer]
      Tcpip\..\Interfaces\{AE99D80D-ED5E-4FA1-8934-689D4319410D}: [DhcpNameServer]
      Internet Explorer:
      HKLM\Software\Microsoft\Internet Explorer\Main,Start Page = about:blank
      HKLM\Software\Microsoft\Internet Explorer\Main,Default_Page_URL = 
      HKLM\Software\Microsoft\Internet Explorer\Main,Default_Search_URL = 
      FF DefaultProfile: ixj5pejf.default-1538731853205
      FF ProfilePath: C:\Users\Grigorovi\AppData\Roaming\Mozilla\Firefox\Profiles\ixj5pejf.default-1538731853205 [2018-11-12]
      FF Extension: (Firefox Monitor) - C:\Users\Grigorovi\AppData\Roaming\Mozilla\Firefox\Profiles\ixj5pejf.default-1538731853205\features\{a452a5ff-64b4-44fa-910c-c6debf5ffb1d}\fxmonitor@mozilla.org.xpi [2018-10-05]
      FF Extension: (Telemetry coverage) - C:\Users\Grigorovi\AppData\Roaming\Mozilla\Firefox\Profiles\ixj5pejf.default-1538731853205\features\{a452a5ff-64b4-44fa-910c-c6debf5ffb1d}\telemetry-coverage-bug1487578@mozilla.org.xpi [2018-10-05] [Legacy]
      FF Plugin: @adobe.com/FlashPlayer -> C:\Windows\system32\Macromed\Flash\NPSWF32_29_0_0_140.dll [2018-04-14] ()
      FF Plugin: @Microsoft.com/NpCtrl,version=1.0 -> C:\Program Files\Microsoft Silverlight\5.1.50907.0\npctrl.dll [2017-05-03] ( Microsoft Corporation)
      FF Plugin: @tools.google.com/Google Update;version=3 -> C:\Program Files\Google\Update\\npGoogleUpdate3.dll [2018-05-29] (Google Inc.)
      FF Plugin: @tools.google.com/Google Update;version=9 -> C:\Program Files\Google\Update\\npGoogleUpdate3.dll [2018-05-29] (Google Inc.)
      FF Plugin: @videolan.org/vlc,version=2.1.5 -> C:\Program Files\VideoLAN\VLC\npvlc.dll [2018-05-29] (VideoLAN)
      FF Plugin: @videolan.org/vlc,version=2.2.4 -> C:\Program Files\VideoLAN\VLC\npvlc.dll [2018-05-29] (VideoLAN)
      FF Plugin: @videolan.org/vlc,version= -> C:\Program Files\VideoLAN\VLC\npvlc.dll [2018-05-29] (VideoLAN)
      FF Plugin: @videolan.org/vlc,version=2.2.6 -> C:\Program Files\VideoLAN\VLC\npvlc.dll [2018-05-29] (VideoLAN)
      FF Plugin: @videolan.org/vlc,version=3.0.3 -> C:\Program Files\VideoLAN\VLC\npvlc.dll [2018-05-29] (VideoLAN)
      FF Plugin: Adobe Reader -> C:\Program Files\Adobe\Acrobat Reader DC\Reader\AIR\nppdf32.dll [2018-09-20] (Adobe Systems Inc.)
      FF Plugin HKU\S-1-5-21-2744073735-3007959217-1321240149-1000: @zoom.us/ZoomVideoPlugin -> C:\Users\Grigorovi\AppData\Roaming\Zoom\bin\npzoomplugin.dll [2018-08-10] (Zoom Video Communications, Inc.)
      CHR Profile: C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default [2018-11-13]
      CHR Extension: (Презентации) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\aapocclcgogkmnckokdopfmhonfmgoek [2017-10-13]
      CHR Extension: (Документи) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\aohghmighlieiainnegkcijnfilokake [2017-10-13]
      CHR Extension: (Google Диск) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\apdfllckaahabafndbhieahigkjlhalf [2018-10-17]
      CHR Extension: (YouTube) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\blpcfgokakmgnkcojhhkbfbldkacnbeo [2016-08-26]
      CHR Extension: (Adblock Plus) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\cfhdojbkjhnklbpkdaibdccddilifddb [2018-10-31]
      CHR Extension: (Adobe Acrobat) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\efaidnbmnnnibpcajpcglclefindmkaj [2017-03-04]
      CHR Extension: (Facebook Pixel Helper) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\fdgfkebogiimcoedlicjlajpkdmockpc [2018-10-23]
      CHR Extension: (Таблици) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\felcaaldnbdncclmgdcncolpebgiejap [2017-10-13]
      CHR Extension: (Google Документи офлайн) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\ghbmnnjooekpmoecnnnilnnbdlolhkhi [2018-08-22]
      CHR Extension: (Pinterest Save Button) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\gpdjojdkbbmdfjfahjcgigfpmkopogic [2018-10-19]
      CHR Extension: (Grammar.com) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\hamhaljjdpcgkelbadepgmnocknejief [2018-10-02]
      CHR Extension: (Keywords Everywhere - Keyword Tool) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\hbapdpeemoojbophdfndmlgdhppljgmp [2018-09-19]
      CHR Extension: (Reasy) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\hhfiiflbfkgfmeinikcgikgiijegkhgf [2017-12-09]
      CHR Extension: (Grammar and Spelling checker by Ginger) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\kdfieneakcjfaiglcfcgkidlkmlijjnh [2018-11-07]
      CHR Extension: (Tag Assistant (by Google)) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\kejbdjndbnbjgmefkgdddjlbokphdefk [2018-09-27]
      CHR Extension: (Ghostery – Privacy Ad Blocker) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\mlomiejdfkolichcflejclcbmpeaniij [2018-10-09]
      CHR Extension: (Awesome Screenshot: Screen Video Recorder) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\nlipoenfbbikpbjkfpfillcgkoblgpmj [2018-07-23]
      CHR Extension: (Плащания в уеб магазина на Chrome) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\nmmhkkegccagdldgiimedpiccmgmieda [2018-04-05]
      CHR Extension: (Gmail) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\pjkljhegncpnkpknbcohdijeoejaedia [2016-08-26]
      CHR Extension: (Chrome Media Router) - C:\Users\Grigorovi\AppData\Local\Google\Chrome\User Data\Default\Extensions\pkedcjkdefgpdelpbcmbmeomcjbeemfm [2018-10-19]
      CHR HKLM\...\Chrome\Extension: [efaidnbmnnnibpcajpcglclefindmkaj] - hxxps://clients2.google.com/service/update2/crx
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      S4 AgereModemAudio; C:\Program Files\LSI SoftModem\agrsmsvc.exe [26112 2009-12-03] (LSI Corporation)
      R2 HitmanProScheduler; C:\Program Files\HitmanPro\hmpsched.exe [114648 2018-11-12] (SurfRight B.V.)
      R2 hmpalertsvc; C:\Program Files\HitmanPro.Alert\hmpalert.exe [4406408 2018-11-12] (SurfRight B.V.)
      R2 MBAMService; C:\Program Files\Malwarebytes\Anti-Malware\mbamservice.exe [5073376 2018-09-19] (Malwarebytes)
      R2 MsMpSvc; C:\Program Files\Microsoft Security Client\Antimalware\MsMpEng.exe [11736 2011-04-27] (Microsoft Corporation)
      R3 NisSrv; C:\Program Files\Microsoft Security Client\Antimalware\NisSrv.exe [208944 2011-04-27] (Microsoft Corporation)
      S3 WinDefend; C:\Program Files\Windows Defender\mpsvc.dll [680960 2013-05-27] (Microsoft Corporation)
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      S3 dg_ssudbus; C:\Windows\System32\DRIVERS\ssudbus.sys [109456 2017-05-18] (Samsung Electronics Co., Ltd.)
      R1 hmpalert; C:\Windows\system32\drivers\hmpalert.sys [263288 2018-11-12] (SurfRight B.V.)
      R3 MBAMSwissArmy; C:\Windows\System32\Drivers\mbamswissarmy.sys [229568 2018-11-13] (Malwarebytes)
      R1 MpFilter; C:\Windows\System32\DRIVERS\MpFilter.sys [165648 2011-04-18] (Microsoft Corporation)
      R1 MpKsl5e3716e3; C:\ProgramData\Microsoft\Microsoft Antimalware\Definition Updates\{4EE32FF0-58AB-4EF4-90BC-B7873B344D95}\MpKsl5e3716e3.sys [49504 2018-11-13] (Microsoft Corporation)
      R3 MpNWMon; C:\Windows\System32\DRIVERS\MpNWMon.sys [43392 2011-04-18] (Microsoft Corporation)
      S3 VGPU; System32\drivers\rdvgkmd.sys [X]
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2099-10-22 18:57 - 30826-10-22 18:57 - 000186368 ____N (Microsoft Corporation) C:\Windows\foJiYOYp.exe
      2099-10-22 18:57 - 30826-10-22 18:57 - 000073216 ____N (Microsoft Corporation) C:\Windows\system32\rNZYYO.exe
      2099-10-22 18:57 - 30826-10-22 18:57 - 000073216 ____N (Microsoft Corporation) C:\Windows\system32\OmATowuMEtOu.exe
      2018-11-13 10:08 - 2018-11-13 10:08 - 000229568 _____ (Malwarebytes) C:\Windows\system32\Drivers\mbamswissarmy.sys
      2018-11-12 18:25 - 2018-11-13 15:38 - 000000000 ____D C:\Windows\CryptoGuard
      2018-11-12 18:25 - 2018-11-13 10:06 - 000000000 ___DC C:\ProgramData\HitmanPro.Alert
      2018-11-12 18:25 - 2018-11-12 18:25 - 000875656 _____ (SurfRight B.V.) C:\Windows\system32\hmpalert.dll
      2018-11-12 18:25 - 2018-11-12 18:25 - 000263288 _____ (SurfRight B.V.) C:\Windows\system32\Drivers\hmpalert.sys
      2018-11-12 18:25 - 2018-11-12 18:25 - 000000000 ___DC C:\ProgramData\Microsoft\Windows\Start Menu\Programs\HitmanPro.Alert
      2018-11-12 18:25 - 2018-11-12 18:25 - 000000000 ___DC C:\Program Files\HitmanPro.Alert
      2018-11-12 18:14 - 2018-11-12 18:14 - 000001847 _____ C:\Users\Public\Desktop\HitmanPro.lnk
      2018-11-12 18:14 - 2018-11-12 18:14 - 000000000 ___DC C:\ProgramData\Microsoft\Windows\Start Menu\Programs\HitmanPro
      2018-11-12 18:13 - 2018-11-12 18:14 - 000000000 ___DC C:\Program Files\HitmanPro
      2018-11-07 09:29 - 2018-11-07 09:29 - 001292716 _____ C:\Users\Grigorovi\Desktop\ros.zip
      2018-11-07 02:23 - 2018-11-05 16:55 - 009162423 _____ C:\Users\Grigorovi\Desktop\139_da_badesh_bog2.zip
      2018-11-07 02:14 - 2018-11-07 02:14 - 001062670 _____ C:\Users\Grigorovi\Desktop\Ерик Бърн -Психология на човешките взаимоотношения.pdf
      2018-11-07 02:13 - 2018-11-07 02:13 - 000798148 _____ C:\Users\Grigorovi\Desktop\Игрите, които хората играят.pdf
      2018-11-01 17:09 - 2018-11-04 22:36 - 000000000 ____D C:\Users\Grigorovi\Desktop\WP-UnEducatedMermad
      2018-10-29 18:44 - 2018-10-29 18:44 - 001092248 _____ C:\Users\Grigorovi\Desktop\Quick-Start-Affiliate-Marketing-Report.pdf
      2018-10-26 22:52 - 2018-10-26 22:52 - 002583150 _____ C:\Users\Grigorovi\Desktop\lipton_spontanna.zip
      2018-10-26 22:51 - 2018-10-26 22:51 - 001290479 _____ C:\Users\Grigorovi\Desktop\24_lipton_honemoon.zip
      2018-10-20 16:07 - 2018-10-20 16:07 - 002677746 _____ C:\Users\Grigorovi\Desktop\unblock_your_abundance_by_christiemarie_sheldon_workbook_nsp2.pdf
      2018-10-17 01:23 - 2018-10-17 01:24 - 000507221 _____ C:\Users\Grigorovi\Desktop\shum_v_ushite.zip
      2018-10-16 18:55 - 2018-10-16 18:55 - 006273583 _____ C:\Users\Grigorovi\Desktop\Шакти Гуаейн-Пътят към истинското блоагоденствие.rar
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-11-13 15:39 - 2018-04-07 19:16 - 000000000 ___DC C:\FRST
      2018-11-13 10:15 - 2009-07-14 06:34 - 000026352 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-1.C7483456-A289-439d-8115-601632D005A0
      2018-11-13 10:15 - 2009-07-14 06:34 - 000026352 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-0.C7483456-A289-439d-8115-601632D005A0
      2018-11-13 10:10 - 2018-04-10 19:56 - 000000386 _____ C:\Windows\Tasks\FreeFileViewerUpdateChecker.job
      2018-11-13 10:06 - 2018-04-07 21:35 - 000065536 _____ C:\Windows\system32\Ikeext.etl
      2018-11-13 10:06 - 2009-07-14 06:53 - 000000006 ____H C:\Windows\Tasks\SA.DAT
      2018-11-13 05:49 - 2017-04-26 17:00 - 000000000 ___DC C:\ProgramData\HitmanPro
      2018-11-12 19:59 - 2009-07-14 04:37 - 000000000 ____D C:\Windows\inf
      2018-11-12 18:48 - 2014-10-15 19:19 - 000000000 ____D C:\Windows\Minidump
      2018-11-12 18:34 - 2016-12-02 16:12 - 000000702 _____ C:\Users\Public\Desktop\System Ninja.lnk
      2018-11-12 18:34 - 2016-12-02 16:12 - 000000000 ___DC C:\ProgramData\Microsoft\Windows\Start Menu\Programs\System Ninja
      2018-11-09 18:05 - 2018-07-24 14:22 - 000000000 ___DC C:\Users\Grigorovi\AppData\Local\gtk-2.0
      2018-10-30 09:45 - 2016-10-28 18:07 - 000660594 _____ C:\Windows\system32\perfh01D.dat
      2018-10-30 09:45 - 2016-10-28 18:07 - 000144252 _____ C:\Windows\system32\perfc01D.dat
      2018-10-30 09:45 - 2016-10-28 17:31 - 000425298 _____ C:\Windows\system32\perfh012.dat
      2018-10-30 09:45 - 2016-10-28 17:31 - 000122162 _____ C:\Windows\system32\perfc012.dat
      2018-10-30 09:45 - 2016-10-28 16:02 - 000378044 _____ C:\Windows\system32\prfh0804.dat
      2018-10-30 09:45 - 2016-10-28 16:02 - 000121370 _____ C:\Windows\system32\prfc0804.dat
      2018-10-30 09:45 - 2016-10-28 15:29 - 000413652 _____ C:\Windows\system32\perfh011.dat
      2018-10-30 09:45 - 2016-10-28 15:29 - 000123878 _____ C:\Windows\system32\perfc011.dat
      2018-10-30 09:45 - 2016-10-28 15:09 - 000680628 _____ C:\Windows\system32\perfh00E.dat
      2018-10-30 09:45 - 2016-10-28 15:09 - 000173052 _____ C:\Windows\system32\perfc00E.dat
      2018-10-30 09:45 - 2016-10-28 14:49 - 000478376 _____ C:\Windows\system32\perfh00B.dat
      2018-10-30 09:45 - 2016-10-28 14:49 - 000103298 _____ C:\Windows\system32\perfc00B.dat
      2018-10-30 09:45 - 2016-10-28 14:25 - 000389218 _____ C:\Windows\system32\perfh00D.dat
      2018-10-30 09:45 - 2016-10-28 14:25 - 000086536 _____ C:\Windows\system32\perfc00D.dat
      2018-10-30 09:45 - 2016-10-28 13:57 - 000740372 _____ C:\Windows\system32\perfh013.dat
      2018-10-30 09:45 - 2016-10-28 13:57 - 000154880 _____ C:\Windows\system32\perfc013.dat
      2018-10-30 09:45 - 2016-10-28 13:42 - 000491388 _____ C:\Windows\system32\perfh014.dat
      2018-10-30 09:45 - 2016-10-28 13:42 - 000097182 _____ C:\Windows\system32\perfc014.dat
      2018-10-30 09:45 - 2016-10-28 13:17 - 000603862 _____ C:\Windows\system32\perfh008.dat
      2018-10-30 09:45 - 2016-10-28 13:17 - 000112906 _____ C:\Windows\system32\perfc008.dat
      2018-10-30 09:45 - 2016-10-28 12:51 - 000736920 _____ C:\Windows\system32\perfh010.dat
      2018-10-30 09:45 - 2016-10-28 12:51 - 000148624 _____ C:\Windows\system32\perfc010.dat
      2018-10-30 09:45 - 2016-10-28 12:37 - 000665714 _____ C:\Windows\system32\perfh005.dat
      2018-10-30 09:45 - 2016-10-28 12:37 - 000143204 _____ C:\Windows\system32\perfc005.dat
      2018-10-30 09:45 - 2016-10-28 12:18 - 000475888 _____ C:\Windows\system32\perfh001.dat
      2018-10-30 09:45 - 2016-10-28 12:18 - 000096550 _____ C:\Windows\system32\perfc001.dat
      2018-10-30 09:45 - 2016-10-28 12:05 - 000742590 _____ C:\Windows\system32\perfh00C.dat
      2018-10-30 09:45 - 2016-10-28 12:05 - 000151358 _____ C:\Windows\system32\perfc00C.dat
      2018-10-30 09:45 - 2016-10-28 11:52 - 000725892 _____ C:\Windows\system32\prfh0816.dat
      2018-10-30 09:45 - 2016-10-28 11:52 - 000154684 _____ C:\Windows\system32\prfc0816.dat
      2018-10-30 09:45 - 2016-10-28 11:36 - 000506288 _____ C:\Windows\system32\perfh006.dat
      2018-10-30 09:45 - 2016-10-28 11:36 - 000100436 _____ C:\Windows\system32\perfc006.dat
      2018-10-30 09:45 - 2016-10-28 11:24 - 000742330 _____ C:\Windows\system32\perfh00A.dat
      2018-10-30 09:45 - 2016-10-28 11:24 - 000160252 _____ C:\Windows\system32\perfc00A.dat
      2018-10-30 09:45 - 2016-10-28 11:11 - 000395216 _____ C:\Windows\system32\prfh0404.dat
      2018-10-30 09:45 - 2016-10-28 11:11 - 000116868 _____ C:\Windows\system32\prfc0404.dat
      2018-10-30 09:45 - 2016-10-28 10:59 - 000737232 _____ C:\Windows\system32\perfh015.dat
      2018-10-30 09:45 - 2016-10-28 10:59 - 000157650 _____ C:\Windows\system32\perfc015.dat
      2018-10-30 09:45 - 2016-10-28 10:44 - 000721474 _____ C:\Windows\system32\perfh019.dat
      2018-10-30 09:45 - 2016-10-28 10:44 - 000152620 _____ C:\Windows\system32\perfc019.dat
      2018-10-30 09:45 - 2016-10-28 10:25 - 000710754 _____ C:\Windows\system32\prfh0416.dat
      2018-10-30 09:45 - 2016-10-28 10:25 - 000149434 _____ C:\Windows\system32\prfc0416.dat
      2018-10-30 09:45 - 2016-10-28 09:57 - 000694082 _____ C:\Windows\system32\perfh007.dat
      2018-10-30 09:45 - 2016-10-28 09:57 - 000150894 _____ C:\Windows\system32\perfc007.dat
      2018-10-30 09:45 - 2016-10-28 09:41 - 000653556 _____ C:\Windows\system32\perfh01F.dat
      2018-10-30 09:45 - 2016-10-28 09:41 - 000141778 _____ C:\Windows\system32\perfc01F.dat
      2018-10-30 09:45 - 2016-10-28 09:41 - 000126256 _____ C:\Windows\system32\perfh002.dat
      2018-10-30 09:45 - 2016-10-28 09:41 - 000028684 _____ C:\Windows\system32\perfc002.dat
      2018-10-30 09:45 - 2010-11-20 23:01 - 017739850 _____ C:\Windows\system32\PerfStringBackup.INI
      2018-10-26 11:12 - 2018-10-05 13:08 - 000129248 _____ (Malwarebytes) C:\Windows\system32\Drivers\mbae.sys
      2018-10-25 10:37 - 2018-04-10 18:45 - 000002093 _____ C:\Users\Public\Desktop\Google Chrome.lnk
      2018-10-25 10:37 - 2016-08-26 11:58 - 000002134 ____C C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Google Chrome.lnk
      2018-10-24 12:51 - 2018-04-15 10:33 - 000000000 ___DC C:\Users\Grigorovi\AppData\Local\ElevatedDiagnostics
      2018-10-23 08:50 - 2016-08-24 15:28 - 000002441 ____C C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Acrobat Reader DC.lnk
      2018-10-15 23:48 - 2014-10-15 19:37 - 000479504 ____N (Microsoft Corporation) C:\Windows\system32\MpSigStub.exe
      ==================== Files in the root of some directories =======
      2017-11-23 15:47 - 2017-11-23 15:47 - 001276776 _____ () C:\Users\Grigorovi\AppData\Roaming\screenshot11Thursday1547301350000.png
      2018-05-17 11:44 - 2018-05-17 11:44 - 001302316 _____ () C:\Users\Grigorovi\AppData\Roaming\screenshot5Thursday1244426890000.png
      2018-05-17 11:44 - 2018-05-17 11:44 - 001299942 _____ () C:\Users\Grigorovi\AppData\Roaming\screenshot5Thursday1244446010000.png
      2016-09-01 09:53 - 2016-09-01 09:53 - 000000000 ____C () C:\Users\Grigorovi\AppData\Local\AtStart.txt
      2016-09-01 09:53 - 2016-09-01 09:53 - 000000000 ____C () C:\Users\Grigorovi\AppData\Local\DSwitch.txt
      2016-09-01 09:53 - 2016-09-01 09:53 - 000000000 ____C () C:\Users\Grigorovi\AppData\Local\QSwitch.txt
      2018-07-31 22:52 - 2018-07-31 22:52 - 000003292 ____C () C:\Users\Grigorovi\AppData\Local\recently-used.xbel
      2017-08-26 20:16 - 2017-08-26 20:16 - 000007597 ____C () C:\Users\Grigorovi\AppData\Local\Resmon.ResmonCfg
      2018-04-07 13:19 - 2018-04-07 13:19 - 000000003 ____C () C:\Users\Grigorovi\AppData\Local\wbem.ini
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\Windows\explorer.exe => File is digitally signed
      C:\Windows\system32\winlogon.exe => File is digitally signed
      C:\Windows\system32\wininit.exe => File is digitally signed
      C:\Windows\system32\svchost.exe => File is digitally signed
      C:\Windows\system32\services.exe => File is digitally signed
      C:\Windows\system32\User32.dll => File is digitally signed
      C:\Windows\system32\userinit.exe => File is digitally signed
      C:\Windows\system32\rpcss.dll => File is digitally signed
      C:\Windows\system32\dnsapi.dll => File is digitally signed
      C:\Windows\system32\Drivers\volsnap.sys => File is digitally signed
      LastRegBack: 2018-11-04 00:42
      ==================== End of FRST.txt ============================
    • от D101149
      Здравейте! Съмнявам се, че система ми е заразена ако може да ми помогнете ще съм ви благодарен (за пореден път)  Първите 3-4 минути изобщо хрома не зарежда страниците..
    • от mordikai
      Scan result of Farbar Recovery Scan Tool (FRST) (x64) Version: 28.09.2018
      Ran by Dellssd (administrator) on DELLSSD-PC (29-09-2018 16:54:29)
      Running from C:\Users\Dellssd\Downloads
      Loaded Profiles: Dellssd (Available Profiles: Dellssd)
      Platform: Windows 7 Professional Service Pack 1 (X64) Language: English (United States)
      Internet Explorer Version 11 (Default browser: IE)
      Boot Mode: Normal
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      (AVAST Software) C:\Program Files\AVAST Software\Avast\AvastSvc.exe
      (Apple Inc.) C:\Program Files\Common Files\Apple\Mobile Device Support\AppleMobileDeviceService.exe
      (Apple Inc.) C:\Program Files\Bonjour\mDNSResponder.exe
      (Microsoft) C:\Program Files\Softland\novaPDF 8\Server\novapdfs.exe
      (TeamViewer GmbH) C:\Program Files (x86)\TeamViewer\TeamViewer_Service.exe
      () C:\Program Files (x86)\Lavasoft\Web Companion\Application\Lavasoft.WCAssistant.WinService.exe
      (Intel Corporation) C:\Windows\System32\igfxtray.exe
      (Intel Corporation) C:\Windows\System32\hkcmd.exe
      (Intel Corporation) C:\Windows\System32\igfxpers.exe
      (McAfee, Inc.) C:\Program Files\McAfee Security Scan\3.11.805\SSScheduler.exe
      (AVAST Software) C:\Program Files\AVAST Software\Avast\AvastUI.exe
      (Wondershare) C:\Program Files (x86)\Common Files\Wondershare\Wondershare Helper Compact\WSHelper.exe
      (AVAST Software) C:\Program Files\AVAST Software\Avast\x64\aswidsagenta.exe
      (AVAST Software) C:\Program Files (x86)\AVAST Software\Browser\Update\\AvastBrowserCrashHandler.exe
      (AVAST Software) C:\Program Files (x86)\AVAST Software\Browser\Update\\AvastBrowserCrashHandler64.exe
      (Microsoft Corporation) C:\Program Files (x86)\Microsoft Office\Office14\WINWORD.EXE
      (Microsoft Corporation) C:\Program Files\Common Files\Microsoft Shared\OfficeSoftwareProtectionPlatform\OSPPSVC.EXE
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Microsoft Corporation) C:\Windows\splwow64.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Skillbrains) C:\Program Files (x86)\Skillbrains\lightshot\\Lightshot.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (BitTorrent Inc.) C:\Users\Dellssd\AppData\Roaming\uTorrent\uTorrent.exe
      (BitTorrent Inc.) C:\Users\Dellssd\AppData\Roaming\uTorrent\updates\3.4.6_42178\utorrentie.exe
      (BitTorrent Inc.) C:\Users\Dellssd\AppData\Roaming\uTorrent\updates\3.4.6_42178\utorrentie.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Microsoft Corporation) C:\Windows\System32\dllhost.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [AvastUI.exe] => C:\Program Files\AVAST Software\Avast\AvLaunch.exe [242392 2018-08-30] (AVAST Software)
      HKLM-x32\...\Run: [Lightshot] => C:\Program Files (x86)\Skillbrains\lightshot\Lightshot.exe [225944 2016-07-11] ()
      HKLM-x32\...\Run: [Wondershare Helper Compact.exe] => C:\Program Files (x86)\Common Files\Wondershare\Wondershare Helper Compact\WSHelper.exe [2137744 2016-10-08] (Wondershare)
      HKLM-x32\...\Run: [BCSSync] => C:\Program Files (x86)\Microsoft Office\Office14\BCSSync.exe [89184 2012-11-05] (Microsoft Corporation)
      Winlogon\Notify\igfxcui: C:\Windows\SYSTEM32\igfxdev.dll (Intel Corporation)
      HKLM\SOFTWARE\Policies\Microsoft\Windows Defender: Restriction <==== ATTENTION
      HKU\S-1-5-21-477188782-2465529923-3270759937-1000\...\RunOnce: [FlashPlayerUpdate] => C:\Windows\SysWOW64\Macromed\Flash\FlashUtil32_30_0_0_134_pepper.exe [1447936 2018-07-13] (Adobe Systems Incorporated)
      HKU\S-1-5-21-477188782-2465529923-3270759937-1000\...\MountPoints2: {6e61377d-2802-11e7-81ae-1c659d02e554} - G:\AutoRun.exe
      HKU\S-1-5-21-477188782-2465529923-3270759937-1000\...\MountPoints2: {76ec0a4f-0d2e-11e6-8287-1c659d02e554} - F:\SETUP.EXE
      HKU\S-1-5-21-477188782-2465529923-3270759937-1000\Control Panel\Desktop\\SCRNSAVE.EXE -> C:\Windows\system32\scrnsave.scr [11264 2009-07-14] (Microsoft Corporation)
      HKU\S-1-5-18\...\RunOnce: [SPReview] => "C:\Windows\System32\SPReview\SPReview.exe" /sp:1 /errorfwlink:"hxxp://go.microsoft.com/fwlink/?LinkID=122915" /build:7601
      Lsa: [Notification Packages] scecli C:\Program Files\TrueKey\McAfeeTrueKeyPasswordFilter
      Startup: C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Startup\McAfee Security Scan Plus.lnk [2018-09-26]
      ShortcutTarget: McAfee Security Scan Plus.lnk -> C:\Program Files\McAfee Security Scan\3.11.805\SSScheduler.exe (McAfee, Inc.)
      GroupPolicy: Restriction ? <==== ATTENTION
      GroupPolicy\User: Restriction ? <==== ATTENTION
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      ProxyEnable: [S-1-5-21-477188782-2465529923-3270759937-1000] => Proxy is enabled.
      Hosts: There are more than one entry in Hosts. See Hosts section of Addition.txt
      Tcpip\Parameters: [DhcpNameServer]
      Tcpip\..\Interfaces\{645E12D2-5740-463F-B063-09C024155032}: [DhcpNameServer]
      Tcpip\..\Interfaces\{B0D854A2-9D35-438A-98DE-EE2EB8CFFC94}: [DhcpNameServer]
      Internet Explorer:
      HKLM\Software\Wow6432Node\Microsoft\Internet Explorer\Main,Search Page = hxxps://search.avast.com/AV772/search/web?q={searchTerms}
      HKLM\Software\Wow6432Node\Microsoft\Internet Explorer\Main,Default_Search_URL = 
      HKU\S-1-5-21-477188782-2465529923-3270759937-1000\Software\Microsoft\Internet Explorer\Main,Search Page = hxxps://search.avast.com/AV772/search/web?q={searchTerms}
      SearchScopes: HKLM-x32 -> DefaultScope {8C31F27B-BE8A-4e4b-A478-17760AF1F5D9} URL = hxxps://search.avast.com/AV772/search/web?q={searchTerms}
      SearchScopes: HKLM-x32 -> {8C31F27B-BE8A-4e4b-A478-17760AF1F5D9} URL = hxxps://search.avast.com/AV772/search/web?q={searchTerms}
      SearchScopes: HKU\S-1-5-21-477188782-2465529923-3270759937-1000 -> 9845cd48-2779-11e7-bbbc-1c659d02e554 URL = hxxps://search.avast.com/AV772/search/web?q={searchTerms}
      SearchScopes: HKU\S-1-5-21-477188782-2465529923-3270759937-1000 -> {8C31F27B-BE8A-4e4b-A478-17760AF1F5D9} URL = hxxps://yandex.ru/search/?win=277&clid=2262092-3&text={searchTerms}
      SearchScopes: HKU\S-1-5-21-477188782-2465529923-3270759937-1000 -> {C0C3A6C6-03BC-4195-8FCB-AEA091301353} URL = hxxps://search.yahoo.com/yhs/search?hspart=lvs&hsimp=yhs-awc&type=lvs__webcompa__1_0__ya__ch_WCYID10041_spdf_opdfs_all_b_doc2pdf_170414__yaie&p={searchTerms}
      BHO: Groove GFS Browser Helper -> {72853161-30C5-4D22-B7F9-0BBC1D38A37E} -> C:\Program Files\Microsoft Office\Office14\GROOVEEX.DLL [2013-12-19] (Microsoft Corporation)
      BHO: Google Toolbar Helper -> {AA58ED58-01DD-4d91-8333-CF10577473F7} -> C:\Program Files (x86)\Google\Google Toolbar\GoogleToolbar_64.dll [2018-03-10] (Google Inc.)
      BHO: Office Document Cache Handler -> {B4F3A835-0E21-4959-BA22-42B3008E02FF} -> C:\Program Files\Microsoft Office\Office14\URLREDIR.DLL [2013-03-06] (Microsoft Corporation)
      BHO-x32: Groove GFS Browser Helper -> {72853161-30C5-4D22-B7F9-0BBC1D38A37E} -> C:\Program Files (x86)\Microsoft Office\Office14\GROOVEEX.DLL [2013-12-19] (Microsoft Corporation)
      BHO-x32: Google Toolbar Helper -> {AA58ED58-01DD-4d91-8333-CF10577473F7} -> C:\Program Files (x86)\Google\Google Toolbar\GoogleToolbar_32.dll [2018-03-10] (Google Inc.)
      BHO-x32: Office Document Cache Handler -> {B4F3A835-0E21-4959-BA22-42B3008E02FF} -> C:\Program Files (x86)\Microsoft Office\Office14\URLREDIR.DLL [2013-03-06] (Microsoft Corporation)
      Toolbar: HKLM - Google Toolbar - {2318C2B1-4965-11d4-9B18-009027A5CD4F} - C:\Program Files (x86)\Google\Google Toolbar\GoogleToolbar_64.dll [2018-03-10] (Google Inc.)
      Toolbar: HKLM-x32 - Google Toolbar - {2318C2B1-4965-11d4-9B18-009027A5CD4F} - C:\Program Files (x86)\Google\Google Toolbar\GoogleToolbar_32.dll [2018-03-10] (Google Inc.)
      Handler: skype4com - {FFC8B962-9B40-4DFF-9458-1830C7DD7F5D} - C:\Program Files (x86)\Google\Google Desktop Search\Plugins\gdSkype\skype4com.dll No File
      StartMenuInternet: IEXPLORE.EXE - iexplore.exe
      FF DefaultProfile: yk7fki5l.default
      FF ProfilePath: C:\Users\Dellssd\AppData\Roaming\Mozilla\Firefox\Profiles\yk7fki5l.default [2018-09-26]
      FF Homepage: Mozilla\Firefox\Profiles\yk7fki5l.default -> hxxps://search.avast.com/AV772/
      FF NewTab: Mozilla\Firefox\Profiles\yk7fki5l.default -> about:newtab
      FF Extension: (Домашняя страница Mail.Ru) - C:\Users\Dellssd\AppData\Roaming\Mozilla\Firefox\Profiles\yk7fki5l.default\Extensions\homepage@mail.ru.xpi [2018-08-10]
      FF Extension: (Поиск Mail.Ru) - C:\Users\Dellssd\AppData\Roaming\Mozilla\Firefox\Profiles\yk7fki5l.default\Extensions\search@mail.ru.xpi [2018-04-12]
      FF Extension: (Советник Яндекс.Маркета) - C:\Users\Dellssd\AppData\Roaming\Mozilla\Firefox\Profiles\yk7fki5l.default\Extensions\sovetnik@metabar.ru.xpi [2018-09-19]
      FF Extension: (Avast SafePrice) - C:\Users\Dellssd\AppData\Roaming\Mozilla\Firefox\Profiles\yk7fki5l.default\Extensions\sp@avast.com.xpi [2018-08-10]
      FF Extension: (Визуальные закладки) - C:\Users\Dellssd\AppData\Roaming\Mozilla\Firefox\Profiles\yk7fki5l.default\Extensions\vb@yandex.ru.xpi [2018-05-06]
      FF Extension: (Avast Online Security) - C:\Users\Dellssd\AppData\Roaming\Mozilla\Firefox\Profiles\yk7fki5l.default\Extensions\wrc@avast.com.xpi [2018-05-30]
      FF Extension: (Пульт) - C:\Users\Dellssd\AppData\Roaming\Mozilla\Firefox\Profiles\yk7fki5l.default\Extensions\{a38384b3-2d1d-4f36-bc22-0f7ae402bcd7}.xpi [2017-12-03]
      FF Extension: (Telemetry coverage) - C:\Users\Dellssd\AppData\Roaming\Mozilla\Firefox\Profiles\yk7fki5l.default\features\{02617030-72af-413d-a344-376f30098954}\telemetry-coverage-bug1487578@mozilla.org.xpi [2018-09-19] [Legacy]
      FF SearchPlugin: C:\Users\Dellssd\AppData\Roaming\Mozilla\Firefox\Profiles\yk7fki5l.default\searchplugins\avast-search.xml [2017-08-25]
      FF SearchPlugin: C:\Users\Dellssd\AppData\Roaming\Mozilla\Firefox\Profiles\yk7fki5l.default\searchplugins\yahoo-lavasoft.xml [2017-04-14]
      FF SearchPlugin: C:\Users\Dellssd\AppData\Roaming\Mozilla\Firefox\Profiles\yk7fki5l.default\searchplugins\Yahoo®-20173422.xml [2017-04-22]
      FF SearchPlugin: C:\Users\Dellssd\AppData\Roaming\Mozilla\Firefox\Profiles\yk7fki5l.default\searchplugins\yandex.ru-20173422.xml [2017-04-22]
      FF Plugin: @microsoft.com/GENUINE -> disabled [No File]
      FF Plugin: @microsoft.com/OfficeAuthz,version=14.0 -> C:\PROGRA~1\MICROS~2\Office14\NPAUTHZ.DLL [2010-01-09] (Microsoft Corporation)
      FF Plugin-x32: @microsoft.com/GENUINE -> disabled [No File]
      FF Plugin-x32: @microsoft.com/OfficeAuthz,version=14.0 -> C:\PROGRA~2\MICROS~2\Office14\NPAUTHZ.DLL [2010-01-09] (Microsoft Corporation)
      FF Plugin-x32: @microsoft.com/SharePoint,version=14.0 -> C:\PROGRA~2\MICROS~2\Office14\NPSPWRAP.DLL [2010-03-24] (Microsoft Corporation)
      FF Plugin-x32: @tools.google.com/Google Update;version=3 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [2018-05-17] (Google Inc.)
      FF Plugin-x32: @tools.google.com/Google Update;version=9 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [2018-05-17] (Google Inc.)
      FF Plugin-x32: @videolan.org/vlc,version=2.2.4 -> C:\Program Files (x86)\VideoLAN\VLC\npvlc.dll [2018-08-09] (VideoLAN)
      FF Plugin-x32: @videolan.org/vlc,version=2.2.6 -> C:\Program Files (x86)\VideoLAN\VLC\npvlc.dll [2018-08-09] (VideoLAN)
      FF Plugin-x32: @videolan.org/vlc,version=2.2.8 -> C:\Program Files (x86)\VideoLAN\VLC\npvlc.dll [2018-08-09] (VideoLAN)
      FF Plugin-x32: @videolan.org/vlc,version=3.0.4 -> C:\Program Files (x86)\VideoLAN\VLC\npvlc.dll [2018-08-09] (VideoLAN)
      FF Plugin-x32: Adobe Reader -> C:\Program Files (x86)\Adobe\Acrobat Reader DC\Reader\AIR\nppdf32.dll [2018-06-29] (Adobe Systems Inc.)
      FF Plugin-x32: Soda PDF Desktop -> C:\Program Files (x86)\Soda PDF Desktop\np-previewer.dll [2017-03-23] (LULU Software)
      FF Plugin HKU\S-1-5-21-477188782-2465529923-3270759937-1000: @zoom.us/ZoomVideoPlugin -> C:\Users\Dellssd\AppData\Roaming\Zoom\bin\npzoomplugin.dll [2017-01-25] (Zoom Video Communications, Inc.)
      CHR HomePage: Default -> yandex.ru
      CHR NewTab: Default ->  Active:"chrome-extension://fehhbdbmfjboomkmkflbaekjkhkklbnh/newtabproduct.html", Active:"chrome-extension://ceopoaldcnmhechacafgagdkklcogkgd/newtabproduct.html", Not-active:"chrome-extension://hcckjhfbahlnihggjcbadkgfjcghcibl/newtab/newtab.html", Not-active:"chrome-extension://mebpengldpmmlnaeehejppajiakgpbek/redirect.html", Not-active:"chrome-extension://mallpejgeafdahhflmliiahjdpgbegpk/stubby.html", Not-active:"chrome-extension://agibagflppafhfonkefpklndlohkclcb/index.html", Not-active:"chrome-extension://ghfmhofojkkfdnlfefhkckbflohgiicn/index.html"
      CHR DefaultSearchURL: Default -> hxxp://musix.searchalgo.com/search/?category=web&s=wmds&q={searchTerms}
      CHR DefaultSearchKeyword: Default -> WowMusix
      CHR DefaultSuggestURL: Default -> hxxp://sug.searchalgo.com/search/index_sg.php?q={searchTerms}
      CHR Profile: C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default [2018-09-29]
      CHR Extension: (Slides) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\aapocclcgogkmnckokdopfmhonfmgoek [2017-10-14]
      CHR Extension: (Docs) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\aohghmighlieiainnegkcijnfilokake [2017-10-13]
      CHR Extension: (Google Drive) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\apdfllckaahabafndbhieahigkjlhalf [2016-09-19]
      CHR Extension: (Skype Calling) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\blakpkgjpemejpbmfiglncklihnhjkij [2016-10-25]
      CHR Extension: (YouTube) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\blpcfgokakmgnkcojhhkbfbldkacnbeo [2016-09-19]
      CHR Extension: (OnlineMapFinder) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\ceopoaldcnmhechacafgagdkklcogkgd [2018-04-26]
      CHR Extension: (Tampermonkey) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\dhdgffkkebhmkfjojejmpbldmpobfkfo [2018-08-24]
      CHR Extension: (Стартовая — Яндекс) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\dkekdlkmdpipihonapoleopfekmapadh [2017-06-14]
      CHR Extension: (Adobe Acrobat) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\efaidnbmnnnibpcajpcglclefindmkaj [2017-04-14]
      CHR Extension: (Avast SafePrice | Comparison, deals, coupons) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\eofcbnmajmjmplflapaojjnihcjkigck [2018-09-20]
      CHR Extension: (MyImageConverter) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\fehhbdbmfjboomkmkflbaekjkhkklbnh [2018-08-23]
      CHR Extension: (Sheets) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\felcaaldnbdncclmgdcncolpebgiejap [2017-10-13]
      CHR Extension: (Search App - Music) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\flohajbbpjlbphjgeffnhlopdhoonghc [2017-09-13]
      CHR Extension: (Google Docs Offline) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\ghbmnnjooekpmoecnnnilnnbdlolhkhi [2018-08-21]
      CHR Extension: (Avast Online Security) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\gomekmidlodglbbmalcneegieacbdmki [2018-09-26]
      CHR Extension: (Яндекс) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\jkfblcbjfojmgagikhldeppgmgdpjkpl [2017-06-20]
      CHR Extension: (Ask Web Search) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\jmengapaekgmapkcophhdmppmjinpogo [2018-09-21]
      CHR Extension: (Ask Web Search) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\jpkmodlfcmmnhhlofndkhdcembjaefbb [2018-09-21]
      CHR Extension: (FromDocToPDF) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\mallpejgeafdahhflmliiahjdpgbegpk [2018-08-24]
      CHR Extension: (Chrome Web Store Payments) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\nmmhkkegccagdldgiimedpiccmgmieda [2018-04-04]
      CHR Extension: (Домашняя страница Mail.Ru) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\odijcgafkhpobjlnfdgiacpdenpmbgme [2016-10-19]
      CHR Extension: (Parity to Affinity) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\peagbbjfdfkkfcehfbddelhhppflbgla [2017-03-13]
      CHR Extension: (Mail.Ru) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\phkdcinmmljblpnkohlipaiodlonpinf [2016-10-19]
      CHR Extension: (SearchApp - Entertainment) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\phlbjnedeghkgaeghaiocogfofoicbpg [2018-01-16]
      CHR Extension: (Gmail) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\pjkljhegncpnkpknbcohdijeoejaedia [2016-09-19]
      CHR Extension: (Chrome Media Router) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\pkedcjkdefgpdelpbcmbmeomcjbeemfm [2018-09-19]
      CHR Extension: (Pulse) - C:\Users\Dellssd\AppData\Local\Google\Chrome\User Data\Default\Extensions\pmpoaahleccaibbhfjfimigepmfmmbbk [2018-06-06]
      CHR HKLM-x32\...\Chrome\Extension: [dkekdlkmdpipihonapoleopfekmapadh] - hxxp://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [efaidnbmnnnibpcajpcglclefindmkaj] - hxxps://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [eofcbnmajmjmplflapaojjnihcjkigck] - hxxps://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [gomekmidlodglbbmalcneegieacbdmki] - hxxps://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [jkfblcbjfojmgagikhldeppgmgdpjkpl] - hxxp://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [lifbcibllhkdhoafpjfnlhfpfgnpldfl] - hxxps://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [odijcgafkhpobjlnfdgiacpdenpmbgme] - hxxps://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [phkdcinmmljblpnkohlipaiodlonpinf] - hxxps://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [pmpoaahleccaibbhfjfimigepmfmmbbk] - hxxps://clients2.google.com/service/update2/crx
      OPR StartupUrls: "hxxps://www.yandex.ru/?win=277&clid=2262091-3"
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R2 Apple Mobile Device Service; C:\Program Files\Common Files\Apple\Mobile Device Support\AppleMobileDeviceService.exe [83768 2018-01-05] (Apple Inc.)
      R3 aswbIDSAgent; C:\Program Files\AVAST Software\Avast\x64\aswidsagenta.exe [7994520 2018-08-30] (AVAST Software)
      S2 avast; C:\Program Files (x86)\AVAST Software\Browser\Update\AvastBrowserUpdate.exe [164984 2018-03-23] (AVAST Software)
      R2 avast! Antivirus; C:\Program Files\AVAST Software\Avast\AvastSvc.exe [322464 2018-08-30] (AVAST Software)
      S3 avastm; C:\Program Files (x86)\AVAST Software\Browser\Update\AvastBrowserUpdate.exe [164984 2018-03-23] (AVAST Software)
      S3 DfSdkS; C:\Program Files (x86)\Ashampoo\Ashampoo Uninstaller 2017\DfSdkS64.exe [544768 2009-08-24] (mst software GmbH, Germany) [File not signed]
      S3 McComponentHostService; C:\Program Files\McAfee Security Scan\3.11.805\McCHSvc.exe [405392 2018-09-24] (McAfee, Inc.)
      R2 NovaPdfServer; C:\Program Files\Softland\novaPDF 8\Server\novapdfs.exe [51112 2017-02-22] (Microsoft)
      S2 Soda PDF Desktop Creator; C:\Program Files\Soda PDF Desktop\creator-ws.exe [755048 2017-03-23] (LULU Software)
      S3 SwitchBoard; C:\Program Files (x86)\Common Files\Adobe\SwitchBoard\SwitchBoard.exe [517096 2010-02-19] (Adobe Systems Incorporated) [File not signed]
      R2 TeamViewer; C:\Program Files (x86)\TeamViewer\TeamViewer_Service.exe [7500048 2016-09-20] (TeamViewer GmbH)
      R2 WCAssistantService; C:\Program Files (x86)\Lavasoft\Web Companion\Application\Lavasoft.WCAssistant.WinService.exe [25192 2017-04-14] ()
      S3 WinDefend; C:\Program Files\Windows Defender\mpsvc.dll [1011712 2013-05-27] (Microsoft Corporation)
      S3 wpscloudsvr; C:\Program Files (x86)\Kingsoft\Kingsoft Office\wpscloudsvr.exe [220288 2018-03-28] (Zhuhai Kingsoft Office Software Co.,Ltd)
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R1 aswArPot; C:\Windows\System32\drivers\aswArPot.sys [199712 2018-08-30] (AVAST Software)
      R1 aswbidsdriver; C:\Windows\System32\drivers\aswbidsdrivera.sys [229384 2018-08-30] (AVAST Software)
      R0 aswbidsh; C:\Windows\System32\drivers\aswbidsha.sys [201320 2018-08-30] (AVAST Software)
      R0 aswblog; C:\Windows\System32\drivers\aswbloga.sys [346664 2018-08-30] (AVAST Software)
      R0 aswbuniv; C:\Windows\System32\drivers\aswbuniva.sys [59568 2018-08-30] (AVAST Software)
      R1 aswHdsKe; C:\Windows\System32\drivers\aswHdsKe.sys [249016 2018-08-30] (AVAST Software)
      S3 aswHwid; C:\Windows\System32\drivers\aswHwid.sys [46968 2018-08-30] (AVAST Software)
      R2 aswMonFlt; C:\Windows\System32\drivers\aswMonFlt.sys [163392 2018-09-12] (AVAST Software)
      R1 aswRdr; C:\Windows\System32\drivers\aswRdr2.sys [111864 2018-08-30] (AVAST Software)
      R0 aswRvrt; C:\Windows\System32\drivers\aswRvrt.sys [87904 2018-08-30] (AVAST Software)
      R1 aswSnx; C:\Windows\System32\drivers\aswSnx.sys [1027720 2018-08-30] (AVAST Software)
      R1 aswSP; C:\Windows\System32\drivers\aswSP.sys [467320 2018-09-05] (AVAST Software)
      R2 aswStm; C:\Windows\System32\drivers\aswStm.sys [215920 2018-09-12] (AVAST Software)
      R0 aswVmm; C:\Windows\System32\drivers\aswVmm.sys [381560 2018-08-30] (AVAST Software)
      R3 ST_Accel; C:\Windows\System32\DRIVERS\ST_Accel.sys [103088 2015-02-26] (STMicroelectronics)
      R2 UI5IFS; C:\Program Files (x86)\Ashampoo\Ashampoo Uninstaller 2017\IFS64.sys [31320 2015-12-07] ()
      S3 BCM42RLY; system32\drivers\BCM42RLY.sys [X]
      S3 btwaudio; system32\drivers\btwaudio.sys [X]
      S3 btwavdt; system32\drivers\btwavdt.sys [X]
      S3 btwl2cap; system32\DRIVERS\btwl2cap.sys [X]
      S3 btwrchid; system32\DRIVERS\btwrchid.sys [X]
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-09-29 16:54 - 2018-09-29 16:54 - 000026700 _____ C:\Users\Dellssd\Downloads\FRST.txt
      2018-09-29 16:54 - 2018-09-29 16:54 - 000000000 ____D C:\FRST
      2018-09-29 16:53 - 2018-09-29 16:53 - 002414080 _____ (Farbar) C:\Users\Dellssd\Downloads\FRST64.exe
      2018-09-29 16:19 - 2018-09-29 16:19 - 004279416 _____ (ESET) C:\Users\Dellssd\Downloads\eset_internet_security_live_installer.exe
      2018-09-29 15:16 - 2018-09-29 15:16 - 000017773 _____ C:\Users\Dellssd\Downloads\American.Horror.Story.S08E03.720p.WEBRip.x264-TBS.torrent
      2018-09-29 11:31 - 2018-09-29 11:31 - 000001191 _____ C:\Users\Dellssd\AppData\Roaming\uni.txt
      2018-09-29 08:39 - 2018-09-29 08:39 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Lightshot
      2018-09-29 08:30 - 2018-09-29 08:30 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Skype
      2018-09-27 23:29 - 2018-09-27 23:29 - 005193216 _____ ( ) C:\Users\Dellssd\Downloads\wspsetup.exe
      2018-09-26 14:31 - 2018-09-26 14:31 - 000001964 _____ C:\Users\Public\Desktop\McAfee Security Scan Plus.lnk
      2018-09-26 14:31 - 2018-09-26 14:31 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\McAfee Security Scan Plus
      2018-09-26 14:31 - 2018-09-26 14:31 - 000000000 ____D C:\ProgramData\McAfee Security Scan
      2018-09-25 11:26 - 2018-09-28 11:38 - 000109568 ____H C:\Users\Dellssd\Desktop\~WRL1409.tmp
      2018-09-25 11:26 - 2018-09-27 10:53 - 000094208 ____H C:\Users\Dellssd\Desktop\~WRL1082.tmp
      2018-09-25 11:26 - 2018-09-26 13:19 - 000084480 ____H C:\Users\Dellssd\Desktop\~WRL1831.tmp
      2018-09-24 22:25 - 2018-09-24 22:25 - 000014480 _____ C:\Users\Dellssd\Downloads\Preacher.S03E10.HDTV.x264-KILLERS.mkv (2).torrent
      2018-09-24 09:39 - 2018-09-24 09:39 - 000014480 _____ C:\Users\Dellssd\Downloads\Preacher.S03E10.HDTV.x264-KILLERS.mkv (1).torrent
      2018-09-23 22:48 - 2018-09-23 22:48 - 000014480 _____ C:\Users\Dellssd\Downloads\Preacher.S03E10.HDTV.x264-KILLERS.mkv.torrent
      2018-09-23 22:46 - 2018-09-23 22:46 - 000011432 _____ C:\Users\Dellssd\Downloads\Preacher.S03E09.HDTV.x264-SVA (2).torrent
      2018-09-23 08:18 - 2018-09-23 08:18 - 000011432 _____ C:\Users\Dellssd\Downloads\Preacher.S03E09.HDTV.x264-SVA (1).torrent
      2018-09-22 20:53 - 2018-09-22 20:53 - 000011432 _____ C:\Users\Dellssd\Downloads\Preacher.S03E09.HDTV.x264-SVA.torrent
      2018-09-22 19:56 - 2018-09-22 19:56 - 000018281 _____ C:\Users\Dellssd\Downloads\Preacher.S03E08.720p.HEVC.x265-MeGusta.torrent
      2018-09-22 19:03 - 2018-09-22 19:03 - 000017384 _____ C:\Users\Dellssd\Downloads\Preacher.S03E07.720p.HEVC.x265-MeGusta.torrent
      2018-09-22 10:02 - 2018-09-22 10:02 - 000010528 _____ C:\Users\Dellssd\Downloads\American.Horror.Story.S08E01.HDTV.x264-SVA (1).torrent
      2018-09-21 18:54 - 2018-09-21 18:54 - 000010528 _____ C:\Users\Dellssd\Downloads\American.Horror.Story.S08E01.HDTV.x264-SVA.torrent
      2018-09-21 18:52 - 2018-09-21 18:52 - 000017830 _____ C:\Users\Dellssd\Downloads\American.Horror.Story.S08E02.WEBRip.x264-TBS.torrent
      2018-09-19 10:10 - 2018-09-19 10:10 - 000262144 _____ C:\Windows\Minidump\091918-9126-01.dmp
      2018-09-16 10:43 - 2018-09-16 10:43 - 000218836 _____ C:\Users\Dellssd\Desktop\a.psd
      2018-09-16 10:20 - 2018-09-16 10:21 - 000024235 _____ C:\Users\Dellssd\Desktop\a.jpf
      2018-09-08 16:34 - 2018-09-08 16:34 - 000152887 _____ C:\Users\Dellssd\Desktop\5.jpeg
      2018-09-06 20:51 - 2018-09-06 20:51 - 000015001 _____ C:\Users\Dellssd\Downloads\[kinozal.tv]id1604058.torrent
      2018-08-30 23:30 - 2018-08-30 23:29 - 000379608 _____ (AVAST Software) C:\Windows\system32\aswBoot.exe
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-09-29 16:53 - 2016-04-28 15:06 - 000000000 ____D C:\Users\Dellssd\AppData\Roaming\uTorrent
      2018-09-29 16:43 - 2017-05-15 14:15 - 000000378 _____ C:\Windows\Tasks\WpsNotifyTask_Dellssd.job
      2018-09-29 16:39 - 2018-02-11 22:39 - 000000994 _____ C:\Windows\Tasks\Chromium nefil.job
      2018-09-29 16:12 - 2016-10-21 06:34 - 000000000 ____D C:\Users\Dellssd\AppData\Roaming\vlc
      2018-09-29 15:16 - 2017-09-30 23:37 - 000000000 ____D C:\Users\Dellssd\AppData\LocalLow\uTorrent
      2018-09-29 13:22 - 2016-04-28 19:38 - 000000392 _____ C:\Windows\Tasks\update-sys.job
      2018-09-29 12:57 - 2016-04-28 19:38 - 000000392 _____ C:\Windows\Tasks\update-S-1-5-21-477188782-2465529923-3270759937-1000.job
      2018-09-29 08:39 - 2016-04-28 19:38 - 000003270 _____ C:\Windows\System32\Tasks\update-S-1-5-21-477188782-2465529923-3270759937-1000
      2018-09-29 08:38 - 2009-07-14 07:45 - 000014448 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-1.C7483456-A289-439d-8115-601632D005A0
      2018-09-29 08:38 - 2009-07-14 07:45 - 000014448 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-0.C7483456-A289-439d-8115-601632D005A0
      2018-09-29 08:30 - 2017-08-13 12:16 - 000001066 _____ C:\Users\Public\Desktop\VLC media player.lnk
      2018-09-29 08:30 - 2017-03-11 18:15 - 000001306 _____ C:\Users\Public\Desktop\Skype.lnk
      2018-09-29 08:30 - 2017-03-11 18:15 - 000000000 ___RD C:\Program Files (x86)\Skype
      2018-09-29 08:30 - 2016-04-28 15:22 - 000000000 ____D C:\ProgramData\Skype
      2018-09-29 08:28 - 2009-07-14 08:13 - 000781790 _____ C:\Windows\system32\PerfStringBackup.INI
      2018-09-29 08:28 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\inf
      2018-09-29 08:21 - 2016-04-28 15:19 - 000000204 _____ C:\Windows\Tasks\AutoKMS.job
      2018-09-29 08:21 - 2009-07-14 08:08 - 000000006 ____H C:\Windows\Tasks\SA.DAT
      2018-09-27 23:33 - 2018-03-23 00:37 - 000000000 ____D C:\Users\Dellssd\AppData\Local\AVAST Software
      2018-09-27 10:13 - 2016-12-02 22:36 - 000000000 ____D C:\Users\Dellssd\Desktop\преводи
      2018-09-26 14:31 - 2018-07-13 15:01 - 000000000 ____D C:\Program Files\McAfee Security Scan
      2018-09-24 09:29 - 2017-04-13 09:23 - 000000000 ____D C:\Program Files (x86)\Mozilla Firefox
      2018-09-24 09:29 - 2016-08-18 13:17 - 000000000 ____D C:\Program Files (x86)\Mozilla Maintenance Service
      2018-09-23 23:46 - 2016-12-01 16:09 - 000000000 ____D C:\Users\Dellssd\AppData\LocalLow\Mozilla
      2018-09-23 08:33 - 2017-07-27 09:56 - 000003180 _____ C:\Windows\System32\Tasks\OneDrive Standalone Update Task-S-1-5-21-477188782-2465529923-3270759937-1000
      2018-09-23 08:33 - 2017-05-14 12:21 - 000002164 _____ C:\Users\Dellssd\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Microsoft OneDrive.lnk
      2018-09-23 08:33 - 2017-05-14 12:21 - 000000000 ___RD C:\Users\Dellssd\OneDrive
      2018-09-22 17:35 - 2018-08-29 08:46 - 000501760 ____H C:\Users\Dellssd\Desktop\~WRL1243.tmp
      2018-09-21 18:56 - 2016-10-30 19:56 - 000000000 ____D C:\Users\Dellssd\Desktop\subtitri
      2018-09-21 14:57 - 2018-08-29 08:46 - 000493568 ____H C:\Users\Dellssd\Desktop\~WRL3209.tmp
      2018-09-20 12:11 - 2016-09-26 11:57 - 000119544 _____ C:\Windows\SysWOW64\GDIPFONTCACHEV1.DAT
      2018-09-20 10:36 - 2017-04-14 13:23 - 000004476 _____ C:\Windows\System32\Tasks\Adobe Acrobat Update Task
      2018-09-20 10:36 - 2017-04-14 13:23 - 000002441 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Acrobat Reader DC.lnk
      2018-09-19 23:21 - 2018-03-23 00:38 - 000002429 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Avast Secure Browser.lnk
      2018-09-19 10:10 - 2017-01-14 08:33 - 000000000 ____D C:\Windows\Minidump
      2018-09-18 23:46 - 2016-09-19 00:17 - 000002430 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Google Chrome.lnk
      2018-09-18 23:46 - 2016-09-19 00:17 - 000002389 _____ C:\Users\Public\Desktop\Google Chrome.lnk
      2018-09-18 12:47 - 2018-08-29 08:46 - 000419328 ____H C:\Users\Dellssd\Desktop\~WRL1414.tmp
      2018-09-17 12:36 - 2018-08-29 08:46 - 000396288 ____H C:\Users\Dellssd\Desktop\~WRL2232.tmp
      2018-09-17 09:55 - 2016-04-28 15:19 - 000000202 _____ C:\Windows\Tasks\AutoKMSDaily.job
      2018-09-16 22:22 - 2018-07-13 14:31 - 000004482 _____ C:\Windows\System32\Tasks\Adobe Flash Player PPAPI Notifier
      2018-09-16 22:22 - 2018-06-17 11:13 - 000003138 _____ C:\Windows\System32\Tasks\{810AB3C2-34D4-499B-B4BB-9D38D546FA12}
      2018-09-16 22:22 - 2018-05-05 14:25 - 000003944 _____ C:\Windows\System32\Tasks\WpsUpdateTask_Dellssd
      2018-09-16 22:22 - 2017-08-07 09:24 - 000004192 _____ C:\Windows\System32\Tasks\WpsExternal_Dellssd_20170807092444
      2018-09-16 22:22 - 2017-05-15 14:15 - 000004196 _____ C:\Windows\System32\Tasks\WpsKtpcntrQingTask_Dellssd
      2018-09-16 22:22 - 2017-05-15 14:15 - 000003362 _____ C:\Windows\System32\Tasks\WpsNotifyTask_Dellssd
      2018-09-16 22:22 - 2017-04-16 19:21 - 000004308 _____ C:\Windows\System32\Tasks\Opera scheduled suite Autoupdate 1492359678
      2018-09-16 22:22 - 2017-04-16 19:21 - 000004086 _____ C:\Windows\System32\Tasks\Opera scheduled Autoupdate 1492359677
      2018-09-16 22:22 - 2017-04-14 13:19 - 000003572 _____ C:\Windows\System32\Tasks\doPDF Update
      2018-09-16 22:22 - 2017-03-11 18:01 - 000003154 _____ C:\Windows\System32\Tasks\{F75FB1AB-3FC6-4CCB-8E59-EFFFE1750F20}
      2018-09-16 22:22 - 2017-03-11 17:59 - 000003154 _____ C:\Windows\System32\Tasks\{CEDD031E-67BD-4005-BC8D-F936A030F0BA}
      2018-09-16 22:22 - 2017-03-10 11:47 - 000003154 _____ C:\Windows\System32\Tasks\{54495718-5171-4E02-8AE9-0C0BA73E7D7F}
      2018-09-16 22:22 - 2017-03-10 11:46 - 000003154 _____ C:\Windows\System32\Tasks\{E1C2E6E7-851E-4C71-BE27-06A41080DD86}
      2018-09-16 22:22 - 2017-03-08 15:35 - 000003154 _____ C:\Windows\System32\Tasks\{380FC156-4700-48BE-8B5A-FBA1286DCE61}
      2018-09-16 22:22 - 2017-03-07 19:54 - 000003154 _____ C:\Windows\System32\Tasks\{B59123EA-C895-4329-A7B1-CB325A18760F}
      2018-09-16 22:22 - 2017-03-07 19:53 - 000003154 _____ C:\Windows\System32\Tasks\{1B3678E0-0EBD-4B19-8557-0E961136459F}
      2018-09-16 22:22 - 2017-03-07 19:23 - 000003152 _____ C:\Windows\System32\Tasks\{C3112054-5422-446C-8C6A-CBF71C0F1362}
      2018-09-16 22:22 - 2017-03-07 19:18 - 000003154 _____ C:\Windows\System32\Tasks\{2A7E9ED5-EA5D-44CE-A690-23D3D3057CA2}
      2018-09-16 22:22 - 2017-03-07 19:14 - 000003154 _____ C:\Windows\System32\Tasks\{E3C65BC8-A75A-427C-B27F-42C9BBE41C62}
      2018-09-16 22:22 - 2016-10-20 13:50 - 000003112 _____ C:\Windows\System32\Tasks\{35511907-B4BB-42B6-B5D5-1DEA4D518FE5}
      2018-09-16 22:22 - 2016-10-20 13:36 - 000003164 _____ C:\Windows\System32\Tasks\{CF456C35-60A1-4F96-848F-0062539D31D4}
      2018-09-16 22:22 - 2016-10-20 13:08 - 000003164 _____ C:\Windows\System32\Tasks\{286D155D-B077-4884-A3BD-71EBE307BEF5}
      2018-09-16 22:22 - 2016-10-20 13:07 - 000003164 _____ C:\Windows\System32\Tasks\{295B979B-F0EA-40DA-9832-C45D45FC859B}
      2018-09-16 22:22 - 2016-10-19 13:20 - 000003164 _____ C:\Windows\System32\Tasks\{B72E12E4-120A-46A7-B0FC-AED00851297F}
      2018-09-16 22:22 - 2016-10-19 12:55 - 000003164 _____ C:\Windows\System32\Tasks\{A7EABB03-E8E6-444E-9C70-01DEA803DBEC}
      2018-09-16 22:22 - 2016-10-19 12:53 - 000003164 _____ C:\Windows\System32\Tasks\{D6E5F4DF-91E3-4ECA-B09F-9DCF123E1030}
      2018-09-16 22:22 - 2016-09-19 00:16 - 000003432 _____ C:\Windows\System32\Tasks\GoogleUpdateTaskMachineUA
      2018-09-16 22:22 - 2016-09-19 00:16 - 000003304 _____ C:\Windows\System32\Tasks\GoogleUpdateTaskMachineCore
      2018-09-16 22:22 - 2016-04-28 19:38 - 000003400 _____ C:\Windows\System32\Tasks\update-sys
      2018-09-16 22:22 - 2016-04-28 15:19 - 000002740 _____ C:\Windows\System32\Tasks\AutoKMSDaily
      2018-09-16 22:22 - 2016-04-28 15:19 - 000002436 _____ C:\Windows\System32\Tasks\AutoKMS
      2018-09-16 22:22 - 2016-04-28 15:14 - 000003148 _____ C:\Windows\System32\Tasks\{5A5A1497-EAC4-4683-9946-09144759EE3B}
      2018-09-16 22:22 - 2016-04-28 13:36 - 000003254 _____ C:\Windows\System32\Tasks\{CD225CD4-3990-439E-8F36-78EB3BDEE4E1}
      2018-09-16 20:22 - 2018-08-29 08:46 - 000370688 ____H C:\Users\Dellssd\Desktop\~WRL3793.tmp
      2018-09-15 19:37 - 2018-08-29 08:46 - 000344576 ____H C:\Users\Dellssd\Desktop\~WRL1766.tmp
      2018-09-14 18:54 - 2018-08-29 08:46 - 000297984 ____H C:\Users\Dellssd\Desktop\~WRL2266.tmp
      2018-09-13 15:27 - 2018-08-29 08:46 - 000268288 ____H C:\Users\Dellssd\Desktop\~WRL2379.tmp
      2018-09-12 23:30 - 2016-04-28 15:24 - 000215920 _____ (AVAST Software) C:\Windows\system32\Drivers\aswStm.sys
      2018-09-12 12:59 - 2018-08-29 08:46 - 000251904 ____H C:\Users\Dellssd\Desktop\~WRL1812.tmp
      2018-09-12 12:19 - 2016-04-28 15:24 - 000163392 _____ (AVAST Software) C:\Windows\system32\Drivers\aswMonFlt.sys
      2018-09-09 09:00 - 2018-08-29 08:46 - 000212992 ____H C:\Users\Dellssd\Desktop\~WRL1160.tmp
      2018-09-08 11:36 - 2018-08-29 08:46 - 000209920 ____H C:\Users\Dellssd\Desktop\~WRL3129.tmp
      2018-09-07 13:25 - 2018-08-29 08:46 - 000199168 ____H C:\Users\Dellssd\Desktop\~WRL0459.tmp
      2018-09-05 11:53 - 2016-04-28 15:24 - 000467320 _____ (AVAST Software) C:\Windows\system32\Drivers\aswSP.sys
      2018-09-04 13:41 - 2018-08-29 08:46 - 000154624 ____H C:\Users\Dellssd\Desktop\~WRL0358.tmp
      2018-09-03 23:58 - 2017-03-11 17:50 - 000000000 _____ C:\Windows\SysWOW64\last.dump
      2018-09-03 10:30 - 2018-08-29 08:46 - 000122368 ____H C:\Users\Dellssd\Desktop\~WRL1632.tmp
      2018-09-01 12:16 - 2018-08-29 08:46 - 000114688 ____H C:\Users\Dellssd\Desktop\~WRL0845.tmp
      2018-08-31 12:46 - 2018-08-29 08:46 - 000098304 ____H C:\Users\Dellssd\Desktop\~WRL3568.tmp
      2018-08-30 23:30 - 2017-04-04 12:54 - 000003910 _____ C:\Windows\System32\Tasks\Avast Emergency Update
      2018-08-30 23:30 - 2016-04-28 15:24 - 000087904 _____ (AVAST Software) C:\Windows\system32\Drivers\aswRvrt.sys
      2018-08-30 23:29 - 2017-12-23 19:29 - 000249016 _____ (AVAST Software) C:\Windows\system32\Drivers\aswHdsKe.sys
      2018-08-30 23:29 - 2017-11-13 11:28 - 000199712 _____ (AVAST Software) C:\Windows\system32\Drivers\aswArPot.sys
      2018-08-30 23:29 - 2017-04-04 12:54 - 000346664 _____ (AVAST Software) C:\Windows\system32\Drivers\aswbloga.sys
      2018-08-30 23:29 - 2017-04-04 12:54 - 000229384 _____ (AVAST Software) C:\Windows\system32\Drivers\aswbidsdrivera.sys
      2018-08-30 23:29 - 2017-04-04 12:54 - 000201320 _____ (AVAST Software) C:\Windows\system32\Drivers\aswbidsha.sys
      2018-08-30 23:29 - 2017-04-04 12:54 - 000059568 _____ (AVAST Software) C:\Windows\system32\Drivers\aswbuniva.sys
      2018-08-30 23:29 - 2016-04-28 15:24 - 001027720 _____ (AVAST Software) C:\Windows\system32\Drivers\aswSnx.sys
      2018-08-30 23:29 - 2016-04-28 15:24 - 000381560 _____ (AVAST Software) C:\Windows\system32\Drivers\aswVmm.sys
      2018-08-30 23:29 - 2016-04-28 15:24 - 000111864 _____ (AVAST Software) C:\Windows\system32\Drivers\aswRdr2.sys
      2018-08-30 23:29 - 2016-04-28 15:24 - 000046968 _____ (AVAST Software) C:\Windows\system32\Drivers\aswHwid.sys
      2018-08-30 13:39 - 2018-08-29 08:46 - 000077824 ____H C:\Users\Dellssd\Desktop\~WRL3210.tmp
      ==================== Files in the root of some directories =======
      2015-10-21 18:11 - 2015-10-21 18:11 - 130502551 _____ () C:\Program Files\openoffice1.cab
      2015-10-21 18:10 - 2015-10-21 18:10 - 002310144 _____ () C:\Program Files\openoffice412.msi
      2015-10-21 18:10 - 2015-10-21 18:10 - 000478720 _____ () C:\Program Files\setup.exe
      2015-10-21 18:10 - 2015-10-21 18:10 - 000000279 _____ () C:\Program Files\setup.ini
      2016-12-08 14:00 - 2017-03-04 10:53 - 000000132 _____ () C:\Users\Dellssd\AppData\Roaming\Adobe AIFF Format CS6 Prefs
      2016-12-07 08:29 - 2016-12-07 08:29 - 000000146 _____ () C:\Users\Dellssd\AppData\Roaming\gamma_ramp.reg
      2018-09-29 11:31 - 2018-09-29 11:31 - 000001191 _____ () C:\Users\Dellssd\AppData\Roaming\uni.txt
      2017-04-08 21:19 - 2016-03-31 21:40 - 000145792 _____ () C:\Users\Dellssd\AppData\Local\downloader.exe
      2016-04-28 19:38 - 2016-04-28 19:38 - 000000003 ____H () C:\Users\Dellssd\AppData\Local\updater.log
      2016-04-28 19:38 - 2016-04-28 19:38 - 000000424 ____H () C:\Users\Dellssd\AppData\Local\UserProducts.xml
      2016-10-29 12:23 - 2016-10-29 12:23 - 000017408 _____ () C:\Users\Dellssd\AppData\Local\WebpageIcons.db
      2017-02-10 09:00 - 2017-02-10 09:00 - 000000000 _____ () C:\Users\Dellssd\AppData\Local\{DC54C818-2F39-4DF4-A54B-09F3D3BE3CC3}
      Some files in TEMP:
      2018-04-09 11:51 - 2018-08-20 12:55 - 062983128 _____ (Softland) C:\Users\Dellssd\AppData\Local\Temp\dopdf-full.exe
      2017-05-15 14:12 - 2017-05-15 14:12 - 003463288 _____ (Gadomotus                                                   ) C:\Users\Dellssd\AppData\Local\Temp\ICReinstall_microsoft_office (1).exe
      2016-10-29 19:52 - 2016-10-30 14:18 - 037642072 _____ (PandoraTV) C:\Users\Dellssd\AppData\Local\Temp\KMP_4.1.3.3.exe
      2017-12-16 10:25 - 2017-12-16 10:25 - 039544976 _____ (PandoraTV) C:\Users\Dellssd\AppData\Local\Temp\KMP_4.2.2.5.exe
      2016-12-06 13:30 - 2016-12-07 08:28 - 048947193 _____ () C:\Users\Dellssd\AppData\Local\Temp\new_version.exe
      2017-10-10 23:42 - 2017-10-10 23:42 - 002163712 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201710104236545.dll
      2017-10-12 10:00 - 2017-10-12 10:00 - 002163712 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017101208259.dll
      2017-10-13 10:42 - 2017-10-13 10:42 - 002163712 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201710134229437.dll
      2017-10-13 10:47 - 2017-10-13 10:47 - 002163712 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171013479979.dll
      2017-10-16 10:13 - 2017-10-16 10:13 - 002163712 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201710161342290.dll
      2017-10-19 23:59 - 2017-10-19 23:59 - 002163712 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201710195926616.dll
      2017-10-24 10:14 - 2017-10-24 10:14 - 002172416 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201710241457563.dll
      2017-10-24 10:09 - 2017-10-24 10:09 - 002163712 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171024911435.dll
      2017-10-02 08:58 - 2017-10-02 08:58 - 002163200 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171025819305.dll
      2017-10-28 08:06 - 2017-10-28 08:06 - 002172416 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171028622139.dll
      2017-10-04 09:31 - 2017-10-04 09:31 - 002163200 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171043113370.dll
      2017-10-05 09:53 - 2017-10-05 09:53 - 002163200 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017105532580.dll
      2017-10-06 09:16 - 2017-10-06 09:16 - 002163200 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171061623730.dll
      2017-10-06 23:52 - 2017-10-06 23:52 - 002163712 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171065224505.dll
      2017-10-07 09:54 - 2017-10-07 09:54 - 002163712 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171075447890.dll
      2017-10-09 10:23 - 2017-10-09 10:23 - 002163712 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171092328422.dll
      2017-11-10 11:43 - 2017-11-10 11:43 - 002172416 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201711104321386.dll
      2017-11-01 10:23 - 2017-11-01 10:23 - 002172416 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171112339856.dll
      2017-11-02 00:52 - 2017-11-02 00:52 - 002172416 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171115225368.dll
      2017-11-17 12:11 - 2017-11-17 12:11 - 002172416 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171117111267.dll
      2017-11-18 19:17 - 2017-11-18 19:17 - 002172416 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201711181734927.dll
      2017-11-21 00:46 - 2017-11-21 00:46 - 002230784 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017112046238.dll
      2017-11-23 00:46 - 2017-11-23 00:46 - 002230784 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201711224618694.dll
      2017-11-25 09:12 - 2017-11-25 09:12 - 002230784 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201711251244928.dll
      2017-11-27 10:16 - 2017-11-27 10:16 - 002230784 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201711271659784.dll
      2017-11-06 09:42 - 2017-11-06 09:42 - 002172416 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171164236192.dll
      2017-11-08 10:10 - 2017-11-08 10:10 - 002172416 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017118103184.dll
      2017-11-09 00:50 - 2017-11-09 00:50 - 002172416 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171185049290.dll
      2017-12-11 11:10 - 2017-12-11 11:10 - 002230784 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171211109386.dll
      2017-12-16 10:08 - 2017-12-16 10:08 - 002230784 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171216841406.dll
      2017-12-20 10:30 - 2017-12-20 10:30 - 002230784 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171220300768.dll
      2017-12-21 09:59 - 2017-12-21 09:59 - 002228736 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171221599557.dll
      2017-12-25 11:52 - 2017-12-25 11:52 - 002228736 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201712255220697.dll
      2017-12-27 10:46 - 2017-12-27 10:46 - 002228736 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201712274620418.dll
      2017-12-28 10:30 - 2017-12-28 10:30 - 002228736 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20171228304823.dll
      2017-12-30 09:54 - 2017-12-30 09:54 - 002228736 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201712305435151.dll
      2017-12-06 11:04 - 2017-12-06 11:04 - 002230784 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017126459962.dll
      2017-05-16 23:45 - 2017-05-16 23:45 - 001980416 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20175164533688.dll
      2017-05-19 08:44 - 2017-05-19 08:44 - 002008064 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20175194420141.dll
      2017-05-20 06:44 - 2017-05-20 06:44 - 002008064 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20175204459667.dll
      2017-05-24 09:17 - 2017-05-24 09:17 - 002008064 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017524175694.dll
      2017-05-29 08:07 - 2017-05-29 08:07 - 002008064 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20175297735.dll
      2017-06-13 07:40 - 2017-06-13 07:40 - 002011648 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20176134013374.dll
      2017-06-13 23:42 - 2017-06-13 23:42 - 002011648 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017613428192.dll
      2017-06-16 08:07 - 2017-06-16 08:07 - 002011648 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017616745230.dll
      2017-06-17 20:54 - 2017-06-17 20:54 - 002011648 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20176175444375.dll
      2017-06-20 12:39 - 2017-06-20 12:39 - 002011648 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017620392713.dll
      2017-06-22 07:31 - 2017-06-22 07:31 - 002011648 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20176223128826.dll
      2017-06-30 08:43 - 2017-06-30 08:43 - 002011648 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017630439814.dll
      2017-06-05 13:34 - 2017-06-05 13:34 - 002011648 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017653419350.dll
      2017-06-06 23:39 - 2017-06-06 23:39 - 002011648 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017663958437.dll
      2017-06-08 18:49 - 2017-06-08 18:49 - 002011648 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017684938352.dll
      2017-07-10 18:05 - 2017-07-10 18:05 - 001972736 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017710548407.dll
      2017-07-14 18:41 - 2017-07-14 18:41 - 001973248 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017714411279.dll
      2017-07-18 23:54 - 2017-07-18 23:54 - 001973248 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20177185419573.dll
      2017-07-21 05:15 - 2017-07-21 05:15 - 001973760 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20177211525566.dll
      2017-07-27 09:55 - 2017-07-27 09:55 - 001973760 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20177275517760.dll
      2017-07-28 04:57 - 2017-07-28 04:57 - 001973760 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20177285736189.dll
      2017-07-03 08:19 - 2017-07-03 08:19 - 001972736 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017731946996.dll
      2017-07-04 09:07 - 2017-07-04 09:07 - 001972736 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201774732193.dll
      2017-08-01 08:38 - 2017-08-01 08:38 - 001973760 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201781381180.dll
      2017-08-16 05:06 - 2017-08-16 05:06 - 001973760 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017816647150.dll
      2017-08-18 04:56 - 2017-08-18 04:56 - 001999360 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20178185624580.dll
      2017-08-20 07:53 - 2017-08-20 07:53 - 001999360 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20178205358978.dll
      2017-08-23 09:46 - 2017-08-23 09:46 - 001999360 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20178234653479.dll
      2017-08-26 09:05 - 2017-08-26 09:05 - 001999360 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017826549919.dll
      2017-08-31 08:56 - 2017-08-31 08:56 - 001999872 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017831561686.dll
      2017-08-05 07:40 - 2017-08-05 07:40 - 001973760 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017854013409.dll
      2017-08-06 22:28 - 2017-08-06 22:28 - 001973760 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017862837477.dll
      2017-08-09 09:31 - 2017-08-09 09:31 - 001973760 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017893159204.dll
      2017-09-14 08:52 - 2017-09-14 08:52 - 001999872 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20179145250727.dll
      2017-09-20 08:56 - 2017-09-20 08:56 - 001999872 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20179205616444.dll
      2017-09-02 09:04 - 2017-09-02 09:04 - 001999872 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201792421331.dll
      2017-09-26 11:48 - 2017-09-26 11:48 - 001999872 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20179264854497.dll
      2017-09-28 00:05 - 2017-09-28 00:05 - 001999872 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017927529360.dll
      2017-09-07 04:56 - 2017-09-07 04:56 - 001999872 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2017975639972.dll
      2018-01-16 10:06 - 2018-01-16 10:06 - 002329600 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_201811662581.dll
      2018-01-18 00:32 - 2018-01-18 00:32 - 002329600 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20181173214934.dll
      2018-01-19 00:31 - 2018-01-19 00:31 - 002329600 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20181183124471.dll
      2018-01-21 11:17 - 2018-01-21 11:17 - 002329600 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_20181211757955.dll
      2018-01-04 11:38 - 2018-01-04 11:38 - 002228736 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2018143847667.dll
      2018-01-07 08:59 - 2018-01-07 08:59 - 002228736 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2018175955849.dll
      2018-01-09 10:29 - 2018-01-09 10:29 - 002228736 _____ (Opera Software) C:\Users\Dellssd\AppData\Local\Temp\Opera_installer_2018192959337.dll
      2010-06-17 17:09 - 2010-06-17 17:09 - 000149352 ____R (Microsoft Corporation) C:\Users\Dellssd\AppData\Local\Temp\ose00000.exe
      2012-11-10 21:20 - 2012-11-10 21:20 - 000150600 ____R (Microsoft Corporation) C:\Users\Dellssd\AppData\Local\Temp\ose00001.exe
      2008-11-16 13:38 - 2008-11-16 13:38 - 000145184 ____R (Microsoft Corporation) C:\Users\Dellssd\AppData\Local\Temp\ose00002.exe
      2010-06-17 17:09 - 2010-06-17 17:09 - 000149352 ____R (Microsoft Corporation) C:\Users\Dellssd\AppData\Local\Temp\ose00003.exe
      2016-08-16 10:48 - 2016-08-16 10:48 - 000488960 _____ () C:\Users\Dellssd\AppData\Local\Temp\sqlite3.exe
      2017-04-22 19:34 - 2017-04-22 19:34 - 000181544 _____ () C:\Users\Dellssd\AppData\Local\Temp\ubar-yadownloader.exe
      2017-03-15 22:10 - 2017-03-15 22:10 - 014456872 _____ (Microsoft Corporation) C:\Users\Dellssd\AppData\Local\Temp\vc_redist.x86.exe
      2017-08-13 12:15 - 2017-08-13 12:15 - 030950664 _____ () C:\Users\Dellssd\AppData\Local\Temp\vlc-2.2.6-win32.exe
      2017-04-14 13:05 - 2017-04-14 13:05 - 000349280 _____ (Lavasoft) C:\Users\Dellssd\AppData\Local\Temp\WcInstaller.exe
      2017-04-22 21:17 - 2017-03-27 12:10 - 000237920 _____ () C:\Users\Dellssd\AppData\Local\Temp\YandexWorking.exe
      2017-03-30 21:07 - 2017-03-30 21:07 - 061980664 _____ (YANDEX LLC) C:\Users\Dellssd\AppData\Local\Temp\{13BD144E-5CAE-445E-ACAC-B02F6DDCF43E}.exe
      2016-10-20 12:07 - 2016-10-20 12:07 - 044295032 _____ (Google Inc.) C:\Users\Dellssd\AppData\Local\Temp\{486E4B52-BB14-452C-9A04-353419ACD5E8}-54.0.2840.71_chrome_installer.exe
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\Windows\system32\winlogon.exe => File is digitally signed
      C:\Windows\system32\wininit.exe => File is digitally signed
      C:\Windows\SysWOW64\wininit.exe => File is digitally signed
      C:\Windows\explorer.exe => File is digitally signed
      C:\Windows\SysWOW64\explorer.exe => File is digitally signed
      C:\Windows\system32\svchost.exe => File is digitally signed
      C:\Windows\SysWOW64\svchost.exe => File is digitally signed
      C:\Windows\system32\services.exe => File is digitally signed
      C:\Windows\system32\User32.dll => File is digitally signed
      C:\Windows\SysWOW64\User32.dll => File is digitally signed
      C:\Windows\system32\userinit.exe => File is digitally signed
      C:\Windows\SysWOW64\userinit.exe => File is digitally signed
      C:\Windows\system32\rpcss.dll => File is digitally signed
      C:\Windows\system32\dnsapi.dll => File is digitally signed
      C:\Windows\SysWOW64\dnsapi.dll => File is digitally signed
      C:\Windows\system32\Drivers\volsnap.sys => File is digitally signed
      LastRegBack: 2018-09-25 14:59
      ==================== End of FRST.txt ============================
    • от ivan_dimitrov26
      Добър ден. От няколко дни след зареждане на Windows-а се зарежда Chromuim (подобен на Google Chrome). Предполагам, че е влязъл с инсталиране на друга програма. Сканирах с Аваст, но не намери нищо. Компютърът е с по-стара операционна система, но се използва рядко.
      Scan result of Farbar Recovery Scan Tool (FRST) (x86) Version: 06.10.2018
      Ran by Administrator (administrator) on V002-16032D283A (09-10-2018 12:51:00)
      Running from C:\Documents and Settings\Administrator\Desktop
      Loaded Profiles: Administrator (Available Profiles: Administrator)
      Platform: Microsoft Windows XP Professional Service Pack 3 (X86) Language: English (United States)
      Internet Explorer Version 8 (Default browser: IE)
      Boot Mode: Normal
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      (AVAST Software) C:\Program Files\AVAST Software\Avast\AvastSvc.exe
      (Adobe Systems Incorporated) C:\Program Files\Adobe\Reader 9.0\Reader\reader_sl.exe
      (Samsung Electronics.) C:\WINDOWS\Samsung\ComSMMgr\SSMMgr.exe
      (Cyberlink Corp.) C:\Program Files\CyberLink\PowerDVD\PDVDServ.exe
      (Analog Devices, Inc.) C:\Program Files\Analog Devices\Core\smax4pnp.exe
      (Analog Devices, Inc.) C:\Program Files\Analog Devices\SoundMAX\SMax4.exe
      (NewSoft Technology Corporation) C:\Program Files\NewSoft\Smart Start UP\PnPDetect.exe
      (Skype Technologies S.A.) C:\Program Files\Skype\Phone\Skype.exe
      (Microsoft Corporation) C:\Program Files\Messenger\msmsgs.exe
      () C:\WINDOWS\Datecs\FType2K.exe
      (Microsoft Corporation) C:\WINDOWS\Microsoft.NET\Framework\v2.0.50727\mscorsvw.exe
      (Microsoft Corporation) C:\Program Files\Common Files\Microsoft Shared\VS7DEBUG\MDM.EXE
      (NVIDIA Corporation) C:\WINDOWS\system32\nvsvc32.exe
      (AVAST Software) C:\Program Files\AVAST Software\Avast\AvastUI.exe
      (AVAST Software) C:\Program Files\AVAST Software\Avast\aswidsagent.exe
      (Microsoft Corporation) C:\WINDOWS\system32\wbem\unsecapp.exe
      (Microsoft Corporation) C:\WINDOWS\system32\wbem\unsecapp.exe
      (Google Inc.) C:\Program Files\Chrome\chrome32_49.0.2623.75\chrome.exe
      (Google Inc.) C:\Program Files\Chrome\chrome32_49.0.2623.75\chrome.exe
      (Microsoft Corporation) C:\WINDOWS\system32\wuauclt.exe
      (Google Inc.) C:\Program Files\Chrome\chrome32_49.0.2623.75\chrome.exe
      (Google Inc.) C:\Program Files\Chrome\chrome32_49.0.2623.75\chrome.exe
      (Google Inc.) C:\Program Files\Chrome\chrome32_49.0.2623.75\chrome.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [NvCplDaemon] => RUNDLL32.EXE C:\WINDOWS\system32\NvCpl.dll,NvStartup
      HKLM\...\Run: [nwiz] => nwiz.exe /install
      HKLM\...\Run: [NvMediaCenter] => RUNDLL32.EXE C:\WINDOWS\system32\NvMcTray.dll,NvTaskbarInit
      HKLM\...\Run: [Adobe Reader Speed Launcher] => C:\Program Files\Adobe\Reader 9.0\Reader\Reader_sl.exe [35696 2009-02-27] (Adobe Systems Incorporated)
      HKLM\...\Run: [Samsung Common SM] => C:\WINDOWS\Samsung\ComSMMgr\ssmmgr.exe [372736 2005-07-03] (Samsung Electronics.)
      HKLM\...\Run: [RemoteControl] => C:\Program Files\CyberLink\PowerDVD\PDVDServ.exe [32768 2005-01-12] (Cyberlink Corp.)
      HKLM\...\Run: [SoundMAXPnP] => C:\Program Files\Analog Devices\Core\smax4pnp.exe [925696 2005-05-20] (Analog Devices, Inc.)
      HKLM\...\Run: [SoundMAX] => C:\Program Files\Analog Devices\SoundMAX\Smax4.exe [716800 2005-09-07] (Analog Devices, Inc.)
      HKLM\...\Run: [Smart Start UP] => C:\Program Files\NewSoft\Smart Start UP\PnPDetect.exe [104528 2007-04-27] (NewSoft Technology Corporation)
      HKLM\...\Run: [NeroFilterCheck] => C:\WINDOWS\system32\NeroCheck.exe [155648 2001-07-09] (Ahead Software Gmbh)
      HKLM\...\Run: [AvastUI.exe] => C:\Program Files\AVAST Software\Avast\AvLaunch.exe [242392 2018-10-09] (AVAST Software)
      HKU\S-1-5-21-2025429265-842925246-1177238915-500\...\Run: [Skype] => C:\Program Files\Skype\Phone\Skype.exe [27716568 2017-05-05] (Skype Technologies S.A.)
      HKU\S-1-5-21-2025429265-842925246-1177238915-500\...\Run: [MSMSGS] => C:\Program Files\Messenger\MSMSGS.EXE [1507600 2002-10-17] (Microsoft Corporation)
      HKU\S-1-5-21-2025429265-842925246-1177238915-500\...\Run: [Chromium] => c:\documents and settings\administrator\local settings\application data\chromium\application\chrome.exe [666624 2015-07-30] (The Chromium Authors)
      SecurityProviders: msapsspc.dll, schannel.dll, credssp.dll, digest.dll, msnsspc.dll
      Startup: C:\Documents and Settings\All Users\Start Menu\Programs\Startup\FlexType 2K.lnk [2018-10-06]
      ShortcutTarget: FlexType 2K.lnk -> C:\WINDOWS\Datecs\FType2K.exe ()
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      Tcpip\Parameters: [DhcpNameServer]
      Tcpip\..\Interfaces\{15E2290D-8571-410D-8D3C-128B92D7A9B4}: [DhcpNameServer]
      Internet Explorer:
      HKU\.DEFAULT\SOFTWARE\Policies\Microsoft\Internet Explorer: Restriction <==== ATTENTION
      HKU\S-1-5-19\SOFTWARE\Policies\Microsoft\Internet Explorer: Restriction <==== ATTENTION
      HKU\S-1-5-20\SOFTWARE\Policies\Microsoft\Internet Explorer: Restriction <==== ATTENTION
      HKU\S-1-5-21-2025429265-842925246-1177238915-500\SOFTWARE\Policies\Microsoft\Internet Explorer: Restriction <==== ATTENTION
      HKLM\Software\Microsoft\Internet Explorer\Main,Start Page = hxxps://search.avast.com/AV772/
      HKLM\Software\Microsoft\Internet Explorer\Main,Search Page = hxxps://search.avast.com/AV772/search/web?q={searchTerms}
      HKLM\Software\Microsoft\Internet Explorer\Main,Default_Page_URL = 
      HKLM\Software\Microsoft\Internet Explorer\Main,Default_Search_URL = 
      HKU\S-1-5-21-2025429265-842925246-1177238915-500\Software\Microsoft\Internet Explorer\Main,Search Page = hxxps://search.avast.com/AV772/search/web?q={searchTerms}
      HKU\S-1-5-21-2025429265-842925246-1177238915-500\Software\Microsoft\Internet Explorer\Main,Start Page = hxxps://search.avast.com/AV772/
      HKLM\SOFTWARE\Microsoft\Internet Explorer\AboutURLs,Tabs: "about:newtab" <==== ATTENTION
      SearchScopes: HKLM -> DefaultScope {8C31F27B-BE8A-4e4b-A478-17760AF1F5D9} URL = hxxps://search.avast.com/AV772/search/web?q={searchTerms}
      SearchScopes: HKLM -> {8C31F27B-BE8A-4e4b-A478-17760AF1F5D9} URL = hxxps://search.avast.com/AV772/search/web?q={searchTerms}
      SearchScopes: HKU\S-1-5-21-2025429265-842925246-1177238915-500 -> DefaultScope {8C31F27B-BE8A-4e4b-A478-17760AF1F5D9} URL = hxxps://search.avast.com/AV772/search/web?q={searchTerms}
      SearchScopes: HKU\S-1-5-21-2025429265-842925246-1177238915-500 -> {8C31F27B-BE8A-4e4b-A478-17760AF1F5D9} URL = hxxps://search.avast.com/AV772/search/web?q={searchTerms}
      BHO: Adobe PDF Link Helper -> {18DF081C-E8AD-4283-A596-FA578C2EBDC3} -> C:\Program Files\Common Files\Adobe\Acrobat\ActiveX\AcroIEHelperShim.dll [2009-02-27] (Adobe Systems Incorporated)
      Handler: ms-itss - {0A9007C0-4076-11D3-8789-0000F8105754} - C:\Program Files\Common Files\Microsoft Shared\Information Retrieval\MSITSS.DLL [2000-04-19] (Microsoft Corporation)
      StartMenuInternet: IEXPLORE.EXE - iexplore.exe
      FF DefaultProfile: wykzwtrk.default
      FF ProfilePath: C:\Documents and Settings\Administrator\Application Data\Mozilla\Firefox\Profiles\wykzwtrk.default [2018-10-09]
      FF Homepage: C:\Documents and Settings\Administrator\Application Data\Mozilla\Firefox\Profiles\wykzwtrk.default -> hxxps://www.gbg.bg/
      FF Extension: (Avast Online Security) - C:\Documents and Settings\Administrator\Application Data\Mozilla\Firefox\Profiles\wykzwtrk.default\Extensions\wrc@avast.com.xpi [2018-10-09]
      FF HKLM\...\Firefox\Extensions: [{20a82645-c095-46ed-80e3-08825760534b}] - C:\WINDOWS\Microsoft.NET\Framework\v3.5\Windows Presentation Foundation\DotNetAssistantExtension
      FF Extension: (Microsoft .NET Framework Assistant) - C:\WINDOWS\Microsoft.NET\Framework\v3.5\Windows Presentation Foundation\DotNetAssistantExtension [2018-10-05] [Legacy] [not signed]
      FF Plugin: @microsoft.com/WPF,version=3.5 -> C:\WINDOWS\Microsoft.NET\Framework\v3.5\Windows Presentation Foundation\NPWPF.dll [2008-07-29] (Microsoft Corporation)
      StartMenuInternet: FIREFOX.EXE - firefox.exe
      CHR Profile: C:\Documents and Settings\Administrator\Local Settings\Application Data\Google\Chrome\User Data\Default [2018-10-09]
      CHR Extension: (Docs) - C:\Documents and Settings\Administrator\Local Settings\Application Data\Google\Chrome\User Data\Default\Extensions\aohghmighlieiainnegkcijnfilokake [2018-10-04]
      CHR Extension: (Google Drive) - C:\Documents and Settings\Administrator\Local Settings\Application Data\Google\Chrome\User Data\Default\Extensions\apdfllckaahabafndbhieahigkjlhalf [2018-10-04]
      CHR Extension: (YouTube) - C:\Documents and Settings\Administrator\Local Settings\Application Data\Google\Chrome\User Data\Default\Extensions\blpcfgokakmgnkcojhhkbfbldkacnbeo [2018-10-04]
      CHR Extension: (Google Docs Offline) - C:\Documents and Settings\Administrator\Local Settings\Application Data\Google\Chrome\User Data\Default\Extensions\ghbmnnjooekpmoecnnnilnnbdlolhkhi [2018-10-04]
      CHR Extension: (Chrome Web Store Payments) - C:\Documents and Settings\Administrator\Local Settings\Application Data\Google\Chrome\User Data\Default\Extensions\nmmhkkegccagdldgiimedpiccmgmieda [2018-10-04]
      CHR Extension: (Gmail) - C:\Documents and Settings\Administrator\Local Settings\Application Data\Google\Chrome\User Data\Default\Extensions\pjkljhegncpnkpknbcohdijeoejaedia [2018-10-04]
      StartMenuInternet: chrome.exe - C:\Program Files\Chrome\chrome32_49.0.2623.75\chrome.exe
      StartMenuInternet: Google Chrome - C:\Program Files\Chrome\chrome32_49.0.2623.75\chrome.exe
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R3 aswbIDSAgent; C:\Program Files\AVAST Software\Avast\aswidsagent.exe [6488376 2018-10-09] (AVAST Software)
      R2 avast! Antivirus; C:\Program Files\AVAST Software\Avast\AvastSvc.exe [322464 2018-10-09] (AVAST Software)
      S2 SkypeUpdate; C:\Program Files\Skype\Updater\Updater.exe [317400 2017-04-05] (Skype Technologies) [File not signed]
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R3 AEAudioService; C:\WINDOWS\System32\drivers\AEAudio.sys [127872 2005-03-04] (Andrea Electronics Corporation)
      R1 aswArPot; C:\WINDOWS\System32\drivers\aswArPot.sys [167552 2018-10-09] (AVAST Software)
      R1 aswbidsdriver; C:\WINDOWS\System32\drivers\aswbidsdriverx.sys [188336 2018-10-09] (AVAST Software)
      R0 aswbidsh; C:\WINDOWS\System32\drivers\aswbidshx.sys [164944 2018-10-09] (AVAST Software)
      R0 aswblog; C:\WINDOWS\System32\drivers\aswblogx.sys [284320 2018-10-09] (AVAST Software)
      R0 aswbuniv; C:\WINDOWS\System32\drivers\aswbunivx.sys [57968 2018-10-09] (AVAST Software)
      R1 aswHdsKe; C:\WINDOWS\System32\drivers\aswHdsKe.sys [196008 2018-10-09] (AVAST Software)
      S3 aswHwid; C:\WINDOWS\System32\drivers\aswHwid.sys [42808 2018-10-09] (AVAST Software)
      R2 aswMonFlt; C:\WINDOWS\System32\drivers\aswMonFlt.sys [135376 2018-10-09] (AVAST Software)
      R1 aswRdr; C:\WINDOWS\System32\drivers\aswRdr.sys [70840 2018-10-09] (AVAST Software)
      R0 aswRvrt; C:\WINDOWS\System32\drivers\aswRvrt.sys [73264 2018-10-09] (AVAST Software)
      R1 aswSnx; C:\WINDOWS\System32\drivers\aswSnx.sys [784112 2018-10-09] (AVAST Software)
      R1 aswSP; C:\WINDOWS\System32\drivers\aswSP.sys [396536 2018-10-09] (AVAST Software)
      R3 aswStmXP; C:\WINDOWS\System32\drivers\aswStmXP.sys [206976 2018-10-09] (AVAST Software)
      R0 aswVmm; C:\WINDOWS\System32\drivers\aswVmm.sys [311328 2018-10-09] (AVAST Software)
      R2 DgiVecp; C:\WINDOWS\System32\Drivers\DgiVecp.sys [41984 2005-03-14] (DeviceGuys, Inc.) [File not signed]
      R0 giveio; C:\WINDOWS\System32\giveio.sys [5248 1996-04-03] () [File not signed]
      R3 HCF_MSFT; C:\WINDOWS\System32\DRIVERS\HCF_MSFT.sys [907456 2001-08-17] (Conexant)
      R0 mv61xxmm; C:\WINDOWS\system32\Drivers\mv61xxmm.sys [14184 2014-02-12] (Marvell Semiconductor Inc.)
      R0 mv64xxmm; C:\WINDOWS\system32\Drivers\mv64xxmm.sys [5632 2014-02-12] (Marvell Semiconductor Inc.) [File not signed]
      R0 mvxxmm; C:\WINDOWS\system32\Drivers\mvxxmm.sys [14184 2014-02-12] (Marvell Semiconductor Inc.)
      R0 PxHelp20; C:\WINDOWS\System32\DRIVERS\PxHelp20.sys [20016 2003-10-28] (Sonic Solutions) [File not signed]
      R3 SenFiltService; C:\WINDOWS\System32\drivers\Senfilt.sys [393088 2005-08-11] (Sensaura)
      R3 yukonwxp; C:\WINDOWS\System32\DRIVERS\yk51x86.sys [299424 2012-03-27] (Marvell)
      S4 IntelIde; no ImagePath
      U1 WS2IFSL; no ImagePath
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-10-09 12:51 - 2018-10-09 12:51 - 000012972 _____ C:\Documents and Settings\Administrator\Desktop\FRST.txt
      2018-10-09 12:50 - 2018-10-09 12:51 - 000000000 ____D C:\FRST
      2018-10-09 12:47 - 2018-10-09 12:49 - 001774592 _____ (Farbar) C:\Documents and Settings\Administrator\Desktop\FRST.exe
      2018-10-09 08:45 - 2018-10-09 08:45 - 000000000 ____D C:\WINDOWS\CSC
      2018-10-09 08:42 - 2018-10-09 08:42 - 000323288 _____ (AVAST Software) C:\WINDOWS\system32\aswBoot.exe
      2018-10-09 08:33 - 2018-10-09 08:33 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\AVAST Software
      2018-10-09 08:32 - 2018-10-09 08:32 - 000001689 _____ C:\Documents and Settings\All Users\Desktop\Avast Free Antivirus.lnk
      2018-10-09 08:32 - 2018-10-09 08:32 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\AVAST Software
      2018-10-09 08:31 - 2018-10-09 12:43 - 000000310 ____H C:\WINDOWS\Tasks\Avast Emergency Update.job
      2018-10-09 08:30 - 2018-10-09 08:43 - 000396536 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswSP.sys
      2018-10-09 08:30 - 2018-10-09 08:43 - 000206976 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswStmXP.sys
      2018-10-09 08:30 - 2018-10-09 08:43 - 000135376 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswMonFlt.sys
      2018-10-09 08:30 - 2018-10-09 08:43 - 000073264 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswRvrt.sys
      2018-10-09 08:30 - 2018-10-09 08:42 - 000784112 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswSnx.sys
      2018-10-09 08:30 - 2018-10-09 08:42 - 000311328 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswVmm.sys
      2018-10-09 08:30 - 2018-10-09 08:42 - 000196008 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswHdsKe.sys
      2018-10-09 08:30 - 2018-10-09 08:42 - 000167552 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswArPot.sys
      2018-10-09 08:30 - 2018-10-09 08:42 - 000070840 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswRdr.sys
      2018-10-09 08:30 - 2018-10-09 08:42 - 000042808 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswHwid.sys
      2018-10-09 08:30 - 2018-10-09 08:41 - 000284320 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswblogx.sys
      2018-10-09 08:30 - 2018-10-09 08:41 - 000188336 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswbidsdriverx.sys
      2018-10-09 08:30 - 2018-10-09 08:41 - 000164944 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswbidshx.sys
      2018-10-09 08:30 - 2018-10-09 08:41 - 000057968 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswbunivx.sys
      2018-10-09 08:29 - 2018-10-09 08:29 - 000000000 ____D C:\Program Files\AVAST Software
      2018-10-08 13:13 - 2018-10-08 13:14 - 000000099 _____ C:\WINDOWS\Reimage.ini
      2018-10-08 13:13 - 2018-10-08 13:13 - 000000000 ____D C:\rei
      2018-10-07 09:40 - 2018-10-07 09:40 - 000000043 _____ C:\Documents and Settings\NetworkService\Application Data\WB.CFG
      2018-10-06 14:51 - 2018-10-06 14:51 - 000000000 ____D C:\Documents and Settings\Administrator\Local Settings\Application Data\CEF
      2018-10-06 14:48 - 2018-10-09 09:02 - 000000000 ____D C:\Documents and Settings\Administrator\Local Settings\Application Data\AVAST Software
      2018-10-06 14:46 - 2018-10-06 14:46 - 000000000 ____D C:\Documents and Settings\Administrator\Local Settings\Application Data\Temp
      2018-10-06 14:45 - 2018-10-06 14:45 - 000000000 __HDC C:\WINDOWS\$NtUninstallWdf01009$
      2018-10-06 14:45 - 2008-11-07 18:55 - 000016928 ____N (Microsoft Corporation) C:\WINDOWS\system32\spmsgXP_2k3.dll
      2018-10-06 14:44 - 2018-10-06 14:43 - 001142072 _____ (Microsoft Corporation) C:\WINDOWS\ucrtbase.dll
      2018-10-06 14:42 - 2018-10-06 14:42 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\Media Player Classic
      2018-10-06 14:41 - 2018-10-06 14:42 - 000000000 ____D C:\Documents and Settings\Administrator\Local Settings\Application Data\chromium
      2018-10-06 14:40 - 2018-10-08 13:58 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\Namek
      2018-10-06 14:39 - 2018-10-09 12:32 - 000000000 ____D C:\Documents and Settings\All Users\Application Data\AVAST Software
      2018-10-06 14:39 - 2018-10-06 14:39 - 000000717 _____ C:\Documents and Settings\All Users\Desktop\Crystal Player.lnk
      2018-10-06 14:39 - 2018-10-06 14:39 - 000000000 ____D C:\Program Files\Crystal Player
      2018-10-06 14:39 - 2018-10-06 14:39 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\Crystal Player
      2018-10-06 14:39 - 2018-10-06 14:39 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\Crystal Player
      2018-10-06 14:37 - 2018-10-06 14:37 - 000000940 _____ C:\Documents and Settings\All Users\Desktop\Media Player Classic.lnk
      2018-10-06 14:37 - 2018-10-06 14:37 - 000000000 ____D C:\Program Files\K-Lite Codec Pack
      2018-10-06 14:37 - 2018-10-06 14:37 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\K-Lite Codec Pack
      2018-10-06 14:37 - 2006-09-13 23:14 - 000593938 _____ C:\WINDOWS\system32\x264vfw.dll
      2018-10-06 14:37 - 2006-07-05 20:02 - 000005120 _____ C:\WINDOWS\system32\ff_vfw.dll
      2018-10-06 14:37 - 2006-07-03 23:40 - 000620180 _____ (DivX, Inc.) C:\WINDOWS\system32\divx.dll
      2018-10-06 14:37 - 2006-06-21 12:42 - 001044480 _____ (The OpenSSL Project, hxxp://www.openssl.org/) C:\WINDOWS\system32\libdivx.dll
      2018-10-06 14:37 - 2006-06-21 12:42 - 000200704 _____ (The OpenSSL Project, hxxp://www.openssl.org/) C:\WINDOWS\system32\ssldivx.dll
      2018-10-06 14:37 - 2006-05-25 00:47 - 003596288 _____ C:\WINDOWS\system32\qt-dx331.dll
      2018-10-06 14:37 - 2006-05-25 00:46 - 000200704 _____ (DivXNetworks) C:\WINDOWS\system32\dtu100.dll
      2018-10-06 14:37 - 2006-05-13 23:16 - 000118784 _____ (fccHandler) C:\WINDOWS\system32\ac3acm.acm
      2018-10-06 14:37 - 2006-04-20 16:00 - 000856064 _____ C:\WINDOWS\system32\xvidcore.dll
      2018-10-06 14:37 - 2006-04-08 03:13 - 000090112 _____ (DivXNetworks) C:\WINDOWS\system32\dpl100.dll
      2018-10-06 14:37 - 2006-02-27 15:30 - 000217088 _____ C:\WINDOWS\system32\xvidvfw.dll
      2018-10-06 14:37 - 2005-02-24 18:56 - 000000547 _____ C:\WINDOWS\system32\ff_vfw.dll.manifest
      2018-10-06 14:37 - 2003-06-23 02:44 - 001415680 _____ (Microsoft Corporation) C:\WINDOWS\system32\WMV9VCM.dll
      2018-10-06 14:26 - 2018-10-06 14:26 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\Datecs Applications
      2018-10-06 14:20 - 2018-10-06 14:20 - 000000763 _____ C:\Documents and Settings\Administrator\Desktop\BSPlayer.lnk
      2018-10-06 14:20 - 2018-10-06 14:20 - 000000000 ____D C:\Program Files\Webteh
      2018-10-06 14:20 - 2018-10-06 14:20 - 000000000 ____D C:\Documents and Settings\Administrator\Start Menu\Programs\Webteh
      2018-10-06 09:28 - 2018-10-06 14:57 - 000000654 _____ C:\Documents and Settings\Administrator\Desktop\Winamp.lnk
      2018-10-06 09:28 - 2018-10-06 14:57 - 000000000 ____D C:\Program Files\Winamp
      2018-10-06 09:28 - 2018-10-06 09:28 - 000000000 ____D C:\Documents and Settings\Administrator\Start Menu\Programs\Winamp
      2018-10-05 12:45 - 2018-10-05 12:45 - 000053248 _____ C:\WINDOWS\system32\zlib.dll
      2018-10-05 09:04 - 2018-10-05 09:04 - 000001106 _____ C:\Documents and Settings\Administrator\Desktop\Nero Burning ROM.lnk
      2018-10-05 09:02 - 2018-10-05 09:03 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\Nero
      2018-10-05 09:02 - 2018-10-05 09:02 - 000000000 ____D C:\Program Files\Common Files\Ahead
      2018-10-05 09:02 - 2004-03-03 20:30 - 000125184 _____ (Ahead Software AG) C:\WINDOWS\system32\Drivers\imagesrv.sys
      2018-10-05 09:02 - 2004-03-03 20:30 - 000005504 _____ (Ahead Software AG) C:\WINDOWS\system32\Drivers\imagedrv.sys
      2018-10-05 09:02 - 2001-07-09 10:50 - 000155648 _____ (Ahead Software Gmbh) C:\WINDOWS\system32\NeroCheck.exe
      2018-10-05 09:02 - 2001-07-06 17:24 - 000283920 _____ (Pegasus Software, LLC) C:\WINDOWS\system32\ImagXpr5.dll
      2018-10-05 09:02 - 2001-07-06 13:41 - 000569344 _____ (Pegasus Software,LLC) C:\WINDOWS\system32\imagr5.dll
      2018-10-05 09:02 - 2001-07-06 11:44 - 000544768 _____ (Pegasus Software, LLC) C:\WINDOWS\system32\imagx5.dll
      2018-10-05 09:02 - 2001-06-26 07:15 - 000038912 _____ (Pegasus Imaging Corp.) C:\WINDOWS\system32\picn20.dll
      2018-10-05 09:02 - 2000-06-26 10:45 - 000106496 _____ (Pegasus Software) C:\WINDOWS\system32\TwnLib20.dll
      2018-10-05 08:52 - 2018-10-05 08:52 - 000000000 ____D C:\Program Files\MSECache
      2018-10-05 08:45 - 2018-10-05 08:45 - 000000000 ____D C:\Documents and Settings\Administrator\My Documents\My Skype Received Files
      2018-10-05 08:45 - 2018-10-05 08:45 - 000000000 ____D C:\Documents and Settings\Administrator\My Documents\My Skype Pictures
      2018-10-05 08:45 - 2018-10-05 08:45 - 000000000 ____D C:\Documents and Settings\Administrator\My Documents\My Skype Content
      2018-10-05 08:36 - 2018-10-05 08:36 - 000154568 _____ C:\Documents and Settings\LocalService\Local Settings\Application Data\FontCache3.0.0.0.dat
      2018-10-05 08:35 - 2018-10-05 08:35 - 000000000 ____D C:\WINDOWS\system32\XPSViewer
      2018-10-05 08:34 - 2018-10-05 08:34 - 000000000 ____D C:\Program Files\Reference Assemblies
      2018-10-05 08:34 - 2018-10-05 08:34 - 000000000 ____D C:\Program Files\MSBuild
      2018-10-05 08:34 - 2008-11-07 18:55 - 000026144 _____ (Microsoft Corporation) C:\WINDOWS\system32\spupdsvc.exe
      2018-10-05 08:34 - 2008-07-06 15:06 - 001676288 ____N (Microsoft Corporation) C:\WINDOWS\system32\xpssvcs.dll
      2018-10-05 08:34 - 2008-07-06 15:06 - 001676288 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\xpssvcs.dll
      2018-10-05 08:34 - 2008-07-06 15:06 - 000575488 ____N (Microsoft Corporation) C:\WINDOWS\system32\xpsshhdr.dll
      2018-10-05 08:34 - 2008-07-06 15:06 - 000575488 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\xpsshhdr.dll
      2018-10-05 08:34 - 2008-07-06 15:06 - 000117760 ____N (Microsoft Corporation) C:\WINDOWS\system32\prntvpt.dll
      2018-10-05 08:34 - 2008-07-06 15:06 - 000089088 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\filterpipelineprintproc.dll
      2018-10-05 08:34 - 2008-07-06 13:50 - 000597504 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\printfilterpipelinesvc.exe
      2018-10-05 08:34 - 2007-11-30 15:39 - 000017272 ____N (Microsoft Corporation) C:\WINDOWS\system32\spmsg.dll
      2018-10-05 08:33 - 2018-10-05 08:33 - 000000829 _____ C:\Documents and Settings\All Users\Start Menu\Programs\Windows Messenger.lnk
      2018-10-05 08:33 - 2018-10-05 08:33 - 000000000 ____D C:\Program Files\Messenger
      2018-10-05 08:31 - 2018-10-05 08:31 - 000000000 ____D C:\Program Files\Microsoft .NET Micro Framework
      2018-10-05 08:28 - 2018-10-05 08:28 - 000000853 _____ C:\Documents and Settings\All Users\Desktop\PDFArchitect.lnk
      2018-10-05 08:28 - 2018-10-05 08:28 - 000000706 _____ C:\Documents and Settings\All Users\Desktop\PDFCreator.lnk
      2018-10-05 08:28 - 2018-10-05 08:28 - 000000000 ____D C:\Program Files\PDFCreator
      2018-10-05 08:28 - 2018-10-05 08:28 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\PDFCreator
      2018-10-05 08:28 - 2018-10-05 08:28 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\pdfforge
      2018-10-05 08:28 - 2012-03-05 21:04 - 000054272 _____ (pdfforge GbR) C:\WINDOWS\system32\pdfcmon.dll
      2018-10-05 08:27 - 2018-10-05 08:27 - 000000000 ____D C:\WINDOWS\system32\appmgmt
      2018-10-04 14:04 - 2018-10-04 14:04 - 000000738 _____ C:\Documents and Settings\Administrator\Desktop\Outlook Express.lnk
      2018-10-04 14:03 - 2018-10-04 14:03 - 000002016 _____ C:\Documents and Settings\Administrator\Desktop\Microsoft Office PowerPoint 2003 (2).lnk
      2018-10-04 12:43 - 2018-10-04 12:43 - 000001527 _____ C:\Documents and Settings\Administrator\Desktop\Tour Windows XP.lnk
      2018-10-04 12:37 - 2018-10-04 12:37 - 000000702 _____ C:\Documents and Settings\All Users\Desktop\MozBackup.lnk
      2018-10-04 12:37 - 2018-10-04 12:37 - 000000000 ____D C:\Program Files\MozBackup
      2018-10-04 12:37 - 2018-10-04 12:37 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\MozBackup
      2018-10-04 12:37 - 2018-09-29 12:42 - 000000775 _____ C:\Documents and Settings\Administrator\My Documents\indexfile.txt
      2018-10-04 12:34 - 2018-10-08 08:43 - 000000000 ____D C:\Documents and Settings\Administrator\My Documents\Изтегляния
      2018-10-04 12:30 - 2018-10-04 12:30 - 000000754 _____ C:\Documents and Settings\All Users\Desktop\YoWindow.lnk
      2018-10-04 12:30 - 2018-10-04 12:30 - 000000000 ____D C:\Program Files\YoWindow
      2018-10-04 12:30 - 2018-10-04 12:30 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\YoWindow
      2018-10-04 12:30 - 2018-10-04 12:30 - 000000000 ____D C:\Documents and Settings\All Users\Application Data\YoWindow
      2018-10-04 12:28 - 2018-10-04 12:28 - 000001487 _____ C:\Documents and Settings\Administrator\Start Menu\Programs\Windows Explorer (2).lnk
      2018-10-04 12:25 - 2018-10-04 12:25 - 000000784 _____ C:\Documents and Settings\Administrator\Desktop\ESET Online Scanner.lnk
      2018-10-04 12:20 - 2018-10-04 12:20 - 000000000 ____D C:\Program Files\Marvell
      2018-10-04 12:20 - 2012-03-27 17:48 - 000299424 _____ (Marvell) C:\WINDOWS\system32\Drivers\yk51x86.sys
      2018-10-04 08:51 - 2018-10-09 09:05 - 000000000 ____D C:\Documents and Settings\Administrator\My Documents\My Photo
      2018-10-04 08:48 - 2018-10-06 14:25 - 000002497 _____ C:\Documents and Settings\Administrator\Desktop\Microsoft Office Word 2003 (2).lnk
      2018-10-04 08:48 - 2018-10-04 08:48 - 000002044 _____ C:\Documents and Settings\Administrator\Desktop\Microsoft Office Excel 2003 (2).lnk
      2018-10-04 08:46 - 2018-10-09 09:22 - 000000192 _____ C:\WINDOWS\winamp.ini
      2018-10-04 08:46 - 2018-10-04 08:46 - 000001826 _____ C:\Documents and Settings\All Users\Desktop\Presto! Mr. Photo 4.lnk
      2018-10-04 08:46 - 2003-10-29 03:34 - 000462848 ____N (Sonic Solutions) C:\WINDOWS\system32\px.dll
      2018-10-04 08:46 - 2003-10-29 03:33 - 000286720 ____N (Sonic Solutions) C:\WINDOWS\system32\pxwave.dll
      2018-10-04 08:46 - 2003-10-29 03:33 - 000143360 ____N (Sonic Solutions) C:\WINDOWS\system32\pxmas.dll
      2018-10-04 08:46 - 2003-10-28 13:02 - 000053248 ____N C:\WINDOWS\system32\pxhpinst.exe
      2018-10-04 08:46 - 2003-10-28 13:02 - 000020016 ____N (Sonic Solutions) C:\WINDOWS\system32\Drivers\pxhelp20.sys
      2018-10-04 08:46 - 2003-10-27 12:00 - 000319488 ____N (Sonic Solutions) C:\WINDOWS\system32\pxdrv.dll
      2018-10-04 08:46 - 2003-10-14 12:00 - 000028672 ____N (Sonic Solutions) C:\WINDOWS\system32\vxblock.dll
      2018-10-04 08:45 - 2018-10-04 08:45 - 000000000 ____D C:\Program Files\NewSoft
      2018-10-04 08:45 - 2018-10-04 08:45 - 000000000 ____D C:\Program Files\Common Files\NewSoft
      2018-10-04 08:45 - 2018-10-04 08:45 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\NewSoft
      2018-10-04 08:45 - 2018-10-04 08:45 - 000000000 ____D C:\Documents and Settings\All Users\Application Data\Newsoft
      2018-10-04 08:45 - 2018-10-04 08:45 - 000000000 ____D C:\Documents and Settings\Administrator\Local Settings\Application Data\NewSoft
      2018-10-04 08:45 - 1998-06-17 00:00 - 000385100 _____ (Microsoft Corporation) C:\WINDOWS\system32\MSVCRTD.DLL
      2018-10-04 08:43 - 2018-10-04 08:43 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\Canon
      2018-10-04 08:42 - 2018-10-04 08:42 - 000000000 ___HD C:\CanoScan
      2018-10-04 08:42 - 2018-10-04 08:42 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\Canon
      2018-10-04 08:42 - 2013-07-03 01:59 - 000014976 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\usbscan.sys
      2018-10-04 08:42 - 2013-07-03 01:59 - 000014976 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\usbscan.sys
      2018-10-04 08:42 - 2005-06-23 22:17 - 000352256 _____ (CANON INC.) C:\WINDOWS\system32\CNQL1213.DLL
      2018-10-04 08:42 - 2005-02-28 13:20 - 000057344 _____ (CANON INC.) C:\WINDOWS\system32\CNQU110.DLL
      2018-10-04 08:38 - 2018-10-09 12:42 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\Skype
      2018-10-04 08:38 - 2018-10-05 13:45 - 000002265 _____ C:\Documents and Settings\All Users\Desktop\Skype.lnk
      2018-10-04 08:38 - 2018-10-04 08:38 - 000000000 ___RD C:\Program Files\Skype
      2018-10-04 08:38 - 2018-10-04 08:38 - 000000000 ____D C:\Program Files\Common Files\Skype
      2018-10-04 08:38 - 2018-10-04 08:38 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\Skype
      2018-10-04 08:38 - 2018-10-04 08:38 - 000000000 ____D C:\Documents and Settings\All Users\Application Data\Skype
      2018-10-04 08:38 - 2018-10-04 08:38 - 000000000 ____D C:\Documents and Settings\Administrator\Tracing
      2018-10-04 08:37 - 2018-10-08 12:43 - 000170200 _____ (Malwarebytes) C:\WINDOWS\system32\Drivers\MBAMSwissArmy.sys
      2018-10-04 08:37 - 2018-10-05 13:43 - 000000000 ____D C:\Documents and Settings\All Users\Application Data\Package Cache
      2018-10-04 08:37 - 2018-10-04 08:37 - 000000777 _____ C:\Documents and Settings\All Users\Desktop\Malwarebytes Anti-Malware.lnk
      2018-10-04 08:37 - 2018-10-04 08:37 - 000000000 ____D C:\Program Files\Malwarebytes Anti-Malware
      2018-10-04 08:37 - 2018-10-04 08:37 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\Malwarebytes Anti-Malware
      2018-10-04 08:37 - 2018-10-04 08:37 - 000000000 ____D C:\Documents and Settings\All Users\Application Data\Malwarebytes
      2018-10-04 08:37 - 2016-03-10 14:09 - 000123264 _____ (Malwarebytes) C:\WINDOWS\system32\Drivers\mbamchameleon.sys
      2018-10-04 08:37 - 2016-03-10 14:08 - 000024448 _____ (Malwarebytes) C:\WINDOWS\system32\Drivers\mbam.sys
      2018-10-04 08:36 - 2018-10-06 14:51 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\vlc
      2018-10-04 08:36 - 2018-10-04 08:36 - 000000000 ____D C:\Program Files\VideoLAN
      2018-10-04 08:31 - 2018-10-04 08:31 - 000000000 ____D C:\Program Files\FinalWire
      2018-10-04 08:31 - 2018-10-04 08:31 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\FinalWire
      2018-10-03 18:55 - 2018-10-03 18:55 - 000000301 _____ C:\Documents and Settings\Administrator\Desktop\Shortcut to Sounds and Audio Devices.lnk
      2018-10-03 18:47 - 2018-10-05 12:33 - 000000000 ___RD C:\Documents and Settings\Administrator\Desktop\New Briefcase
      2018-10-03 18:35 - 2008-04-13 22:47 - 000083072 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wdmaud.sys
      2018-10-03 18:35 - 2008-04-13 22:47 - 000083072 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\wdmaud.sys
      2018-10-03 18:35 - 2008-04-13 22:15 - 000006272 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\splitter.sys
      2018-10-03 18:35 - 2008-04-13 22:15 - 000006272 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\splitter.sys
      2018-10-03 18:34 - 2018-10-03 18:34 - 000000000 ____D C:\Program Files\Analog Devices
      2018-10-03 18:34 - 2018-10-03 18:34 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\SoundMAX
      2018-10-03 18:34 - 2008-04-14 03:42 - 000129536 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\ksproxy.ax
      2018-10-03 18:34 - 2008-04-14 03:42 - 000129536 _____ (Microsoft Corporation) C:\WINDOWS\system32\ksproxy.ax
      2018-10-03 18:34 - 2008-04-14 03:41 - 000004096 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\ksuser.dll
      2018-10-03 18:34 - 2008-04-14 03:41 - 000004096 _____ (Microsoft Corporation) C:\WINDOWS\system32\ksuser.dll
      2018-10-03 18:34 - 2008-04-13 22:45 - 000060800 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sysaudio.sys
      2018-10-03 18:34 - 2008-04-13 22:45 - 000060800 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\sysaudio.sys
      2018-10-03 18:34 - 2008-04-13 22:15 - 000172416 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kmixer.sys
      2018-10-03 18:34 - 2008-04-13 22:15 - 000172416 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\kmixer.sys
      2018-10-03 18:34 - 2008-04-13 22:15 - 000060160 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\drmk.sys
      2018-10-03 18:34 - 2008-04-13 22:15 - 000060160 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\drmk.sys
      2018-10-03 18:34 - 2008-04-13 22:15 - 000056576 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\swmidi.sys
      2018-10-03 18:34 - 2008-04-13 22:15 - 000056576 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\swmidi.sys
      2018-10-03 18:34 - 2008-04-13 22:15 - 000052864 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\dmusic.sys
      2018-10-03 18:34 - 2008-04-13 22:15 - 000052864 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\DMusic.sys
      2018-10-03 18:34 - 2008-04-13 22:15 - 000002944 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\drmkaud.sys
      2018-10-03 18:34 - 2008-04-13 22:15 - 000002944 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\drmkaud.sys
      2018-10-03 18:34 - 2008-04-13 22:09 - 000007552 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mskssrv.sys
      2018-10-03 18:34 - 2008-04-13 22:09 - 000007552 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\MSKSSRV.sys
      2018-10-03 18:34 - 2008-04-13 22:09 - 000005376 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mspclock.sys
      2018-10-03 18:34 - 2008-04-13 22:09 - 000005376 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\MSPCLOCK.sys
      2018-10-03 18:34 - 2008-04-13 22:09 - 000004992 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mspqm.sys
      2018-10-03 18:34 - 2008-04-13 22:09 - 000004992 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\MSPQM.sys
      2018-10-03 18:34 - 2008-04-13 20:09 - 000142592 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\aec.sys
      2018-10-03 18:34 - 2008-04-13 20:09 - 000142592 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\aec.sys
      2018-10-03 18:34 - 2008-03-21 11:35 - 000146048 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\portcls.sys
      2018-10-03 18:34 - 2008-03-21 11:35 - 000146048 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\portcls.sys
      2018-10-03 18:34 - 2005-09-26 16:20 - 000049152 _____ (Analog Devices Inc.) C:\WINDOWS\system32\DSndUp.exe
      2018-10-03 18:34 - 2005-05-04 09:20 - 000053248 ____N (Analog Devices Inc.) C:\WINDOWS\system32\wdmioctl.dll
      2018-10-03 18:34 - 2002-04-17 15:05 - 000045056 ____N (adi) C:\WINDOWS\system32\CleanUp.exe
      2018-10-03 18:34 - 2001-09-11 15:20 - 001285632 ____N (Analog Devices) C:\WINDOWS\system32\SMMedia.dll
      2018-10-03 18:31 - 2018-10-03 18:31 - 000000000 ____D C:\Program Files\Realtek
      2018-10-03 18:31 - 2018-10-03 18:31 - 000000000 ____D C:\Program Files\Intel Desktop Board
      2018-10-03 18:30 - 2018-10-07 09:22 - 000069800 _____ C:\Documents and Settings\Administrator\Local Settings\Application Data\GDIPFONTCACHEV1.DAT
      2018-10-03 18:30 - 2018-10-03 18:30 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\DriverDR.com
      2018-10-03 14:32 - 2018-10-03 14:22 - 000000804 _____ C:\Documents and Settings\Administrator\Desktop\Windows Media Player.lnk
      2018-10-03 14:29 - 2018-10-03 14:29 - 000001487 _____ C:\Documents and Settings\All Users\Desktop\ICQ6.5.lnk
      2018-10-03 14:29 - 2018-10-03 14:29 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\ICQ6.5
      2018-10-03 14:28 - 2018-10-08 09:25 - 000000000 ____D C:\Documents and Settings\All Users\Application Data\ICQ
      2018-10-03 14:28 - 2018-10-03 14:49 - 000000000 ____D C:\Program Files\ICQ6.5
      2018-10-03 14:28 - 2018-10-03 14:28 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\ICQ
      2018-10-03 14:27 - 2018-10-03 14:27 - 000000000 ____D C:\Program Files\SpeedFan
      2018-10-03 14:27 - 2018-10-03 14:27 - 000000000 ____D C:\Documents and Settings\Administrator\Start Menu\Programs\SpeedFan
      2018-10-03 14:21 - 2018-10-03 14:22 - 000000000 ____D C:\WINDOWS\RegisteredPackages
      2018-10-03 14:19 - 2018-10-06 14:49 - 000000116 _____ C:\WINDOWS\NeroDigital.ini
      2018-10-03 14:19 - 2018-10-03 14:19 - 000000000 ____D C:\Documents and Settings\All Users\Application Data\CyberLink
      2018-10-03 14:19 - 2018-10-03 14:19 - 000000000 ____D C:\Documents and Settings\Administrator\My Documents\CyberLink
      2018-10-03 14:19 - 2018-10-03 14:19 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\CyberLink
      2018-10-03 14:17 - 2018-10-05 09:02 - 000000000 ____D C:\Program Files\Ahead
      2018-10-03 14:16 - 2018-10-03 14:16 - 000001684 _____ C:\Documents and Settings\All Users\Desktop\CyberLink PowerDVD.lnk
      2018-10-03 14:16 - 2018-10-03 14:16 - 000000000 ____D C:\Program Files\CyberLink
      2018-10-03 14:16 - 2018-10-03 14:16 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\CyberLink PowerDVD
      2018-10-03 14:14 - 2018-10-03 14:14 - 000000857 _____ C:\Documents and Settings\All Users\Desktop\Wise Disk Cleaner.lnk
      2018-10-03 14:14 - 2018-10-03 14:14 - 000000000 ____D C:\Program Files\Wise
      2018-10-03 14:14 - 2018-10-03 14:14 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\Wise Disk Cleaner
      2018-10-03 14:13 - 2018-10-04 12:30 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\YoWindow
      2018-10-03 14:12 - 2018-10-03 14:12 - 000000755 _____ C:\Documents and Settings\All Users\Desktop\Billiards.lnk
      2018-10-03 14:12 - 2018-10-03 14:12 - 000000000 ____D C:\Program Files\IrfanView
      2018-10-03 14:12 - 2018-10-03 14:12 - 000000000 ____D C:\Program Files\ePlaybus.com
      2018-10-03 14:12 - 2018-10-03 14:12 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\ePlaybus.com
      2018-10-03 14:12 - 2018-10-03 14:12 - 000000000 ____D C:\Documents and Settings\Administrator\Start Menu\Programs\IrfanView
      2018-10-03 14:11 - 2018-10-03 14:11 - 000000000 ____D C:\Program Files\ESET
      2018-10-03 14:10 - 2018-10-06 14:26 - 000000000 ____D C:\WINDOWS\Datecs
      2018-10-03 14:10 - 2018-10-03 14:10 - 000000000 ____D C:\Documents and Settings\Administrator\Start Menu\Programs\Datecs Applications
      2018-10-03 14:10 - 2000-06-08 17:00 - 000000398 _____ C:\WINDOWS\system32\kbdus.kbd
      2018-10-03 14:10 - 1997-01-06 11:35 - 000005120 _____ (Datecs Ltd. ) C:\WINDOWS\system32\vga856.fon
      2018-10-03 14:09 - 2018-10-03 14:09 - 000001487 _____ C:\Documents and Settings\Administrator\Desktop\Windows Explorer (2).lnk
      2018-10-03 14:07 - 2018-10-03 13:19 - 000000856 _____ C:\Documents and Settings\Administrator\Start Menu\Programs\Copy of Shortcut to chrome.lnk
      2018-10-03 13:19 - 2018-10-03 13:19 - 000000856 _____ C:\Documents and Settings\Administrator\Desktop\Google chrome.lnk
      2018-10-03 11:52 - 2013-08-09 00:55 - 000032384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\usbccgp.sys
      2018-10-03 11:52 - 2013-08-09 00:55 - 000032384 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\usbccgp.sys
      2018-10-03 11:52 - 2008-04-14 03:41 - 000021504 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\hidserv.dll
      2018-10-03 11:52 - 2008-04-14 03:41 - 000021504 _____ (Microsoft Corporation) C:\WINDOWS\system32\hidserv.dll
      2018-10-03 11:52 - 2008-04-13 22:15 - 000010368 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\hidusb.sys
      2018-10-03 11:52 - 2008-04-13 22:15 - 000010368 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\hidusb.sys
      2018-10-03 11:52 - 2008-04-13 22:09 - 000014592 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdhid.sys
      2018-10-03 11:52 - 2008-04-13 22:09 - 000014592 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\kbdhid.sys
      2018-10-03 11:52 - 2001-08-17 11:48 - 000012160 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mouhid.sys
      2018-10-03 11:52 - 2001-08-17 11:48 - 000012160 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\mouhid.sys
      2018-10-02 08:49 - 2018-10-02 08:49 - 000000000 ____D C:\Documents and Settings\Administrator\Local Settings\Application Data\Adobe
      2018-10-02 08:45 - 2018-10-02 08:45 - 000000376 _____ C:\WINDOWS\ODBC.INI
      2018-10-02 08:45 - 2003-06-18 17:31 - 000017920 _____ (Microsoft Corporation) C:\WINDOWS\system32\mdimon.dll
      2018-10-02 08:44 - 2018-10-04 14:03 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\Microsoft Office
      2018-10-02 08:44 - 2018-10-02 08:44 - 000002002 _____ C:\Documents and Settings\All Users\Start Menu\Open Office Document.lnk
      2018-10-02 08:44 - 2018-10-02 08:44 - 000001992 _____ C:\Documents and Settings\All Users\Start Menu\New Office Document.lnk
      2018-10-02 08:44 - 2018-10-02 08:44 - 000000000 ____D C:\Program Files\Microsoft Works
      2018-10-02 08:44 - 2018-10-02 08:44 - 000000000 ____D C:\Program Files\Microsoft Visual Studio
      2018-10-02 08:44 - 2018-10-02 08:44 - 000000000 ____D C:\Program Files\Microsoft ActiveSync
      2018-10-02 08:44 - 2018-10-02 08:44 - 000000000 ____D C:\Program Files\Common Files\L&H
      2018-10-02 08:44 - 2018-10-02 08:44 - 000000000 ____D C:\Program Files\Common Files\DESIGNER
      2018-10-02 08:43 - 2018-10-05 08:52 - 000000000 ____D C:\Program Files\Microsoft Office
      2018-10-02 08:43 - 2018-10-02 08:44 - 000000000 ____D C:\WINDOWS\SHELLNEW
      2018-10-02 08:42 - 2018-10-02 08:42 - 000000000 __RHD C:\MSOCache
      2018-10-02 08:40 - 2018-10-04 08:45 - 000000000 ___HD C:\Program Files\InstallShield Installation Information
      2018-10-02 08:40 - 2018-10-02 08:40 - 000000129 _____ C:\Documents and Settings\All Users\Desktop\SAMSUNG Dr.Printer.url
      2018-10-02 08:40 - 2018-10-02 08:40 - 000000000 ____D C:\Program Files\Samsung ML-2010 Series
      2018-10-02 08:40 - 2018-10-02 08:40 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\Samsung ML-2010 Series
      2018-10-02 08:40 - 2005-04-08 05:29 - 000020622 _____ (Samsung Electronics.) C:\WINDOWS\system32\SUGS2LMK.DLL
      2018-10-02 08:40 - 2005-03-03 14:23 - 000000604 _____ C:\WINDOWS\system32\SUGS2LMK.SMT
      2018-10-02 08:40 - 2005-03-03 13:09 - 000057344 _____ (SEC) C:\WINDOWS\system32\SSCoInst.dll
      2018-10-02 08:40 - 2005-03-03 07:32 - 000151552 _____ (Samsung Electronics Co., Ltd.) C:\WINDOWS\system32\SSCoInst.exe
      2018-10-02 08:39 - 2018-10-02 08:40 - 000000000 ____D C:\WINDOWS\Samsung
      2018-10-02 08:39 - 2005-03-14 08:01 - 000208896 ____N (Samsung Electronics Co., Ltd.) C:\WINDOWS\system32\SSRemove.exe
      2018-10-02 08:39 - 2005-03-14 08:01 - 000041984 ____N (DeviceGuys, Inc.) C:\WINDOWS\system32\Drivers\DGIVECP.SYS
      2018-10-02 08:37 - 2018-10-02 08:37 - 000000000 ____D C:\Documents and Settings\Administrator\Local Settings\Application Data\Help
      2018-10-02 08:37 - 2018-10-02 08:37 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\Help
      2018-10-01 15:58 - 2018-10-01 15:58 - 000000000 _____ C:\WINDOWS\system32\h323log.txt
      2018-10-01 15:56 - 2001-08-17 14:59 - 000003072 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\audstub.sys
      2018-10-01 15:55 - 2008-04-14 06:42 - 000074240 _____ (Microsoft Corporation) C:\WINDOWS\system32\usbui.dll
      2018-10-01 15:55 - 2008-04-14 01:10 - 000057600 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\redbook.sys
      2018-10-01 15:55 - 2001-08-17 14:28 - 000907456 _____ (Conexant) C:\WINDOWS\system32\Drivers\HCF_MSFT.sys
      2018-10-01 15:53 - 2018-10-05 08:52 - 000000000 ____D C:\Program Files\Common Files\Microsoft Shared
      2018-10-01 15:53 - 2018-10-05 08:36 - 000506702 _____ C:\WINDOWS\system32\PerfStringBackup.INI
      2018-10-01 15:53 - 2018-10-01 15:53 - 000004444 _____ C:\WINDOWS\system32\pid.PNF
      2018-10-01 15:53 - 2018-10-01 15:53 - 000000000 ____D C:\Program Files\Common Files\SpeechEngines
      2018-10-01 15:53 - 2018-10-01 15:53 - 000000000 ____D C:\Program Files\Common Files\ODBC
      2018-10-01 15:53 - 2018-10-01 13:10 - 000004512 _____ C:\WINDOWS\imsins.BAK
      2018-10-01 15:53 - 2018-10-01 13:06 - 000004161 _____ C:\WINDOWS\ODBCINST.INI
      2018-10-01 15:53 - 2014-02-12 16:56 - 000069120 _____ (Microsoft Corporation) C:\WINDOWS\NOTEPAD.EXE
      2018-10-01 15:53 - 2008-04-14 14:00 - 001685606 ____C C:\WINDOWS\system32\dllcache\sam.spd
      2018-10-01 15:53 - 2008-04-14 14:00 - 000774144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\spttseng.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000741376 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sapi.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000643717 ____C C:\WINDOWS\system32\dllcache\ltts1033.lxa
      2018-10-01 15:53 - 2008-04-14 14:00 - 000605050 ____C C:\WINDOWS\system32\dllcache\r1033tts.lxa
      2018-10-01 15:53 - 2008-04-14 14:00 - 000176157 ____C (Digi International, Inc.) C:\WINDOWS\system32\dllcache\dgrpsetu.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000176157 _____ (Digi International, Inc.) C:\WINDOWS\system32\dgrpsetu.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000155648 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sapi.cpl
      2018-10-01 15:53 - 2008-04-14 14:00 - 000146432 _____ (Microsoft Corporation) C:\WINDOWS\system\WINSPOOL.DRV
      2018-10-01 15:53 - 2008-04-14 14:00 - 000126912 _____ (Microsoft Corporation) C:\WINDOWS\system\MSVIDEO.DLL
      2018-10-01 15:53 - 2008-04-14 14:00 - 000109456 _____ (Microsoft Corporation) C:\WINDOWS\system\AVIFILE.DLL
      2018-10-01 15:53 - 2008-04-14 14:00 - 000103424 ____C (Equinox Systems Inc.) C:\WINDOWS\system32\dllcache\eqnclass.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000103424 _____ (Equinox Systems Inc.) C:\WINDOWS\system32\EqnClass.Dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000085020 ____C (Digi International) C:\WINDOWS\system32\dllcache\dgsetup.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000085020 _____ (Digi International) C:\WINDOWS\system32\dgsetup.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000082944 _____ (Microsoft Corporation) C:\WINDOWS\system\OLECLI.DLL
      2018-10-01 15:53 - 2008-04-14 14:00 - 000077824 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\spcommon.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000073376 _____ (Microsoft Corporation) C:\WINDOWS\system\MCIAVI.DRV
      2018-10-01 15:53 - 2008-04-14 14:00 - 000069584 _____ (Microsoft Corporation) C:\WINDOWS\system\AVICAP.DLL
      2018-10-01 15:53 - 2008-04-14 14:00 - 000068768 _____ (Microsoft Corporation) C:\WINDOWS\system\MMSYSTEM.DLL
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066594 ____C C:\WINDOWS\system32\dllcache\c_869.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066594 ____C C:\WINDOWS\system32\dllcache\c_866.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066594 ____C C:\WINDOWS\system32\dllcache\c_857.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066594 ____C C:\WINDOWS\system32\dllcache\c_855.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066594 ____C C:\WINDOWS\system32\dllcache\c_852.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066594 ____C C:\WINDOWS\system32\dllcache\c_737.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066594 _____ C:\WINDOWS\system32\c_869.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066594 _____ C:\WINDOWS\system32\c_866.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066594 _____ C:\WINDOWS\system32\c_857.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066594 _____ C:\WINDOWS\system32\c_855.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066594 _____ C:\WINDOWS\system32\c_852.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066594 _____ C:\WINDOWS\system32\c_737.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_875.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_28603.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_28599.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_28597.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_28595.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_28594.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20127.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_10082.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_10081.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_10029.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_10017.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_10010.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_10007.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_10006.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\c_875.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\c_28603.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\c_28599.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\C_28597.NLS
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\C_28595.NLS
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\C_28594.NLS
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\c_20127.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\c_10082.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\c_10081.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\c_10029.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\c_10017.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\c_10010.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\c_10007.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000066082 _____ C:\WINDOWS\system32\c_10006.nls
      2018-10-01 15:53 - 2008-04-14 14:00 - 000061440 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\spcplui.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000036864 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sapisvr.exe
      2018-10-01 15:53 - 2008-04-14 14:00 - 000036656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\dosapp.fon
      2018-10-01 15:53 - 2008-04-14 14:00 - 000032816 _____ (Microsoft Corporation) C:\WINDOWS\system\COMMDLG.DLL
      2018-10-01 15:53 - 2008-04-14 14:00 - 000028160 _____ (Microsoft Corporation) C:\WINDOWS\system\MCIWAVE.DRV
      2018-10-01 15:53 - 2008-04-14 14:00 - 000025264 _____ (Microsoft Corporation) C:\WINDOWS\system\MCISEQ.DRV
      2018-10-01 15:53 - 2008-04-14 14:00 - 000024661 ____C (Perle Systems Ltd.) C:\WINDOWS\system32\dllcache\spxcoins.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000024661 _____ (Perle Systems Ltd.) C:\WINDOWS\system32\spxcoins.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000024064 _____ (Microsoft Corporation) C:\WINDOWS\system\OLESVR.DLL
      2018-10-01 15:53 - 2008-04-14 14:00 - 000022016 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\agt0408.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000019968 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\agt040e.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000019456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\agt041f.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000019456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\agt0419.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000019456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\agt0415.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000019456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\agt0405.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000019200 _____ (Microsoft Corporation) C:\WINDOWS\system\TAPI.DLL
      2018-10-01 15:53 - 2008-04-14 14:00 - 000015360 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\taskman.exe
      2018-10-01 15:53 - 2008-04-14 14:00 - 000015360 _____ (Microsoft Corporation) C:\WINDOWS\TASKMAN.EXE
      2018-10-01 15:53 - 2008-04-14 14:00 - 000013600 _____ (Microsoft Corporation) C:\WINDOWS\system\WFWNET.DRV
      2018-10-01 15:53 - 2008-04-14 14:00 - 000013312 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\irclass.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000013312 _____ (Microsoft Corporation) C:\WINDOWS\system32\irclass.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000011264 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\irenum.sys
      2018-10-01 15:53 - 2008-04-14 14:00 - 000011264 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\irenum.sys
      2018-10-01 15:53 - 2008-04-14 14:00 - 000009936 _____ (Microsoft Corporation) C:\WINDOWS\system\LZEXPAND.DLL
      2018-10-01 15:53 - 2008-04-14 14:00 - 000009008 _____ (Microsoft Corporation) C:\WINDOWS\system\VER.DLL
      2018-10-01 15:53 - 2008-04-14 14:00 - 000008704 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\batt.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000008704 _____ (Microsoft Corporation) C:\WINDOWS\system32\batt.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000008192 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdhept.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000008192 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdhept.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000007168 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdcz.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000007168 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdcz.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdycl.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdsl1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdsl.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdpl.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdhu.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdhela3.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdcz2.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdcz1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdcr.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____N (Microsoft Corporation) C:\WINDOWS\system32\KBDAL.DLL
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdycl.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdsl1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdsl.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdpl.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdhu.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdhela3.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdcz2.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdcz1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdcr.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdal.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdtuq.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdtuf.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdlv1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdlv.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdhela2.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdgkl.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdest.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdtuq.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdtuf.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdlv1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdlv.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdhela2.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdgkl.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdest.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____R (Microsoft Corporation) C:\WINDOWS\system32\kbdmon.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____R (Microsoft Corporation) C:\WINDOWS\system32\kbdkyr.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdycc.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbduzb.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdur.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdtat.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdru1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdru.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdro.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdpl1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdlt1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdlt.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdkaz.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdhu1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdhe319.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdhe220.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdhe.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdbu.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdblr.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdazel.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdaze.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdycc.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbduzb.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdur.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdtat.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdru1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdru.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdro.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdpl1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdmon.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdlt1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdlt.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdkyr.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdkaz.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdhu1.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdhe319.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdhe220.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdhe.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdbu.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdblr.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdazel.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdaze.dll
      2018-10-01 15:53 - 2008-04-14 14:00 - 000005120 _____ (Microsoft Corporation) C:\WINDOWS\system\SHELL.DLL
      2018-10-01 15:53 - 2008-04-14 14:00 - 000004048 _____ (Microsoft Corporation) C:\WINDOWS\system\TIMER.DRV
      2018-10-01 15:53 - 2008-04-14 14:00 - 000003360 _____ (Microsoft Corporation) C:\WINDOWS\system\SYSTEM.DRV
      2018-10-01 15:53 - 2008-04-14 14:00 - 000002577 ____N C:\WINDOWS\system32\CONFIG.TMP
      2018-10-01 15:53 - 2008-04-14 14:00 - 000002176 _____ (Microsoft Corporation) C:\WINDOWS\system\VGA.DRV
      2018-10-01 15:53 - 2008-04-14 14:00 - 000002032 _____ (Microsoft Corporation) C:\WINDOWS\system\MOUSE.DRV
      2018-10-01 15:53 - 2008-04-14 14:00 - 000002000 _____ (Microsoft Corporation) C:\WINDOWS\system\KEYBOARD.DRV
      2018-10-01 15:53 - 2008-04-14 14:00 - 000001744 _____ (Microsoft Corporation) C:\WINDOWS\system\SOUND.DRV
      2018-10-01 15:53 - 2008-04-14 14:00 - 000001688 _____ C:\WINDOWS\system32\AUTOEXEC.NT
      2018-10-01 15:53 - 2008-04-14 14:00 - 000001152 _____ (Microsoft Corporation) C:\WINDOWS\system\MMTASK.TSK
      2018-10-01 15:53 - 2008-04-14 14:00 - 000000888 ____C C:\WINDOWS\system32\dllcache\sam.sdf
      2018-10-01 15:53 - 2008-04-14 06:42 - 000074752 _____ (Microsoft Corporation) C:\WINDOWS\system32\storprop.dll
      2018-10-01 15:52 - 2018-10-01 15:52 - 000000000 ____D C:\Documents and Settings\Default User\Local Settings\Temp
      2018-10-01 15:52 - 2018-10-01 13:11 - 000733603 _____ C:\WINDOWS\setuplog.txt
      2018-10-01 15:52 - 2009-01-09 21:19 - 001089593 ____C C:\WINDOWS\system32\dllcache\NTPRINT.CAT
      2018-10-01 15:52 - 2008-04-14 14:00 - 002144487 ____C C:\WINDOWS\system32\dllcache\NT5.CAT
      2018-10-01 15:52 - 2008-04-14 14:00 - 001296669 ____C C:\WINDOWS\system32\dllcache\SP3.CAT
      2018-10-01 15:52 - 2008-04-14 14:00 - 000797189 ____C C:\WINDOWS\system32\dllcache\NT5IIS.CAT
      2018-10-01 15:52 - 2008-04-14 14:00 - 000522220 ____C C:\WINDOWS\system32\dllcache\NT5INF.CAT
      2018-10-01 15:52 - 2008-04-14 14:00 - 000399645 ____C C:\WINDOWS\system32\dllcache\MAPIMIG.CAT
      2018-10-01 15:52 - 2008-04-14 14:00 - 000144484 ____C C:\WINDOWS\system32\dllcache\netfx.cat
      2018-10-01 15:52 - 2008-04-14 14:00 - 000112918 ____C C:\WINDOWS\system32\dllcache\tabletpc.cat
      2018-10-01 15:52 - 2008-04-14 14:00 - 000037484 ____C C:\WINDOWS\system32\dllcache\MW770.CAT
      2018-10-01 15:52 - 2008-04-14 14:00 - 000034747 ____C C:\WINDOWS\system32\dllcache\mediactr.cat
      2018-10-01 15:52 - 2008-04-14 14:00 - 000034063 ____C C:\WINDOWS\system32\dllcache\FP4.CAT
      2018-10-01 15:52 - 2008-04-14 14:00 - 000016535 ____C C:\WINDOWS\system32\dllcache\IMS.CAT
      2018-10-01 15:52 - 2008-04-14 14:00 - 000013472 ____C C:\WINDOWS\system32\dllcache\HPCRDP.CAT
      2018-10-01 15:52 - 2008-04-14 14:00 - 000010027 ____C C:\WINDOWS\system32\dllcache\MSTSWEB.CAT
      2018-10-01 15:52 - 2008-04-14 14:00 - 000008574 ____C C:\WINDOWS\system32\dllcache\IASNT4.CAT
      2018-10-01 15:52 - 2008-04-14 14:00 - 000007382 ____C C:\WINDOWS\system32\dllcache\OEMBIOS.CAT
      2018-10-01 15:52 - 2008-04-14 14:00 - 000007334 ____C C:\WINDOWS\system32\dllcache\wmerrenu.cat
      2018-10-01 15:51 - 2018-10-09 08:47 - 000000211 ___SH C:\boot.ini
      2018-10-01 15:51 - 2018-10-06 14:27 - 000272576 _____ C:\WINDOWS\system32\FNTCACHE.DAT
      2018-10-01 15:51 - 2018-10-03 14:17 - 000000000 ___HD C:\Documents and Settings\Default User
      2018-10-01 15:51 - 2018-10-01 15:51 - 001138688 _____ C:\WINDOWS\system32\config\software.sav
      2018-10-01 15:51 - 2018-10-01 15:51 - 000913408 _____ C:\WINDOWS\system32\config\system.sav
      2018-10-01 15:51 - 2018-10-01 15:51 - 000094208 _____ C:\WINDOWS\system32\config\default.sav
      2018-10-01 15:51 - 2018-10-01 13:12 - 000000000 ____D C:\Documents and Settings
      2018-10-01 15:51 - 2018-10-01 13:05 - 000000000 ____D C:\Documents and Settings\All Users
      2018-10-01 15:50 - 2018-10-01 15:51 - 000262144 _____ C:\WINDOWS\system32\config\userdiff
      2018-10-01 15:43 - 2018-10-09 08:43 - 000000000 ___HD C:\WINDOWS\inf
      2018-10-01 15:43 - 2018-10-08 09:27 - 000000000 ____D C:\WINDOWS\Driver Cache
      2018-10-01 15:43 - 2018-10-06 14:26 - 000000000 RSHDC C:\WINDOWS\system32\dllcache
      2018-10-01 15:43 - 2018-10-05 08:55 - 000000000 ____D C:\WINDOWS\system32\Macromed
      2018-10-01 15:43 - 2018-10-05 08:34 - 000000000 ____D C:\WINDOWS\system32\spool
      2018-10-01 15:43 - 2018-10-04 08:42 - 000000000 ____D C:\WINDOWS\Media
      2018-10-01 15:43 - 2018-10-03 18:34 - 000000000 ____D C:\WINDOWS\system
      2018-10-01 15:43 - 2018-10-03 14:21 - 000000000 ____D C:\WINDOWS\security
      2018-10-01 15:43 - 2018-10-03 14:21 - 000000000 ____D C:\WINDOWS\Help
      2018-10-01 15:43 - 2018-10-02 08:43 - 000000000 ____D C:\WINDOWS\pchealth
      2018-10-01 15:43 - 2018-10-01 15:51 - 000000000 ____D C:\WINDOWS\system32\usmt
      2018-10-01 15:43 - 2018-10-01 15:51 - 000000000 ____D C:\WINDOWS\system32\scripting
      2018-10-01 15:43 - 2018-10-01 15:51 - 000000000 ____D C:\WINDOWS\Network Diagnostic
      2018-10-01 15:43 - 2018-10-01 15:51 - 000000000 ____D C:\WINDOWS\L2Schemas
      2018-10-01 15:43 - 2018-10-01 15:50 - 000000000 ___SD C:\WINDOWS\Offline Web Pages
      2018-10-01 15:43 - 2018-10-01 15:50 - 000000000 ___SD C:\WINDOWS\Downloaded Program Files
      2018-10-01 15:43 - 2018-10-01 15:49 - 000000000 ____D C:\WINDOWS\system32\Setup
      2018-10-01 15:43 - 2018-10-01 15:49 - 000000000 ____D C:\WINDOWS\system32\npp
      2018-10-01 15:43 - 2018-10-01 15:49 - 000000000 ____D C:\WINDOWS\PeerNet
      2018-10-01 15:43 - 2018-10-01 15:49 - 000000000 ____D C:\WINDOWS\mui
      2018-10-01 15:43 - 2018-10-01 15:49 - 000000000 ____D C:\WINDOWS\msagent
      2018-10-01 15:43 - 2018-10-01 15:46 - 000000000 ____D C:\WINDOWS\system32\ras
      2018-10-01 15:43 - 2018-10-01 15:45 - 000000000 ____D C:\WINDOWS\system32\icsxml
      2018-10-01 15:43 - 2018-10-01 15:44 - 000000000 ____D C:\WINDOWS\system32\1033
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\wins
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\ShellExt
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\PreInstall
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\mui
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\inetsrv
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\IME
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\export
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\Drivers\disdn
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\dhcp
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\3com_dmi
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\3076
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\2052
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\1054
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\1042
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\1041
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\1037
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\1031
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\1028
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\system32\1025
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\Resources
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\Provisioning
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\msapps
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\java
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\Connection Wizard
      2018-10-01 15:43 - 2018-10-01 15:43 - 000000000 ____D C:\WINDOWS\addins
      2018-10-01 15:43 - 2018-10-01 13:06 - 000000000 ____D C:\WINDOWS\repair
      2018-10-01 15:43 - 2018-10-01 13:06 - 000000000 ____D C:\WINDOWS\ime
      2018-10-01 15:43 - 2018-10-01 13:05 - 000000000 ___RD C:\WINDOWS\Web
      2018-10-01 15:43 - 2018-10-01 13:05 - 000000000 ____D C:\WINDOWS\system32\ias
      2018-10-01 15:43 - 2018-10-01 13:03 - 000000000 ____D C:\WINDOWS\system32\oobe
      2018-10-01 15:43 - 2018-10-01 13:00 - 000000000 ____D C:\WINDOWS\Cursors
      2018-10-01 13:56 - 2018-10-02 08:49 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\Adobe
      2018-10-01 13:56 - 2018-10-01 13:56 - 000001804 _____ C:\Documents and Settings\All Users\Start Menu\Programs\Adobe Reader 9.lnk
      2018-10-01 13:56 - 2018-10-01 13:56 - 000001729 _____ C:\Documents and Settings\All Users\Desktop\Adobe Reader 9.lnk
      2018-10-01 13:56 - 2018-10-01 13:56 - 000000000 ____D C:\Documents and Settings\All Users\Application Data\Adobe
      2018-10-01 13:56 - 2018-10-01 13:56 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\Macromedia
      2018-10-01 13:55 - 2018-10-01 13:56 - 000000000 ____D C:\Program Files\Common Files\Adobe
      2018-10-01 13:55 - 2018-10-01 13:55 - 000000694 _____ C:\Documents and Settings\Administrator\Desktop\BitComet.lnk
      2018-10-01 13:55 - 2018-10-01 13:55 - 000000000 ____D C:\Program Files\BitComet
      2018-10-01 13:55 - 2018-10-01 13:55 - 000000000 ____D C:\Program Files\Adobe
      2018-10-01 13:55 - 2018-10-01 13:55 - 000000000 ____D C:\Documents and Settings\Administrator\Start Menu\Programs\BitComet
      2018-10-01 13:55 - 2018-10-01 13:55 - 000000000 _____ C:\WINDOWS\PROTOCOL.INI
      2018-10-01 13:54 - 2018-10-01 13:54 - 000000776 _____ C:\Documents and Settings\All Users\Start Menu\Programs\SA Dictionary.lnk
      2018-10-01 13:54 - 2018-10-01 13:54 - 000000770 _____ C:\Documents and Settings\All Users\Desktop\SA Dictionary.lnk
      2018-10-01 13:54 - 2018-10-01 13:54 - 000000000 ____D C:\Program Files\SA Dictionary 2004 Datacenter
      2018-10-01 13:54 - 1999-03-23 09:12 - 000299520 _____ (InstallShield Corporation, Inc.) C:\WINDOWS\uninst.exe
      2018-10-01 13:53 - 2018-10-03 14:11 - 000000000 ____D C:\Program Files\CPUID
      2018-10-01 13:53 - 2018-10-03 14:11 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\CPUID
      2018-10-01 13:53 - 2018-10-01 13:53 - 000000000 ____D C:\Documents and Settings\Administrator\WINDOWS
      2018-10-01 13:52 - 2018-10-01 13:52 - 000000000 ____D C:\Program Files\WinRAR
      2018-10-01 13:52 - 2018-10-01 13:52 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\WinRAR
      2018-10-01 13:52 - 2018-10-01 13:52 - 000000000 ____D C:\Documents and Settings\Administrator\Start Menu\Programs\WinRAR
      2018-10-01 13:50 - 2018-10-01 13:50 - 000000000 ____D C:\Program Files\Datecs
      2018-10-01 13:50 - 2002-04-23 00:17 - 000045056 _____ C:\WINDOWS\system32\newdll.dll
      2018-10-01 13:50 - 2000-11-17 08:47 - 000008992 _____ (Microsoft Corporation) C:\WINDOWS\system32\kbdbphz.dLL
      2018-10-01 13:50 - 2000-11-15 01:52 - 000006416 _____ (Microsoft Corporation) C:\WINDOWS\system32\kbdbds.Dll
      2018-10-01 13:50 - 1999-12-07 09:00 - 000006416 _____ (Microsoft Corporation) C:\WINDOWS\system32\kbdbp.Dll
      2018-10-01 13:50 - 1999-11-18 05:04 - 000007440 _____ (Microsoft Corporation) C:\WINDOWS\system32\Kbddll.dll
      2018-10-01 13:50 - 1999-11-11 13:47 - 000006928 _____ (Microsoft Corporation) C:\WINDOWS\system32\kbdhebx.Dll
      2018-10-01 13:50 - 1999-11-11 13:47 - 000006416 _____ (Microsoft Corporation) C:\WINDOWS\system32\kbdinori.Dll
      2018-10-01 13:50 - 1999-11-11 13:47 - 000006416 _____ (Microsoft Corporation) C:\WINDOWS\system32\kbdinasa.Dll
      2018-10-01 13:50 - 1997-04-03 21:00 - 000066594 _____ C:\WINDOWS\system32\C_856.nls
      2018-10-01 13:50 - 1997-04-03 21:00 - 000008992 _____ (Microsoft Corporation) C:\WINDOWS\system32\KBDBPH.dLL
      2018-10-01 13:41 - 2018-10-09 12:42 - 000088566 _____ C:\WINDOWS\system32\nvapps.xml
      2018-10-01 13:41 - 2018-10-01 13:43 - 000000000 ____D C:\WINDOWS\nview
      2018-10-01 13:41 - 2006-10-22 15:06 - 000208896 _____ (NVIDIA Corporation) C:\WINDOWS\system32\NVUNINST.EXE
      2018-10-01 13:41 - 2006-10-22 12:22 - 000208896 _____ (NVIDIA Corporation) C:\WINDOWS\system32\nvudisp.exe
      2018-10-01 13:41 - 2006-10-22 12:22 - 000017056 _____ C:\WINDOWS\system32\nvdisp.nvu
      2018-10-01 13:40 - 2018-10-01 13:40 - 000000000 ____D C:\NVIDIA
      2018-10-01 13:39 - 2018-10-01 13:39 - 000000000 ____D C:\WINDOWS\pss
      2018-10-01 13:38 - 2015-08-16 17:29 - 042567136 _____ (NVIDIA Corporation ) C:\Documents and Settings\Administrator\Desktop\93.71_forceware_winxp2k_english_whql.exe
      2018-10-01 13:37 - 2018-10-04 13:35 - 000000000 ____D C:\Program Files\Mozilla Maintenance Service
      2018-10-01 13:37 - 2018-10-04 12:40 - 000000000 ____D C:\Program Files\Mozilla Firefox
      2018-10-01 13:37 - 2018-10-01 13:37 - 000000730 _____ C:\Documents and Settings\All Users\Start Menu\Programs\Mozilla Firefox.lnk
      2018-10-01 13:37 - 2018-10-01 13:37 - 000000724 _____ C:\Documents and Settings\All Users\Desktop\Mozilla Firefox.lnk
      2018-10-01 13:37 - 2018-10-01 13:37 - 000000000 ____D C:\Documents and Settings\Administrator\Local Settings\Application Data\Mozilla
      2018-10-01 13:37 - 2018-10-01 13:37 - 000000000 ____D C:\Documents and Settings\Administrator\Application Data\Mozilla
      2018-10-01 13:35 - 2018-10-01 13:35 - 000000000 ____D C:\Program Files\Chrome
      2018-10-01 13:35 - 2018-10-01 13:35 - 000000000 ____D C:\Documents and Settings\Administrator\Local Settings\Application Data\Google
      2018-10-01 13:34 - 2008-04-13 22:15 - 000026368 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\usbstor.sys
      2018-10-01 13:34 - 2008-04-13 22:15 - 000026368 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\USBSTOR.SYS
      2018-10-01 13:33 - 2018-10-07 09:14 - 000006144 _____ C:\Documents and Settings\Administrator\Local Settings\Application Data\DCBC2A71-70D8-4DAN-EHR8-E0D61DEA3FDF.ini
      2018-10-01 13:19 - 2018-10-01 13:19 - 000000000 __SHD C:\Documents and Settings\Administrator\PrivacIE
      2018-10-01 13:14 - 2018-10-03 14:33 - 000000803 _____ C:\Documents and Settings\Administrator\Start Menu\Programs\Internet Explorer.lnk
      2018-10-01 13:14 - 2008-04-14 14:00 - 000026991 ____C C:\WINDOWS\system32\dllcache\msn7.cat
      2018-10-01 13:14 - 2008-04-14 14:00 - 000014433 ____C C:\WINDOWS\system32\dllcache\msn9.cat
      2018-10-01 13:14 - 2008-04-14 14:00 - 000012363 ____C C:\WINDOWS\system32\dllcache\MSMSGS.CAT
      2018-10-01 13:13 - 2018-10-01 13:19 - 000000738 _____ C:\Documents and Settings\Administrator\Start Menu\Programs\Outlook Express.lnk
      2018-10-01 13:12 - 2018-10-09 12:53 - 000000000 ____D C:\Documents and Settings\Administrator\Local Settings\Temp
      2018-10-01 13:12 - 2018-10-09 12:41 - 000000178 ___SH C:\Documents and Settings\Administrator\ntuser.ini
      2018-10-01 13:12 - 2018-10-09 12:41 - 000000000 ____D C:\Documents and Settings\Administrator
      2018-10-01 13:12 - 2018-10-03 14:22 - 000000792 _____ C:\Documents and Settings\Administrator\Start Menu\Programs\Windows Media Player.lnk
      2018-10-01 13:12 - 2018-10-01 13:06 - 000001599 _____ C:\Documents and Settings\Administrator\Start Menu\Programs\Remote Assistance.lnk
      2018-10-01 13:12 - 2018-10-01 13:06 - 000000000 __SHD C:\Documents and Settings\Administrator\IETldCache
      2018-10-01 13:11 - 2018-10-09 12:42 - 000000006 ____H C:\WINDOWS\Tasks\SA.DAT
      2018-10-01 13:11 - 2018-10-09 12:41 - 000017208 _____ C:\WINDOWS\SchedLgU.Txt
      2018-10-01 13:11 - 2018-10-01 13:11 - 000000020 ___SH C:\Documents and Settings\LocalService\ntuser.ini
      2018-10-01 13:11 - 2018-10-01 13:11 - 000000000 __SHD C:\Documents and Settings\LocalService
      2018-10-01 13:11 - 2018-10-01 13:11 - 000000000 ____D C:\Documents and Settings\LocalService\Local Settings\Temp
      2018-10-01 13:11 - 2018-10-01 13:06 - 000000000 __SHD C:\Documents and Settings\LocalService\IETldCache
      2018-10-01 13:10 - 2018-10-01 13:10 - 000008192 _____ C:\WINDOWS\REGLOCS.OLD
      2018-10-01 13:10 - 2018-10-01 13:10 - 000000020 ___SH C:\Documents and Settings\NetworkService\ntuser.ini
      2018-10-01 13:10 - 2018-10-01 13:10 - 000000000 __SHD C:\Documents and Settings\NetworkService
      2018-10-01 13:10 - 2018-10-01 13:10 - 000000000 ____D C:\Documents and Settings\NetworkService\Local Settings\Temp
      2018-10-01 13:10 - 2018-10-01 13:06 - 000000000 __SHD C:\Documents and Settings\NetworkService\IETldCache
      2018-10-01 13:09 - 2014-02-12 16:56 - 000456704 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\smtpsvc.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000571392 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tintlgnt.ime
      2018-10-01 13:09 - 2008-04-14 14:00 - 000455168 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tintsetp.exe
      2018-10-01 13:09 - 2008-04-14 14:00 - 000426041 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\voicepad.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000364032 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\w3svc.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000358400 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\snmpincl.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000259072 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\snmpcl.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000236544 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\smi2smir.exe
      2018-10-01 13:09 - 2008-04-14 14:00 - 000221696 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\seo.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000188416 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\snmpsmir.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000185344 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\thawbrkr.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000156672 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\winzm.ime
      2018-10-01 13:09 - 2008-04-14 14:00 - 000156672 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\winsp.ime
      2018-10-01 13:09 - 2008-04-14 14:00 - 000156672 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\winpy.ime
      2018-10-01 13:09 - 2008-04-14 14:00 - 000143422 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\softkey.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000103424 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\uihelper.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000101376 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\srusbusd.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000086073 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\voicesub.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000079872 ____C (Ricoh Co., Ltd.) C:\WINDOWS\system32\dllcache\rwia330.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000079872 ____C (Ricoh Co., Ltd.) C:\WINDOWS\system32\dllcache\rwia001.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000079360 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\winar30.ime
      2018-10-01 13:09 - 2008-04-14 14:00 - 000076800 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wam51.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000076288 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\uniime.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000073728 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\w3ext.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000072704 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wingb.ime
      2018-10-01 13:09 - 2008-04-14 14:00 - 000065536 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\winime.ime
      2018-10-01 13:09 - 2008-04-14 14:00 - 000065024 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\unicdime.ime
      2018-10-01 13:09 - 2008-04-14 14:00 - 000053248 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wamreg51.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000048256 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\w32.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000046592 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\svcext51.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000046592 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sspifilt.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000045056 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\ssinc51.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000044032 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tintlphr.exe
      2018-10-01 13:09 - 2008-04-14 14:00 - 000041600 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\weitekp9.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000039936 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\snmpthrd.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000038912 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sm9aw.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000033792 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tools.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000033280 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\snmp.exe
      2018-10-01 13:09 - 2008-04-14 14:00 - 000031744 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\smb6w.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000031744 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sma3w.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000031232 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\weitekp9.sys
      2018-10-01 13:09 - 2008-04-14 14:00 - 000030208 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sm87w.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000030208 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sm81w.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000029184 ____C (Ricoh Co., Ltd.) C:\WINDOWS\system32\dllcache\rw330ext.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000029184 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sm8cw.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000028288 ____C C:\WINDOWS\system32\dllcache\xjis.nls
      2018-10-01 13:09 - 2008-04-14 14:00 - 000027648 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rw001ext.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000026624 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sm93w.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000026624 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sm92w.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000026112 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sm90w.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000026112 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sm8dw.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000026112 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sm8aw.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000026112 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sm89w.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000026112 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\romanime.ime
      2018-10-01 13:09 - 2008-04-14 14:00 - 000025088 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sm59w.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000021896 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tdipx.sys
      2018-10-01 13:09 - 2008-04-14 14:00 - 000019464 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tdspx.sys
      2018-10-01 13:09 - 2008-04-14 14:00 - 000018944 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\simptcp.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000016896 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\status.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000015872 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\smierrsm.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000014848 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\register.exe
      2018-10-01 13:09 - 2008-04-14 14:00 - 000014336 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tsprof.exe
      2018-10-01 13:09 - 2008-04-14 14:00 - 000013192 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tdasync.sys
      2018-10-01 13:09 - 2008-04-14 14:00 - 000010752 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\smtpapi.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000010240 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tmigrate.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000010240 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\snmpstup.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000009728 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rwnh.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000009216 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wamps51.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000008704 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\snmptrap.exe
      2018-10-01 13:09 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\snmpmib.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\w3svapi.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\smimsgif.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\smierrsy.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000004608 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\w3ctrs51.dll
      2018-10-01 13:09 - 2008-04-14 14:00 - 000004096 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rpcref.dll
      2018-10-01 13:09 - 2001-08-17 22:36 - 000057856 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\EXCH_scripto.dll
      2018-10-01 13:09 - 2001-08-17 22:36 - 000026112 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\EXCH_seos.dll
      2018-10-01 13:09 - 2001-08-17 22:36 - 000023040 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\EXCH_regtrace.exe
      2018-10-01 13:09 - 2001-08-17 22:36 - 000012288 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\EXCH_smtpctrs.dll
      2018-10-01 13:09 - 2001-08-17 22:36 - 000007168 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\EXCH_snprfdll.dll
      2018-10-01 13:08 - 2014-02-12 16:55 - 000257024 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\infocomm.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 010129408 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\hwxkor.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 001875968 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msir3jp.lex
      2018-10-01 13:08 - 2008-04-14 14:00 - 001158818 ____C C:\WINDOWS\system32\dllcache\korwbrkr.lex
      2018-10-01 13:08 - 2008-04-14 14:00 - 000811064 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imjp81k.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000716856 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imjpcus.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000482304 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\pintlgnt.ime
      2018-10-01 13:08 - 2008-04-14 14:00 - 000471102 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imskdic.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000368696 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imjpcic.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000340023 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imjp81.ime
      2018-10-01 13:08 - 2008-04-14 14:00 - 000315455 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imskf.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000311359 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imepadsv.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000307257 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imjpdct.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000274489 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imjputyc.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000262200 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imjputy.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000233527 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imjprw.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000229439 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\multibox.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000208952 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imjpmig.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000196665 ____C C:\WINDOWS\system32\dllcache\imjpinst.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000175104 ____C C:\WINDOWS\system32\dllcache\pintlcsa.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000155705 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imjpdsvr.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000145408 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iische51.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000134339 ____C C:\WINDOWS\system32\dllcache\imekr.lex
      2018-10-01 13:08 - 2008-04-14 14:00 - 000131584 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\pmxviceo.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000119808 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mtstocom.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000106496 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imekrcic.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000102463 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imepadsm.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000102456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imlang.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000098304 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msir3jp.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000094720 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imekr61.ime
      2018-10-01 13:08 - 2008-04-14 14:00 - 000092416 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mga.sys
      2018-10-01 13:08 - 2008-04-14 14:00 - 000092032 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mga.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000086016 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imekrmbx.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000085504 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\metada51.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000083748 ____C C:\WINDOWS\system32\dllcache\prcp.nls
      2018-10-01 13:08 - 2008-04-14 14:00 - 000083748 ____C C:\WINDOWS\system32\dllcache\prc.nls
      2018-10-01 13:08 - 2008-04-14 14:00 - 000081976 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imjpdct.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000079872 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iislog51.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000079360 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\phon.ime
      2018-10-01 13:08 - 2008-04-14 14:00 - 000077824 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\quick.ime
      2018-10-01 13:08 - 2008-04-14 14:00 - 000070656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\korwbrkr.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000070144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\pintlphr.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000067584 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\pmigrate.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000060928 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iisclex4.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000059904 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imkrinst.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000059392 ____C C:\WINDOWS\system32\dllcache\imscinst.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000057398 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imjpdadm.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000053760 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\pintlcsd.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000053248 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\nextlink.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000047066 ____C C:\WINDOWS\system32\dllcache\ksc.nls
      2018-10-01 13:08 - 2008-04-14 14:00 - 000045109 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imjpuex.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000044544 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\nsepm.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000044032 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\imekrmig.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000040960 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msiregmv.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000037888 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\md5filt.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000036927 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\padrs411.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000035328 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iprip.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000033792 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\lmmib2.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000031744 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\pagecnt.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000026624 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mdsync.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000026624 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iscomlog.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000025088 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iisadmin.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000022528 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\lpdsvc.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000022016 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\logscrpt.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000020992 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\permchk.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000020736 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\ramdisk.sys
      2018-10-01 13:08 - 2008-04-14 14:00 - 000019456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iiscrmap.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000018944 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\lprmon.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000018432 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\jupiw.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\quser.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000015872 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\padrs404.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000015360 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\padrs804.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000015360 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\inetin51.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000014336 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\padrs412.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000013312 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\lonsint.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000011264 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\pmxmcro.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000009728 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\query.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000009216 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdnecat.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000009216 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdnecat.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000009216 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iwrps.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000008704 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\infoctrs.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000007680 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdnecnt.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000007680 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\pwsdata.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000007680 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\migregdb.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000007680 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdnecnt.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000007168 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdnec95.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000007168 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdibm02.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000007168 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdnec95.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000007168 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdibm02.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000007168 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\isapips.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000007168 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iisfecnv.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006656 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdlk41a.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdlk41a.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iissync.exe
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdth3.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdth2.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdlk41j.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdinpun.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdax2.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbd106n.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbd101a.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbd101.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\pmxgl.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdth3.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdth2.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdlk41j.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdinpun.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdax2.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbd106n.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbd101a.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbd101.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdvntc.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdusa.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdth1.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdth0.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdintel.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdintam.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdinmar.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdinkan.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdinhin.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdinguj.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdindev.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdheb.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdfa.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbda3.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbda2.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbda1.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdvntc.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdusa.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdurdu.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdth1.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdth0.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdsyr2.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdsyr1.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdintel.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdintam.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdinmar.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdinkan.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdinhin.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdinguj.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdindev.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdheb.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdfa.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbddiv2.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbddiv1.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbda3.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbda2.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbda1.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005120 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdgeo.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005120 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdarmw.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005120 ____N (Microsoft Corporation) C:\WINDOWS\system32\kbdarme.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005120 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdgeo.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005120 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdarmw.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000005120 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\kbdarme.dll
      2018-10-01 13:08 - 2008-04-14 14:00 - 000003584 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iismui.dll
      2018-10-01 13:08 - 2001-08-17 22:36 - 000065536 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\EXCH_mailmsg.dll
      2018-10-01 13:08 - 2001-08-17 22:36 - 000038912 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\EXCH_ntfsdrv.dll
      2018-10-01 13:07 - 2014-02-12 16:55 - 000369664 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\asp51.dll
      2018-10-01 13:07 - 2014-02-12 16:55 - 000268288 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\httpext.dll
      2018-10-01 13:07 - 2014-02-12 16:55 - 000229888 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxscover.exe
      2018-10-01 13:07 - 2014-02-12 16:55 - 000126464 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\ftpsv251.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 013463552 ____C C:\WINDOWS\system32\dllcache\hwxjpn.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 010096640 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\hwxcht.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 002134528 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\smtpsnap.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 001677824 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\chsbrkr.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000838144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\chtbrkr.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000562176 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxsst.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000514587 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\edb500.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000480256 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cintsetp.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000451584 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxsapi.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000400384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxsxp32.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000397312 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxstiff.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000331264 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\aqueue.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000285184 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxscomex.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000267776 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxssvc.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000246272 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxst30.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000218112 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\c_g18030.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000198656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cintime.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000195618 ____C C:\WINDOWS\system32\dllcache\c_10002.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000192512 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxswzrd.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000189986 ____C C:\WINDOWS\system32\dllcache\c_1361.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000189440 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\smtpadm.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000187938 ____C C:\WINDOWS\system32\dllcache\c_20005.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000186402 ____C C:\WINDOWS\system32\dllcache\c_20001.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000185378 ____C C:\WINDOWS\system32\dllcache\c_20003.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000180770 ____C C:\WINDOWS\system32\dllcache\c_20932.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000180258 ____C C:\WINDOWS\system32\dllcache\c_20004.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000180258 ____C C:\WINDOWS\system32\dllcache\c_20000.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000177698 ____C C:\WINDOWS\system32\dllcache\c_20949.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000177698 ____C C:\WINDOWS\system32\dllcache\c_10003.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000173602 ____C C:\WINDOWS\system32\dllcache\c_20936.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000173602 ____C C:\WINDOWS\system32\dllcache\c_20002.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000173602 ____C C:\WINDOWS\system32\dllcache\c_10008.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000173568 ____C C:\WINDOWS\system32\dllcache\chtskf.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000162850 ____C C:\WINDOWS\system32\dllcache\c_10001.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000154112 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxsui.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000142848 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxsclnt.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000132608 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxsclntr.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000111104 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxscfgwz.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000108827 ____C C:\WINDOWS\system32\dllcache\hanja.lex
      2018-10-01 13:07 - 2008-04-14 14:00 - 000108544 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\appconf.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000101888 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\evntagnt.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000097792 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\chtmbx.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000092160 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\evntwin.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000082172 ____C C:\WINDOWS\system32\dllcache\bopomofo.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000078848 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\dayi.ime
      2018-10-01 13:07 - 2008-04-14 14:00 - 000078336 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\chajei.ime
      2018-10-01 13:07 - 2008-04-14 14:00 - 000072192 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxscom.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066728 ____C C:\WINDOWS\system32\dllcache\big5.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066594 ____C C:\WINDOWS\system32\dllcache\c_864.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066594 ____C C:\WINDOWS\system32\dllcache\c_862.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066594 ____C C:\WINDOWS\system32\dllcache\c_858.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066594 ____C C:\WINDOWS\system32\dllcache\c_720.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_870.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_708.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_28596.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_21027.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_21025.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20924.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20880.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20871.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20838.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20833.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20424.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20423.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20420.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20297.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20290.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20285.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20284.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20280.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20278.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20277.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20273.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20269.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20108.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20107.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20106.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_20105.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_1149.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_1148.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_1147.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_1146.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_1145.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_1144.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_1143.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_1142.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_1141.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_1140.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_1047.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_10021.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_10005.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000066082 ____C C:\WINDOWS\system32\dllcache\c_10004.nls
      2018-10-01 13:07 - 2008-04-14 14:00 - 000061440 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\httpod51.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000057856 ____C (SEIKO EPSON CORP.) C:\WINDOWS\system32\dllcache\esuimgd.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000057399 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cplexe.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000056320 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\convlog.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000056320 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\chtskdic.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000055296 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxsevent.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000054528 ____C (Philips Semiconductors GmbH) C:\WINDOWS\system32\dllcache\cap7146.sys
      2018-10-01 13:07 - 2008-04-14 14:00 - 000049664 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\adrot.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000045568 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\browscap.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000045056 ____C (SEIKO EPSON CORP.) C:\WINDOWS\system32\dllcache\esunid.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000042496 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\davcdata.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000039936 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\hostmib.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000036864 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\hanjadic.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000033792 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\controt.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000032256 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\gzip.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000031744 ____C (SEIKO EPSON CORP.) C:\WINDOWS\system32\dllcache\esucmd.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000031744 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxsroute.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000029696 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\admexs.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000029184 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\asptxn.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000026624 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxsdrv.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000025856 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\et4000.sys
      2018-10-01 13:07 - 2008-04-14 14:00 - 000024064 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\evntcmd.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000024064 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\compfilt.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000023552 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxsmon.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000023552 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxsext32.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000021504 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cintlgnt.ime
      2018-10-01 13:07 - 2008-04-14 14:00 - 000020480 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\counters.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000019456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\agt0804.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000019456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\agt0412.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000019456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\agt0411.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000019456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\agt040d.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000019456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\agt0404.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000019456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\agt0401.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000018944 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cprofile.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000015872 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\chgport.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000014848 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\flattemp.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000014336 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\exstrace.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000014336 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\chgusr.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000013312 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\chglogon.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000011264 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxssend.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000010752 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\c_iscii.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000010240 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\aspperf.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000009728 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\change.exe
      2018-10-01 13:07 - 2008-04-14 14:00 - 000009216 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\authfilt.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000008704 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxsperf.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000008192 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\staxmem.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000008192 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\httpmb51.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000007680 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\ftpctrs2.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000007168 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wamregps.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000007168 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\f3ahvoas.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fxsres.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\c_is2022.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\ftpmib.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\ftlx041e.dll
      2018-10-01 13:07 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\admxprox.dll
      2018-10-01 13:07 - 2003-03-24 16:52 - 000618605 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fp4autl.dll
      2018-10-01 13:07 - 2003-03-24 16:52 - 000094208 ____C C:\WINDOWS\system32\dllcache\fpencode.dll
      2018-10-01 13:07 - 2003-03-24 16:52 - 000032827 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tcptest.exe
      2018-10-01 13:07 - 2003-03-24 16:52 - 000024632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fpadmcgi.exe
      2018-10-01 13:07 - 2003-03-24 16:52 - 000020541 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fpadmdll.dll
      2018-10-01 13:07 - 2003-03-24 16:52 - 000020536 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\shtml.dll
      2018-10-01 13:07 - 2003-03-24 16:52 - 000016437 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\shtml.exe
      2018-10-01 13:07 - 2003-03-24 16:52 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tcptsat.dll
      2018-10-01 13:07 - 2001-08-17 22:36 - 000045056 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\EXCH_aqadmin.dll
      2018-10-01 13:07 - 2001-08-17 22:36 - 000043520 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\EXCH_fcachdll.dll
      2018-10-01 13:07 - 2001-08-17 22:36 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\EXCH_adsiisex.dll
      2018-10-01 13:06 - 2018-10-03 14:31 - 000001607 _____ C:\Documents and Settings\All Users\Start Menu\Set Program Access and Defaults.lnk
      2018-10-01 13:06 - 2018-10-03 14:22 - 000023392 _____ C:\WINDOWS\system32\nscompat.tlb
      2018-10-01 13:06 - 2018-10-03 14:22 - 000016832 _____ C:\WINDOWS\system32\amcompat.tlb
      2018-10-01 13:06 - 2018-10-03 14:21 - 000316640 _____ C:\WINDOWS\WMSysPr9.prx
      2018-10-01 13:06 - 2018-10-01 13:19 - 000001006 _____ C:\WINDOWS\OEWABLog.txt
      2018-10-01 13:06 - 2018-10-01 13:06 - 000002577 _____ C:\WINDOWS\system32\CONFIG.NT
      2018-10-01 13:06 - 2018-10-01 13:06 - 000001599 _____ C:\Documents and Settings\Default User\Start Menu\Programs\Remote Assistance.lnk
      2018-10-01 13:06 - 2018-10-01 13:06 - 000000792 _____ C:\Documents and Settings\Default User\Start Menu\Programs\Windows Media Player.lnk
      2018-10-01 13:06 - 2018-10-01 13:06 - 000000398 _____ C:\Documents and Settings\All Users\Start Menu\Windows Catalog.lnk
      2018-10-01 13:06 - 2018-10-01 13:06 - 000000000 __SHD C:\Documents and Settings\Default User\IETldCache
      2018-10-01 13:06 - 2018-10-01 13:06 - 000000000 __RSH C:\MSDOS.SYS
      2018-10-01 13:06 - 2018-10-01 13:06 - 000000000 __RSH C:\IO.SYS
      2018-10-01 13:06 - 2018-10-01 13:06 - 000000000 ____D C:\WINDOWS\system32\xircom
      2018-10-01 13:06 - 2018-10-01 13:06 - 000000000 ____D C:\Program Files\xerox
      2018-10-01 13:06 - 2018-10-01 13:06 - 000000000 ____D C:\Program Files\microsoft frontpage
      2018-10-01 13:06 - 2018-10-01 13:06 - 000000000 _____ C:\WINDOWS\control.ini
      2018-10-01 13:06 - 2018-10-01 13:06 - 000000000 _____ C:\CONFIG.SYS
      2018-10-01 13:06 - 2018-10-01 13:06 - 000000000 _____ C:\AUTOEXEC.BAT
      2018-10-01 13:06 - 2008-04-14 14:00 - 000829440 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\inetmgr.dll
      2018-10-01 13:06 - 2008-04-14 14:00 - 000290816 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\adsiis51.dll
      2018-10-01 13:06 - 2008-04-14 14:00 - 000275968 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\certwiz.ocx
      2018-10-01 13:06 - 2008-04-14 14:00 - 000169984 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iisui.dll
      2018-10-01 13:06 - 2008-04-14 14:00 - 000133632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iisrtl.dll
      2018-10-01 13:06 - 2008-04-14 14:00 - 000112128 _____ (Microsoft Corporation) C:\WINDOWS\system32\mapi32.dll
      2018-10-01 13:06 - 2008-04-14 14:00 - 000094720 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\certmap.ocx
      2018-10-01 13:06 - 2008-04-14 14:00 - 000076800 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\logui.ocx
      2018-10-01 13:06 - 2008-04-14 14:00 - 000076288 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cnfgprts.ocx
      2018-10-01 13:06 - 2008-04-14 14:00 - 000068608 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\isatq.dll
      2018-10-01 13:06 - 2008-04-14 14:00 - 000068608 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iisext51.dll
      2018-10-01 13:06 - 2008-04-14 14:00 - 000064512 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iismap.dll
      2018-10-01 13:06 - 2008-04-14 14:00 - 000046592 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\coadmin.dll
      2018-10-01 13:06 - 2008-04-14 14:00 - 000043520 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\admwprox.dll
      2018-10-01 13:06 - 2008-04-14 14:00 - 000030720 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iisrstas.exe
      2018-10-01 13:06 - 2008-04-14 14:00 - 000019968 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\inetsloc.dll
      2018-10-01 13:06 - 2008-04-14 14:00 - 000014336 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iisreset.exe
      2018-10-01 13:06 - 2008-04-14 14:00 - 000013312 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\infoadmn.dll
      2018-10-01 13:06 - 2008-04-14 14:00 - 000007680 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\inetmgr.exe
      2018-10-01 13:06 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\ftpsapi2.dll
      2018-10-01 13:06 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iisrstap.dll
      2018-10-01 13:06 - 2004-05-13 00:39 - 000876653 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fp4awel.dll
      2018-10-01 13:06 - 2004-05-13 00:39 - 000598071 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fpmmc.dll
      2018-10-01 13:06 - 2004-05-13 00:39 - 000184435 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fp4amsft.dll
      2018-10-01 13:06 - 2003-03-24 16:52 - 000208896 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fpmmcsat.dll
      2018-10-01 13:06 - 2003-03-24 16:52 - 000188494 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fpcount.exe
      2018-10-01 13:06 - 2003-03-24 16:52 - 000188480 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cfgwiz.exe
      2018-10-01 13:06 - 2003-03-24 16:52 - 000147513 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fp4apws.dll
      2018-10-01 13:06 - 2003-03-24 16:52 - 000109328 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fp98swin.exe
      2018-10-01 13:06 - 2003-03-24 16:52 - 000102509 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fp4atxt.dll
      2018-10-01 13:06 - 2003-03-24 16:52 - 000082035 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fp4anscp.dll
      2018-10-01 13:06 - 2003-03-24 16:52 - 000049212 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fp4awebs.dll
      2018-10-01 13:06 - 2003-03-24 16:52 - 000049210 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fp4areg.dll
      2018-10-01 13:06 - 2003-03-24 16:52 - 000041020 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fp4avnb.dll
      2018-10-01 13:06 - 2003-03-24 16:52 - 000032826 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fp4avss.dll
      2018-10-01 13:06 - 2003-03-24 16:52 - 000020541 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fpexedll.dll
      2018-10-01 13:06 - 2003-03-24 16:52 - 000020540 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\author.dll
      2018-10-01 13:06 - 2003-03-24 16:52 - 000020540 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\admin.dll
      2018-10-01 13:06 - 2003-03-24 16:52 - 000020538 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fpremadm.exe
      2018-10-01 13:06 - 2003-03-24 16:52 - 000016439 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\author.exe
      2018-10-01 13:06 - 2003-03-24 16:52 - 000016439 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\admin.exe
      2018-10-01 13:06 - 2003-03-24 16:52 - 000014608 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fp98sadm.exe
      2018-10-01 13:05 - 2018-10-03 14:21 - 000000000 __SHD C:\Documents and Settings\All Users\DRM
      2018-10-01 13:05 - 2018-10-01 13:05 - 000000000 ____D C:\Program Files\Microsoft CAPICOM
      2018-10-01 13:04 - 2018-10-01 13:04 - 000065536 _____ C:\WINDOWS\system32\config\Internet.evt
      2018-10-01 13:04 - 2018-10-01 13:04 - 000000786 _____ C:\Documents and Settings\All Users\Start Menu\Programs\Windows Movie Maker.lnk
      2018-10-01 13:04 - 2018-10-01 13:04 - 000000749 ___RH C:\WINDOWS\WindowsShell.Manifest
      2018-10-01 13:04 - 2018-10-01 13:04 - 000000749 ___RH C:\WINDOWS\system32\wuaucpl.cpl.manifest
      2018-10-01 13:04 - 2018-10-01 13:04 - 000000749 ___RH C:\WINDOWS\system32\sapi.cpl.manifest
      2018-10-01 13:04 - 2018-10-01 13:04 - 000000749 ___RH C:\WINDOWS\system32\nwc.cpl.manifest
      2018-10-01 13:04 - 2018-10-01 13:04 - 000000749 ___RH C:\WINDOWS\system32\ncpa.cpl.manifest
      2018-10-01 13:04 - 2018-10-01 13:04 - 000000749 ___RH C:\WINDOWS\system32\cdplayer.exe.manifest
      2018-10-01 13:04 - 2018-10-01 13:04 - 000000488 ___RH C:\WINDOWS\system32\WindowsLogon.manifest
      2018-10-01 13:04 - 2018-10-01 13:04 - 000000488 ___RH C:\WINDOWS\system32\logonui.exe.manifest
      2018-10-01 13:04 - 2018-10-01 13:04 - 000000000 ___HD C:\Program Files\WindowsUpdate
      2018-10-01 13:04 - 2018-10-01 13:04 - 000000000 ____D C:\WINDOWS\system32\DirectX
      2018-10-01 13:04 - 2018-10-01 13:04 - 000000000 ____D C:\Program Files\Online Services
      2018-10-01 13:04 - 2008-04-14 14:00 - 004399505 ____C C:\WINDOWS\system32\dllcache\nls302en.lex
      2018-10-01 13:04 - 2008-04-14 14:00 - 000099840 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\helphost.exe
      2018-10-01 13:04 - 2008-04-14 14:00 - 000048680 ___SH C:\WINDOWS\winnt256.bmp
      2018-10-01 13:04 - 2008-04-14 14:00 - 000048680 ___SH C:\WINDOWS\winnt.bmp
      2018-10-01 13:04 - 2008-04-14 14:00 - 000035328 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\notiflag.exe
      2018-10-01 13:04 - 2008-04-14 14:00 - 000021504 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\brpinfo.dll
      2018-10-01 13:04 - 2008-04-14 14:00 - 000011264 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\atrace.dll
      2018-10-01 13:04 - 2008-04-14 14:00 - 000011264 _____ (Microsoft Corporation) C:\WINDOWS\system32\atrace.dll
      2018-10-01 13:04 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\hcappres.dll
      2018-10-01 13:03 - 2018-10-01 13:04 - 000000000 ____D C:\WINDOWS\srchasst
      2018-10-01 13:03 - 2018-10-01 13:03 - 000000000 ____D C:\Program Files\Movie Maker
      2018-10-01 13:03 - 2018-10-01 13:03 - 000000000 ____D C:\Program Files\Common Files\Services
      2018-10-01 13:03 - 2018-10-01 13:03 - 000000000 ____D C:\Program Files\Common Files\MSSoap
      2018-10-01 13:03 - 2014-02-12 16:57 - 000759296 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\vgx.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 001933848 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wuaueng.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 001933848 _____ (Microsoft Corporation) C:\WINDOWS\system32\wuaueng.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 000577048 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wuapi.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 000577048 _____ (Microsoft Corporation) C:\WINDOWS\system32\wuapi.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 000329240 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wucltui.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 000329240 _____ (Microsoft Corporation) C:\WINDOWS\system32\wucltui.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 000219160 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wuaucpl.cpl
      2018-10-01 13:03 - 2014-02-12 16:56 - 000219160 _____ (Microsoft Corporation) C:\WINDOWS\system32\wuaucpl.cpl
      2018-10-01 13:03 - 2014-02-12 16:56 - 000210968 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wuweb.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 000210968 _____ (Microsoft Corporation) C:\WINDOWS\system32\wuweb.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 000194520 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wuaueng1.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 000194520 _____ (Microsoft Corporation) C:\WINDOWS\system32\wuaueng1.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 000172504 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wuauclt1.exe
      2018-10-01 13:03 - 2014-02-12 16:56 - 000172504 _____ (Microsoft Corporation) C:\WINDOWS\system32\wuauclt1.exe
      2018-10-01 13:03 - 2014-02-12 16:56 - 000053784 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wuauclt.exe
      2018-10-01 13:03 - 2014-02-12 16:56 - 000053784 _____ (Microsoft Corporation) C:\WINDOWS\system32\wuauclt.exe
      2018-10-01 13:03 - 2014-02-12 16:56 - 000035864 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wups.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 000035864 _____ (Microsoft Corporation) C:\WINDOWS\system32\wups.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 000023064 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wuauserv.dll
      2018-10-01 13:03 - 2014-02-12 16:56 - 000023064 _____ (Microsoft Corporation) C:\WINDOWS\system32\wuauserv.dll
      2018-10-01 13:03 - 2014-02-12 16:55 - 003558912 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\moviemk.exe
      2018-10-01 13:03 - 2008-04-14 14:00 - 004256768 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmm2res.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 003166208 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msgr3en.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000726078 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\srchui.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000502272 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmm2fxa.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000409088 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\qmgr.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000409088 _____ (Microsoft Corporation) C:\WINDOWS\system32\qmgr.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000402432 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmm2filt.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000364544 ____C (Microsoft Corporation (written by Digital Renaissance Inc.)) C:\WINDOWS\system32\dllcache\npdsplay.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000325632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmm2fxb.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000235520 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mssoap1.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000226816 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\npdrmv2.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000221184 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmpns.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000167936 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmm2ae.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000118784 _____ (Microsoft Corporation) C:\WINDOWS\system32\msg723.acm
      2018-10-01 13:03 - 2008-04-14 14:00 - 000093184 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\ieinfo5.ocx
      2018-10-01 13:03 - 2008-04-14 14:00 - 000073728 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\icwtutor.exe
      2018-10-01 13:03 - 2008-04-14 14:00 - 000064512 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\acctres.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000064512 _____ (Microsoft Corporation) C:\WINDOWS\system32\acctres.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000061440 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\icwres.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000058434 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\srchctls.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000047104 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\srdiag.exe
      2018-10-01 13:03 - 2008-04-14 14:00 - 000040960 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\trialoc.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000039936 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msinfo32.exe
      2018-10-01 13:03 - 2008-04-14 14:00 - 000025088 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wisc10.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000023552 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mssoapr.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000018944 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\qmgrprxy.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000018944 _____ (Microsoft Corporation) C:\WINDOWS\system32\qmgrprxy.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\isignup.exe
      2018-10-01 13:03 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\icfgnt5.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000016384 _____ (Microsoft Corporation) C:\WINDOWS\system32\icfgnt5.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000012288 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wb32.exe
      2018-10-01 13:03 - 2008-04-14 14:00 - 000012288 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\nmevtmsg.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000012288 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cb32.exe
      2018-10-01 13:03 - 2008-04-14 14:00 - 000012288 _____ (Microsoft Corporation) C:\WINDOWS\system32\nmevtmsg.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000010240 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\npwmsdrm.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000008192 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\bitsprx2.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000008192 _____ (Microsoft Corporation) C:\WINDOWS\system32\bitsprx2.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000007680 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmm2ext.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000007168 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\bitsprx4.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000007168 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\bitsprx3.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000007168 _____ (Microsoft Corporation) C:\WINDOWS\system32\bitsprx4.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000007168 _____ (Microsoft Corporation) C:\WINDOWS\system32\bitsprx3.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmm2res2.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000004639 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mplayer2.exe
      2018-10-01 13:03 - 2008-04-14 14:00 - 000004096 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmm2eres.dll
      2018-10-01 13:03 - 2008-04-14 14:00 - 000000984 ____C C:\WINDOWS\system32\dllcache\srframe.mmf
      2018-10-01 13:03 - 2005-01-28 13:44 - 000991232 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\migrate.exe
      2018-10-01 13:03 - 2005-01-28 13:44 - 000819200 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\setup_wm.exe
      2018-10-01 13:03 - 2005-01-28 13:44 - 000352256 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mpvis.dll
      2018-10-01 13:03 - 2005-01-28 13:44 - 000077824 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmpband.dll
      2018-10-01 13:03 - 2005-01-28 13:44 - 000073728 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmplayer.exe
      2018-10-01 13:03 - 2005-01-28 13:44 - 000028672 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\custsat.dll
      2018-10-01 13:02 - 2018-10-02 08:44 - 000000000 ____D C:\Program Files\Common Files\System
      2018-10-01 13:02 - 2018-10-01 13:03 - 000000000 ____D C:\Program Files\Outlook Express
      2018-10-01 13:02 - 2018-10-01 13:03 - 000000000 ____D C:\Program Files\NetMeeting
      2018-10-01 13:02 - 2014-02-12 16:57 - 000638816 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iexplore.exe
      2018-10-01 13:02 - 2014-02-12 16:57 - 000068608 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\hmmapi.dll
      2018-10-01 13:02 - 2014-02-12 16:56 - 001315328 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msoe.dll
      2018-10-01 13:02 - 2014-02-12 16:56 - 000153088 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\triedit.dll
      2018-10-01 13:02 - 2014-02-12 16:56 - 000102400 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msjro.dll
      2018-10-01 13:02 - 2014-02-12 16:56 - 000045568 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wab.exe
      2018-10-01 13:02 - 2014-02-12 16:55 - 000744448 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\helpsvc.exe
      2018-10-01 13:02 - 2014-02-12 16:55 - 000692736 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\inetcomm.dll
      2018-10-01 13:02 - 2014-02-12 16:55 - 000692736 _____ (Microsoft Corporation) C:\WINDOWS\system32\inetcomm.dll
      2018-10-01 13:02 - 2014-02-12 16:55 - 000565248 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msado15.dll
      2018-10-01 13:02 - 2014-02-12 16:55 - 000331776 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msadce.dll
      2018-10-01 13:02 - 2014-02-12 16:55 - 000200704 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msadox.dll
      2018-10-01 13:02 - 2014-02-12 16:55 - 000180224 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msadomd.dll
      2018-10-01 13:02 - 2014-02-12 16:55 - 000143360 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msadco.dll
      2018-10-01 13:02 - 2014-02-12 16:55 - 000128512 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\dhtmled.ocx
      2018-10-01 13:02 - 2014-02-12 16:55 - 000081920 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msado27.tlb
      2018-10-01 13:02 - 2014-02-12 16:55 - 000081920 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\isign32.dll
      2018-10-01 13:02 - 2014-02-12 16:55 - 000081920 _____ (Microsoft Corporation) C:\WINDOWS\system32\isign32.dll
      2018-10-01 13:02 - 2014-02-12 16:55 - 000077824 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msado26.tlb
      2018-10-01 13:02 - 2014-02-12 16:55 - 000077824 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msado25.tlb
      2018-10-01 13:02 - 2014-02-12 16:55 - 000061440 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msado21.tlb
      2018-10-01 13:02 - 2014-02-12 16:55 - 000061440 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msado20.tlb
      2018-10-01 13:02 - 2014-02-12 16:55 - 000057344 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msador15.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 002479616 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msoeres.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 001032192 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\conf.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000769024 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\helpctr.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000565248 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msobmain.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000554008 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\dao360.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000510976 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wab32.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000487424 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\oledb32.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000385024 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\callcont.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000380416 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rstrui.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000376832 ____C () C:\WINDOWS\system32\dllcache\msinfo.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000315392 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdasql.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000274944 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mstask.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000274944 _____ (Microsoft Corporation) C:\WINDOWS\system32\mstask.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000274432 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mst120.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000274432 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\inetcfg.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000274432 _____ (Microsoft Corporation) C:\WINDOWS\system32\inetcfg.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000252928 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msoeacct.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000252928 _____ (Microsoft Corporation) C:\WINDOWS\system32\msoeacct.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000249856 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wab32res.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000239104 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\srrstr.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000239104 _____ (Microsoft Corporation) C:\WINDOWS\system32\srrstr.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000233472 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdaora.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000229376 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\nmas.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000221184 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\nac.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000217088 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sqlxmlx.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000214528 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\icwconn1.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000204800 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdaps.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000200704 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdaprst.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000192512 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\schedsvc.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000192512 _____ (Microsoft Corporation) C:\WINDOWS\system32\schedsvc.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000188416 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\nmwb.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000188416 _____ (Microsoft Corporation) C:\WINDOWS\system32\msh261.drv
      2018-10-01 13:02 - 2008-04-14 14:00 - 000172032 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\nmoldwb.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000172032 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\icwhelp.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000171008 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\srsvc.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000171008 _____ (Microsoft Corporation) C:\WINDOWS\system32\srsvc.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000169984 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msconfig.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000155648 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msadds.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000151552 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\nmft.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000150528 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\uploadm.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000129792 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fltmgr.sys
      2018-10-01 13:02 - 2008-04-14 14:00 - 000129792 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\fltMgr.sys
      2018-10-01 13:02 - 2008-04-14 14:00 - 000122368 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msobcomm.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000118784 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdarem.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000105984 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msoert2.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000105984 _____ (Microsoft Corporation) C:\WINDOWS\system32\msoert2.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000104448 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\oeimport.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000102912 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\pchshell.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000094208 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdatl3.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000086528 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\directdb.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000086016 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\icwconn2.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000085504 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wabimp.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000081920 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\nmchat.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000081920 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\ils.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000081920 _____ (Microsoft Corporation) C:\WINDOWS\system32\ils.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000077824 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\nmcom.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000077824 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdaosp.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000073728 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\icwdial.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000073728 _____ (Microsoft Corporation) C:\WINDOWS\system32\icwdial.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000073472 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sr.sys
      2018-10-01 13:02 - 2008-04-14 14:00 - 000073472 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\sr.sys
      2018-10-01 13:02 - 2008-04-14 14:00 - 000073216 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\setup50.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000069632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msconf.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000069632 _____ (Microsoft Corporation) C:\WINDOWS\system32\msconf.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000067584 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\srclient.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000067584 _____ (Microsoft Corporation) C:\WINDOWS\system32\srclient.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000065536 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\oledb32r.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000065536 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\icwphbk.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000065536 _____ (Microsoft Corporation) C:\WINDOWS\system32\icwphbk.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000061440 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rrcm.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000061440 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msadcf.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000061440 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\icwconn.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000060416 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\oemig50.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000060416 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msimn.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000057344 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mst123.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000057344 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msadrh15.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000057344 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\h323cc.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000053248 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msadcs.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000051200 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\oobebaln.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000049152 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\icwutil.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000048128 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\inetres.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000048128 _____ (Microsoft Corporation) C:\WINDOWS\system32\inetres.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000045568 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\safrslv.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000045568 _____ (Microsoft Corporation) C:\WINDOWS\system32\safrslv.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000045056 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\confmrsl.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000043520 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\safrcdlg.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000043520 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\racpldlg.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000043520 _____ (Microsoft Corporation) C:\WINDOWS\system32\safrcdlg.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000043520 _____ (Microsoft Corporation) C:\WINDOWS\system32\racpldlg.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000040960 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\dcap32.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000038400 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\pchsvc.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000036864 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdfmap.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000035328 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\oemiglib.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000034560 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mnmdd.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000034560 _____ (Microsoft Corporation) C:\WINDOWS\system32\mnmdd.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000032768 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wabfind.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000032768 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mnmsrvc.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000032768 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\icwdl.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000032768 ____C (Intel Corporation) C:\WINDOWS\system32\dllcache\isrdbg32.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000032768 _____ (Microsoft Corporation) C:\WINDOWS\system32\mnmsrvc.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000032768 _____ (Intel Corporation) C:\WINDOWS\system32\isrdbg32.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000030720 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msobshel.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000030208 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wabmig.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000029696 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\safrdm.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000029696 _____ (Microsoft Corporation) C:\WINDOWS\system32\safrdm.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000029184 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msoobe.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000028672 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\nmmkcert.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000028672 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\nmasnt.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000028672 _____ (Microsoft Corporation) C:\WINDOWS\system32\nmmkcert.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000024576 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msxactps.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000024576 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msader15.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000024576 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msaddsr.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000024576 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\icwrmind.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000023040 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fltmc.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000023040 _____ (Microsoft Corporation) C:\WINDOWS\system32\fltMc.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000020480 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdatt.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000020480 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msadcer.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000020480 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\inetwiz.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000019456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msobweb.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000018432 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\iedw.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000018432 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\hscupd.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000016896 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fltlib.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000016896 _____ (Microsoft Corporation) C:\WINDOWS\system32\fltlib.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msobdl.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdasqlr.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdaremr.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdaprsr.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdaorar.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msadcor.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msadcfr.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000012288 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mstinit.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000012288 _____ (Microsoft Corporation) C:\WINDOWS\system32\mstinit.exe
      2018-10-01 13:02 - 2008-04-14 14:00 - 000004096 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdaurl.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000004096 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdasc.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000004096 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdaer.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000004096 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdaenum.dll
      2018-10-01 13:02 - 2008-04-14 14:00 - 000004096 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdadc.dll
      2018-10-01 13:01 - 2018-10-09 12:37 - 000000599 _____ C:\Documents and Settings\All Users\Start Menu\Microsoft Update Catalog.lnk
      2018-10-01 13:01 - 2018-10-01 13:05 - 000000000 ____D C:\WINDOWS\Registration
      2018-10-01 13:01 - 2018-10-01 13:01 - 000021640 _____ C:\WINDOWS\system32\emptyregdb.dat
      2018-10-01 13:01 - 2018-10-01 13:01 - 000001570 _____ C:\Documents and Settings\All Users\Start Menu\Microsoft Update.lnk
      2018-10-01 13:01 - 2018-10-01 13:01 - 000000037 _____ C:\WINDOWS\vbaddin.ini
      2018-10-01 13:01 - 2018-10-01 13:01 - 000000036 _____ C:\WINDOWS\vb.ini
      2018-10-01 13:01 - 2018-10-01 13:01 - 000000000 ___RD C:\Documents and Settings\All Users\Start Menu\Programs\Games
      2018-10-01 13:01 - 2018-10-01 13:01 - 000000000 ____D C:\Program Files\MSN Gaming Zone
      2018-10-01 13:01 - 2018-10-01 13:01 - 000000000 ____D C:\Program Files\ComPlus Applications
      2018-10-01 13:01 - 2008-04-14 14:00 - 002178131 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\shvlres.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 001817687 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\bckgres.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 001175635 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\hrtzres.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 001039955 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cmnresm.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000780885 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\chkrres.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000753236 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rvseres.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000217160 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cmnclim.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000113222 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\zoneclim.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000082501 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\bckg.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000066113 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\shvl.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000057409 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\hrtz.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000048706 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rvse.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000042577 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\bckgzm.exe
      2018-10-01 13:01 - 2008-04-14 14:00 - 000042575 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\chkrzm.exe
      2018-10-01 13:01 - 2008-04-14 14:00 - 000042574 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rvsezm.exe
      2018-10-01 13:01 - 2008-04-14 14:00 - 000042573 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\shvlzm.exe
      2018-10-01 13:01 - 2008-04-14 14:00 - 000042573 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\hrtzzm.exe
      2018-10-01 13:01 - 2008-04-14 14:00 - 000041029 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\zcorem.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000040515 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\chkr.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000036937 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\zclientm.exe
      2018-10-01 13:01 - 2008-04-14 14:00 - 000032339 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\uniansi.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000029760 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\znetm.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000013894 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\zonelibm.dll
      2018-10-01 13:01 - 2008-04-14 14:00 - 000005632 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\write.exe
      2018-10-01 13:01 - 2008-04-14 14:00 - 000005632 _____ (Microsoft Corporation) C:\WINDOWS\system32\write.exe
      2018-10-01 13:01 - 2008-04-14 14:00 - 000004677 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\zeeverm.dll
      2018-10-01 13:00 - 2018-10-01 13:01 - 000000000 ____D C:\WINDOWS\system32\MsDtc
      2018-10-01 13:00 - 2018-10-01 13:01 - 000000000 ____D C:\WINDOWS\system32\Com
      2018-10-01 13:00 - 2018-10-01 13:00 - 000000000 ____D C:\Program Files\Windows NT
      2018-10-01 13:00 - 2014-02-12 16:56 - 000453120 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmiprvsd.dll
      2018-10-01 13:00 - 2014-02-12 16:56 - 000343040 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mspaint.exe
      2018-10-01 13:00 - 2014-02-12 16:56 - 000343040 _____ (Microsoft Corporation) C:\WINDOWS\system32\mspaint.exe
      2018-10-01 13:00 - 2014-02-12 16:56 - 000299008 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msiprov.dll
      2018-10-01 13:00 - 2014-02-12 16:56 - 000296960 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\termsrv.dll
      2018-10-01 13:00 - 2014-02-12 16:56 - 000296960 _____ (Microsoft Corporation) C:\WINDOWS\system32\termsrv.dll
      2018-10-01 13:00 - 2014-02-12 16:56 - 000227840 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmiprvse.exe
      2018-10-01 13:00 - 2014-02-12 16:56 - 000218112 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wordpad.exe
      2018-10-01 13:00 - 2014-02-12 16:56 - 000139784 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rdpwd.sys
      2018-10-01 13:00 - 2014-02-12 16:56 - 000139784 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\rdpwd.sys
      2018-10-01 13:00 - 2014-02-12 16:56 - 000092672 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\policman.dll
      2018-10-01 13:00 - 2014-02-12 16:56 - 000091648 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mtxoci.dll
      2018-10-01 13:00 - 2014-02-12 16:56 - 000091648 _____ (Microsoft Corporation) C:\WINDOWS\system32\mtxoci.dll
      2018-10-01 13:00 - 2014-02-12 16:56 - 000036864 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tsgqec.dll
      2018-10-01 13:00 - 2014-02-12 16:56 - 000036864 _____ (Microsoft Corporation) C:\WINDOWS\system32\tsgqec.dll
      2018-10-01 13:00 - 2014-02-12 16:56 - 000022024 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tdtcp.sys
      2018-10-01 13:00 - 2014-02-12 16:56 - 000022024 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\tdtcp.sys
      2018-10-01 13:00 - 2014-02-12 16:55 - 002691072 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\lhmstscx.dll
      2018-10-01 13:00 - 2014-02-12 16:55 - 002691072 _____ (Microsoft Corporation) C:\WINDOWS\system32\mstscax.dll
      2018-10-01 13:00 - 2014-02-12 16:55 - 001358336 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cimwin32.dll
      2018-10-01 13:00 - 2014-02-12 16:55 - 001034240 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\lhmstsc.exe
      2018-10-01 13:00 - 2014-02-12 16:55 - 001034240 _____ (Microsoft Corporation) C:\WINDOWS\system32\mstsc.exe
      2018-10-01 13:00 - 2014-02-12 16:55 - 000956928 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdtctm.dll
      2018-10-01 13:00 - 2014-02-12 16:55 - 000956928 _____ (Microsoft Corporation) C:\WINDOWS\system32\msdtctm.dll
      2018-10-01 13:00 - 2014-02-12 16:55 - 000473600 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fastprox.dll
      2018-10-01 13:00 - 2014-02-12 16:55 - 000428032 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdtcprx.dll
      2018-10-01 13:00 - 2014-02-12 16:55 - 000428032 _____ (Microsoft Corporation) C:\WINDOWS\system32\msdtcprx.dll
      2018-10-01 13:00 - 2014-02-12 16:55 - 000161792 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdtcuiu.dll
      2018-10-01 13:00 - 2014-02-12 16:55 - 000161792 _____ (Microsoft Corporation) C:\WINDOWS\system32\msdtcuiu.dll
      2018-10-01 13:00 - 2014-02-12 16:55 - 000131072 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\aaclient.dll
      2018-10-01 13:00 - 2014-02-12 16:55 - 000131072 _____ (Microsoft Corporation) C:\WINDOWS\system32\aaclient.dll
      2018-10-01 13:00 - 2014-02-12 16:55 - 000058880 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdtclog.dll
      2018-10-01 13:00 - 2014-02-12 16:55 - 000058880 _____ (Microsoft Corporation) C:\WINDOWS\system32\msdtclog.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 001267200 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\comsvcs.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 001267200 _____ (Microsoft Corporation) C:\WINDOWS\system32\comsvcs.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000625664 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\catsrvut.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000625664 _____ (Microsoft Corporation) C:\WINDOWS\system32\catsrvut.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000605696 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\getuname.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000605696 _____ (Microsoft Corporation) C:\WINDOWS\system32\getuname.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000539648 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\comuid.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000539648 _____ (Microsoft Corporation) C:\WINDOWS\system32\comuid.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000539136 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\dialer.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000538624 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\spider.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000538624 _____ (Microsoft Corporation) C:\WINDOWS\system32\spider.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000531456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wbemcore.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000498688 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\clbcatq.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000498688 _____ (Microsoft Corporation) C:\WINDOWS\system32\clbcatq.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000358912 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmic.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000347136 _____ (Hilgraeve, Inc.) C:\WINDOWS\system32\hypertrm.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000290304 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rhttpaa.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000290304 _____ (Microsoft Corporation) C:\WINDOWS\system32\rhttpaa.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000281088 ____C (Cinematronics) C:\WINDOWS\system32\dllcache\pinball.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000273920 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wbemess.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000247808 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\esscli.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000237056 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\provthrd.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000227840 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\avtapi.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000227840 _____ (Microsoft Corporation) C:\WINDOWS\system32\avtapi.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000226304 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\catsrv.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000226304 _____ (Microsoft Corporation) C:\WINDOWS\system32\catsrv.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000214528 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wbemcomn.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000212992 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\ntevt.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000197120 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wbemupgd.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000196608 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmiadap.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000196608 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wbemcntl.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000195072 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\comadmin.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000185344 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\framedyn.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000185344 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cmprops.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000185344 _____ (Microsoft Corporation) C:\WINDOWS\system32\cmprops.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000184320 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\accwiz.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000184320 _____ (Microsoft Corporation) C:\WINDOWS\system32\accwiz.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000178176 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wbemdisp.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000178176 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\repdrvfs.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000167424 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\comsnap.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000167424 _____ (Microsoft Corporation) C:\WINDOWS\system32\comsnap.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000156672 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmipcima.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000147968 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rdchost.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000147968 _____ (Microsoft Corporation) C:\WINDOWS\system32\rdchost.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000144896 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmisvc.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000144896 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmiprov.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000141312 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sessmgr.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000141312 _____ (Microsoft Corporation) C:\WINDOWS\system32\sessmgr.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000140800 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmidcprv.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000138752 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sndvol32.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000138752 _____ (Microsoft Corporation) C:\WINDOWS\system32\sndvol32.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000132096 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmipdskq.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000131584 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\viewprov.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000131584 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sndrec32.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000131584 _____ (Microsoft Corporation) C:\WINDOWS\system32\sndrec32.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000126976 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mshearts.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000126976 _____ (Microsoft Corporation) C:\WINDOWS\system32\mshearts.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000126464 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmiapsrv.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000123904 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mofd.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000123392 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mplay32.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000123392 _____ (Microsoft Corporation) C:\WINDOWS\system32\mplay32.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000120320 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\dsprov.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000119808 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\winmine.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000119808 _____ (Microsoft Corporation) C:\WINDOWS\system32\winmine.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000116224 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wbemtest.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000116224 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\updprov.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000114688 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\calc.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000114688 _____ (Microsoft Corporation) C:\WINDOWS\system32\calc.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000110592 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\clbcatex.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000110592 _____ (Microsoft Corporation) C:\WINDOWS\system32\clbcatex.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000102912 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\clipbrd.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000102912 _____ (Microsoft Corporation) C:\WINDOWS\system32\clipbrd.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000097792 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\comrepl.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000097792 _____ (Microsoft Corporation) C:\WINDOWS\system32\comrepl.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000095232 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmiutils.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000093702 _____ C:\WINDOWS\system32\subrange.uce
      2018-10-01 13:00 - 2008-04-14 14:00 - 000093696 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tscfgwmi.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000093696 _____ (Microsoft Corporation) C:\WINDOWS\system32\tscfgwmi.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000088576 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmiaprpl.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000087176 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rdpwsx.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000087176 _____ (Microsoft Corporation) C:\WINDOWS\system32\rdpwsx.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000086528 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\stdprov.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000085504 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\catsrvps.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000085504 _____ (Microsoft Corporation) C:\WINDOWS\system32\catsrvps.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000080384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\charmap.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000080384 _____ (Microsoft Corporation) C:\WINDOWS\system32\charmap.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000075264 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmipicmp.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000073216 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\avwav.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000073216 _____ (Microsoft Corporation) C:\WINDOWS\system32\avwav.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000071680 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wbemcons.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000068608 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\access.cpl
      2018-10-01 13:00 - 2008-04-14 14:00 - 000068608 _____ (Microsoft Corporation) C:\WINDOWS\system32\access.cpl
      2018-10-01 13:00 - 2008-04-14 14:00 - 000067072 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rdshost.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000067072 _____ (Microsoft Corporation) C:\WINDOWS\system32\rdshost.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000065978 _____ C:\WINDOWS\Soap Bubbles.bmp
      2018-10-01 13:00 - 2008-04-14 14:00 - 000065954 _____ C:\WINDOWS\Prairie Wind.bmp
      2018-10-01 13:00 - 2008-04-14 14:00 - 000065832 _____ C:\WINDOWS\Santa Fe Stucco.bmp
      2018-10-01 13:00 - 2008-04-14 14:00 - 000063488 _____ C:\WINDOWS\system32\wmimgmt.msc
      2018-10-01 13:00 - 2008-04-14 14:00 - 000062976 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rdpclip.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000062976 _____ (Microsoft Corporation) C:\WINDOWS\system32\rdpclip.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000062464 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmipjobj.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000061952 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmipiprt.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000061952 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tmplprov.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000061440 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmimsg.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000060928 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmicookr.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000060458 _____ C:\WINDOWS\system32\ideograf.uce
      2018-10-01 13:00 - 2008-04-14 14:00 - 000060416 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\remotepg.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000060416 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\colbact.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000060416 _____ (Microsoft Corporation) C:\WINDOWS\system32\remotepg.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000060416 _____ (Microsoft Corporation) C:\WINDOWS\system32\colbact.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000059904 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wbemdisp.tlb
      2018-10-01 13:00 - 2008-04-14 14:00 - 000059904 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\trnsprov.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000059392 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\stclient.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000059392 _____ (Microsoft Corporation) C:\WINDOWS\system32\stclient.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000058880 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\licwmi.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000058880 _____ (Microsoft Corporation) C:\WINDOWS\system32\licwmi.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000056832 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\sol.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000056832 _____ (Microsoft Corporation) C:\WINDOWS\system32\sol.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000056320 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\servdeps.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000056320 _____ (Microsoft Corporation) C:\WINDOWS\system32\servdeps.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000055296 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\freecell.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000055296 _____ (Microsoft Corporation) C:\WINDOWS\system32\freecell.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000053248 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\fwdprov.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000052224 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmitimep.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000047104 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\ncprov.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000045568 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmi2xml.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000044544 _____ (Hilgraeve, Inc.) C:\WINDOWS\system32\hticons.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000043520 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wbemsvc.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000041472 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmipsess.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000040960 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\smtpcons.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000038912 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cfgbkend.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000038912 _____ (Microsoft Corporation) C:\WINDOWS\system32\cfgbkend.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000036352 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\scrcons.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000035328 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\winchat.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000035328 _____ (Microsoft Corporation) C:\WINDOWS\system32\winchat.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000034304 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mtxlegih.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000034304 _____ (Microsoft Corporation) C:\WINDOWS\system32\mtxlegih.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000033792 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\regini.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000033792 _____ (Microsoft Corporation) C:\WINDOWS\system32\regini.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000031232 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wbemads.tlb
      2018-10-01 13:00 - 2008-04-14 14:00 - 000030720 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mtxdm.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000030720 _____ (Microsoft Corporation) C:\WINDOWS\system32\mtxdm.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000028160 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\comaddin.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000028160 _____ (Microsoft Corporation) C:\WINDOWS\system32\comaddin.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000026680 _____ C:\WINDOWS\River Sumida.bmp
      2018-10-01 13:00 - 2008-04-14 14:00 - 000026582 _____ C:\WINDOWS\Greenstone.bmp
      2018-10-01 13:00 - 2008-04-14 14:00 - 000024576 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\krnlprov.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000024006 _____ C:\WINDOWS\system32\gb2312.uce
      2018-10-01 13:00 - 2008-04-14 14:00 - 000022984 _____ C:\WINDOWS\system32\bopomofo.uce
      2018-10-01 13:00 - 2008-04-14 14:00 - 000022016 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\qwinsta.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000022016 _____ (Microsoft Corporation) C:\WINDOWS\system32\qwinsta.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000020992 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msg.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000020992 _____ (Microsoft Corporation) C:\WINDOWS\system32\msg.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000019968 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rdpsnd.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000019968 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\qprocess.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000019968 _____ (Microsoft Corporation) C:\WINDOWS\system32\rdpsnd.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000019968 _____ (Microsoft Corporation) C:\WINDOWS\system32\qprocess.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000019456 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mtsadmin.tlb
      2018-10-01 13:00 - 2008-04-14 14:00 - 000018944 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wbemprox.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000017408 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mmfutil.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000017408 _____ (Microsoft Corporation) C:\WINDOWS\system32\mmfutil.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000017362 _____ C:\WINDOWS\Rhododendron.bmp
      2018-10-01 13:00 - 2008-04-14 14:00 - 000017336 _____ C:\WINDOWS\Gone Fishing.bmp
      2018-10-01 13:00 - 2008-04-14 14:00 - 000017062 _____ C:\WINDOWS\Coffee Bean.bmp
      2018-10-01 13:00 - 2008-04-14 14:00 - 000016896 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\unsecapp.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000016896 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tsshutdn.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000016896 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\qappsrv.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000016896 _____ (Microsoft Corporation) C:\WINDOWS\system32\tsshutdn.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000016896 _____ (Microsoft Corporation) C:\WINDOWS\system32\qappsrv.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000016740 _____ C:\WINDOWS\system32\shiftjis.uce
      2018-10-01 13:00 - 2008-04-14 14:00 - 000016730 _____ C:\WINDOWS\FeatherTexture.bmp
      2018-10-01 13:00 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\winmgmtr.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tskill.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mofcomp.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000016384 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\avmeter.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000016384 _____ (Microsoft Corporation) C:\WINDOWS\system32\tskill.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000016384 _____ (Microsoft Corporation) C:\WINDOWS\system32\avmeter.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000015872 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rwinsta.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000015872 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\cdmodem.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000015872 _____ (Microsoft Corporation) C:\WINDOWS\system32\rwinsta.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000015872 _____ (Microsoft Corporation) C:\WINDOWS\system32\cdmodem.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000015360 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\logoff.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000015360 _____ (Microsoft Corporation) C:\WINDOWS\system32\logoff.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000014848 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tsdiscon.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000014848 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tscon.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000014848 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\shadow.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000014848 _____ (Microsoft Corporation) C:\WINDOWS\system32\tsdiscon.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000014848 _____ (Microsoft Corporation) C:\WINDOWS\system32\tscon.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000014848 _____ (Microsoft Corporation) C:\WINDOWS\system32\shadow.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000013824 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rdsaddin.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000013824 _____ (Microsoft Corporation) C:\WINDOWS\system32\rdsaddin.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000013312 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\winmgmt.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000013312 ____C (Hilgraeve, Inc.) C:\WINDOWS\system32\dllcache\htrn_jis.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000013223 _____ C:\WINDOWS\system32\tslabels.ini
      2018-10-01 13:00 - 2008-04-14 14:00 - 000012876 _____ C:\WINDOWS\system32\korean.uce
      2018-10-01 13:00 - 2008-04-14 14:00 - 000012288 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wbemads.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000012040 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\tdpipe.sys
      2018-10-01 13:00 - 2008-04-14 14:00 - 000012040 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\tdpipe.sys
      2018-10-01 13:00 - 2008-04-14 14:00 - 000011776 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\xolehlp.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000011776 _____ (Microsoft Corporation) C:\WINDOWS\system32\xolehlp.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000011264 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\icaapi.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000011264 _____ (Microsoft Corporation) C:\WINDOWS\system32\icaapi.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000009728 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\reset.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000009728 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\comrepl.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000009728 _____ (Microsoft Corporation) C:\WINDOWS\system32\reset.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000009522 _____ C:\WINDOWS\Zapotec.bmp
      2018-10-01 13:00 - 2008-04-14 14:00 - 000008484 _____ C:\WINDOWS\system32\kanji_2.uce
      2018-10-01 13:00 - 2008-04-14 14:00 - 000006948 _____ C:\WINDOWS\system32\kanji_1.uce
      2018-10-01 13:00 - 2008-04-14 14:00 - 000006656 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\wmiapres.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\msdtc.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\dcomcnfg.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000006144 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\comrereg.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000006144 _____ (Microsoft Corporation) C:\WINDOWS\system32\msdtc.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000006144 _____ (Microsoft Corporation) C:\WINDOWS\system32\dcomcnfg.exe
      2018-10-01 13:00 - 2008-04-14 14:00 - 000004096 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\rdpcfgex.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000004096 ____C (Microsoft Corporation) C:\WINDOWS\system32\dllcache\mtxex.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000004096 _____ (Microsoft Corporation) C:\WINDOWS\system32\rdpcfgex.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000004096 _____ (Microsoft Corporation) C:\WINDOWS\system32\mtxex.dll
      2018-10-01 13:00 - 2008-04-14 14:00 - 000003286 _____ C:\WINDOWS\system32\tslabels.h
      2018-10-01 13:00 - 2008-04-14 14:00 - 000001931 _____ C:\WINDOWS\system32\msdtcprf.ini
      2018-10-01 13:00 - 2008-04-14 14:00 - 000001272 _____ C:\WINDOWS\Blue Lace 16.bmp
      2018-10-01 13:00 - 2008-04-14 14:00 - 000001161 _____ C:\WINDOWS\system32\usrlogon.cmd
      2018-10-01 13:00 - 2008-04-14 14:00 - 000000768 _____ C:\WINDOWS\system32\msdtcprf.h
      2018-10-01 12:59 - 2009-09-04 16:43 - 000195712 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\rdpdr.sys
      2018-10-01 12:59 - 2008-04-14 03:43 - 000040840 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\termdd.sys
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-10-09 08:47 - 2008-04-14 14:00 - 000000573 _____ C:\WINDOWS\win.ini
      2018-10-09 08:47 - 2008-04-14 14:00 - 000000227 _____ C:\WINDOWS\system.ini
      2018-10-05 08:55 - 2008-04-14 14:00 - 000842240 _____ (Adobe Systems Incorporated) C:\WINDOWS\system32\FlashPlayerApp.exe
      2018-10-05 08:55 - 2008-04-14 14:00 - 000175104 _____ (Adobe Systems Incorporated) C:\WINDOWS\system32\FlashPlayerCPLApp.cpl
      2018-10-03 10:08 - 2008-04-14 14:00 - 000002206 _____ C:\WINDOWS\system32\wpa.dbl
      ==================== Files in the root of some directories =======
      2018-10-01 13:33 - 2018-10-07 09:14 - 000006144 _____ () C:\Documents and Settings\Administrator\Local Settings\Application Data\DCBC2A71-70D8-4DAN-EHR8-E0D61DEA3FDF.ini
      Some files in TEMP:
      2018-10-08 13:13 - 2018-10-08 13:14 - 013604352 _____ (Reimage) C:\Documents and Settings\Administrator\Local Settings\Temp\ReimagePackage.exe
      2002-07-15 21:43 - 2002-07-15 21:43 - 000052736 _____ () C:\Documents and Settings\Administrator\Local Settings\Temp\sfextra.dll
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\WINDOWS\explorer.exe => File is digitally signed
      C:\WINDOWS\system32\winlogon.exe => File is digitally signed
      C:\WINDOWS\system32\svchost.exe => File is digitally signed
      C:\WINDOWS\system32\services.exe => File is digitally signed
      C:\WINDOWS\system32\User32.dll => File is digitally signed
      C:\WINDOWS\system32\userinit.exe => File is digitally signed
      C:\WINDOWS\system32\rpcss.dll => File is digitally signed
      C:\WINDOWS\system32\dnsapi.dll => File is digitally signed
      C:\WINDOWS\system32\Drivers\volsnap.sys => File is digitally signed
      ==================== End of FRST.txt ============================
  • Дарение



Поставихме бисквитки на устройството ви за най-добро потребителско изживяване. Можете да промените настройките си за бисквитки, или в противен случай приемаме, че сте съгласни с нашите условия за ползване.