Премини към съдържанието
15 години Kaldata.com – време е да почерпим! Прочети още... ×

Препоръчан отговор

Здравейте на всички :)

Така, от доста време забелязвам, че компютъра се товари доста, бавно зарежда уиндолса, малко фпс в игри ;/

И реших да направим една проверка .. : )





DDS (Ver_2011-09-30.01) - NTFS_x86 Internet Explorer: 9.10.9200.16686  BrowserJavaVersion: 10.25.2 Run by User at 19:14:52 on 2013-10-07 Microsoft Windows 7 Enterprise 6.1.7601.1.1251.359.1026.18.1917.915 [GMT 3:00] . AV: Microsoft Security Essentials *Disabled/Updated* {641105E6-77ED-3F35-A304-765193BCB75F} SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46} SP: Microsoft Security Essentials *Disabled/Updated* {DF70E402-51D7-30BB-99B4-4D23E83BFDE2} . ============== Running Processes ================ . C:Windowssystem32wininit.exe C:Windowssystem32lsm.exe C:Program FilesMicrosoft Security ClientMsMpEng.exe C:WindowsSystem32spoolsv.exe C:Program FilesApplication UpdaterApplicationUpdater.exe C:PROGRA~1MYWEBS~1bar1.binmwssvc.exe C:Windowssystem32taskhost.exe C:Windowssystem32PnkBstrA.exe D:MCRazer Game BoosterRzKLService.exe C:ProgramDataSkypeToolbarsSkype C2C Servicec2c_service.exe C:Windowssystem32Dwm.exe C:WindowsExplorer.EXE C:Program FilesTeamViewerVersion8TeamViewer_Service.exe C:Program FilesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exe C:WindowsZSSnp211.exe C:Program FilesMicrosoft Security Clientmsseces.exe C:Program FilesAVG Secure Searchvprot.exe C:WindowsSystem32hkcmd.exe C:WindowsSystem32igfxpers.exe C:Program FilesCommon FilesJavaJava Updatejusched.exe C:Program FilesCommon FilesSpigotSearch SettingsSearchSettings.exe D:DownloadsmyНова папкаhamachi-2-ui.exe C:Program FilesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12loggingserver.exe C:Windowssystem32conhost.exe C:Windowssystem32driverssfuservice.exe D:DownloadsmyНова папкаLMIGuardianSvc.exe C:Program FilesCommon FilesMicrosoft SharedWindows LiveWLIDSVC.EXE C:Program FilesCommon FilesMicrosoft SharedWindows LiveWLIDSvcM.exe D:DownloadsmyНова папкаhamachi-2.exe D:DownloadsmyНова папкаLMIGuardianSvc.exe C:Program FilesWindows Sidebarsidebar.exe C:Windowssystem32SearchIndexer.exe C:WindowsMicrosoft.NetFrameworkv3.0WPFPresentationFontCache.exe C:UsersUserAppDataLocalAkamainetsession_win.exe C:UsersUserAppDataLocalAkamainetsession_win.exe C:WindowsSystem32WUDFHost.exe C:Program FilesWindows Media Playerwmpnetwk.exe C:Windowssystem32DllHost.exe C:Program FilesMozilla Firefoxfirefox.exe C:Program FilesMozilla Firefoxplugin-container.exe C:Windowssystem32MacromedFlashFlashPlayerPlugin_11_8_800_168.exe C:Windowssystem32MacromedFlashFlashPlayerPlugin_11_8_800_168.exe C:Windowssystem32wbemwmiprvse.exe C:Windowssystem32vssvc.exe C:Windowssystem32SearchProtocolHost.exe C:Windowssystem32SearchFilterHost.exe C:Windowssystem32conhost.exe C:Windowssystem32svchost.exe -k DcomLaunch C:Windowssystem32svchost.exe -k RPCSS C:WindowsSystem32svchost.exe -k LocalServiceNetworkRestricted C:WindowsSystem32svchost.exe -k LocalSystemNetworkRestricted C:Windowssystem32svchost.exe -k LocalService C:Windowssystem32svchost.exe -k netsvcs C:Windowssystem32svchost.exe -k NetworkService C:Windowssystem32svchost.exe -k LocalServiceNoNetwork C:Windowssystem32svchost.exe -k LocalServiceAndNoImpersonation C:Windowssystem32svchost.exe -k imgsvc C:Windowssystem32svchost.exe -k NetworkServiceNetworkRestricted C:WindowsSystem32svchost.exe -k LocalServicePeerNet C:WindowsSystem32svchost.exe -k swprv . ============== Pseudo HJT Report =============== . uProxyOverride = <local> uURLSearchHooks: YTD Toolbar: {F3FEE66E-E034-436a-86E4-9690573BEE8A} - uURLSearchHooks: {00A6FAF6-072E-44cf-8957-5838F569A31D} - <orphaned> BHO: privitize Helper Object: {1ACB5ABE-4890-4747-952C-F13BDB93FB75} - c:program filesindustriyaprivitize1.8.21.6bhprivitize.dll BHO: Groove GFS Browser Helper: {72853161-30C5-4D22-B7F9-0BBC1D38A37E} - c:program filesmicrosoft officeoffice14GROOVEEX.DLL BHO: Java Plug-In SSV Helper: {761497BB-D6F0-462C-B6EB-D4DAF1D92D43} - c:program filesjavajre7binssv.dll BHO: Windows Live ID Sign-in Helper: {9030D464-4C02-4ABF-8ECC-5164760863C6} - c:program filescommon filesmicrosoft sharedwindows liveWindowsLiveLogin.dll BHO: AVG Security Toolbar: {95B7759C-8C7F-4BF1-B163-73684A933233} - c:program filesavg secure search17.0.1.12AVG Secure Search_toolbar.dll BHO: Skype Browser Helper: {AE805869-2E5C-4ED4-8F7B-F1F7851A4497} - c:program filesskypetoolbarsinternet explorerskypeieplugin.dll BHO: Office Document Cache Handler: {B4F3A835-0E21-4959-BA22-42B3008E02FF} - c:program filesmicrosoft officeoffice14URLREDIR.DLL BHO: Java Plug-In 2 SSV Helper: {DBC80044-A445-435b-BC74-9C25C1C588A9} - c:program filesjavajre7binjp2ssv.dll BHO: YTD Toolbar: {F3FEE66E-E034-436a-86E4-9690573BEE8A} - TB: <No Name>: {E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39} - LocalServer32 - <no file> TB: AVG Security Toolbar: {95B7759C-8C7F-4BF1-B163-73684A933233} - c:program filesavg secure search17.0.1.12AVG Secure Search_toolbar.dll TB: privitize Toolbar: {1C46A0DD-D53E-46C4-A435-CA11103E255E} - c:program filesindustriyaprivitize1.8.21.6privitizeTlbr.dll TB: YTD Toolbar: {F3FEE66E-E034-436a-86E4-9690573BEE8A} - uRun: [DAEMON Tools Lite] "c:program filesdaemon tools liteDTLite.exe" -autorun uRun: [sidebar] c:program fileswindows sidebarsidebar.exe /autoRun uRun: [skype] "c:program filesskypephoneSkype.exe" /minimized /regrun uRun: [Clownfish] "c:program filesclownfishClownfish.exe" uRun: [Akamai NetSession Interface] "c:usersuserappdatalocalakamainetsession_win.exe" mRun: [bCSSync] "c:program filesmicrosoft officeoffice14BCSSync.exe" /DelayServices mRun: [ZSSnp211] c:windowsZSSnp211.exe mRun: [Google Desktop Search] "c:program filesgooglegoogle desktop searchGoogleDesktop.exe" /startup mRun: [MSC] "c:program filesmicrosoft security clientmsseces.exe" -hide -runkey mRun: [vProt] "c:program filesavg secure searchvprot.exe" mRun: [Driver Genius] <no file> mPolicies-System: ConsentPromptBehaviorUser = dword:3 mPolicies-System: EnableUIADesktopToggle = dword:0 IE: Download all by FlashGet3 - c:program filesflashget networkflashget 3GetAllUrl.htm IE: Download by FlashGet3 - c:program filesflashget networkflashget 3GetUrl.htm IE: E&xport to Microsoft Excel - c:progra~1micros~2office14EXCEL.EXE/3000 IE: Free YouTube Download - c:usersuserappdataroamingdvdvideosoftiehelpersfreeytvdownloader.htm IE: Free YouTube to MP3 Converter - c:usersuserappdataroamingdvdvideosoftiehelpersfreeyoutubetomp3converter.htm IE: Se&nd to OneNote - c:progra~1micros~2office14ONBttnIE.dll/105 IE: ????3?? - <no file> IE: ????3?????? - <no file> IE: {2670000A-7350-4f3c-8081-5663EE0C6C49} - {48E73304-E1D6-4330-914C-F5F514E3486C} - c:program filesmicrosoft officeoffice14ONBttnIE.dll IE: {789FE86F-6FC4-46A1-9849-EDE0DB0C95CA} - {FFFDC614-B694-4AE6-AB38-5D6374584B52} - c:program filesmicrosoft officeoffice14ONBttnIELinkedNotes.dll IE: {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - c:program filesskypetoolbarsinternet explorerskypeieplugin.dll Trusted Zone: clonewarsadventures.com Trusted Zone: freerealms.com Trusted Zone: soe.com Trusted Zone: sony.com TCP: NameServer = TCP: Interfaces{2C4E44DB-F385-4EEB-A10C-DCAB6B3D8099} : DHCPNameServer = Filter: text/xml - {807573E5-5146-11D5-A672-00B0D022E945} - c:program filescommon filesmicrosoft sharedoffice14MSOXMLMF.DLL Handler: skype-ie-addon-data - {91774881-D725-4E58-B298-07617B9B86A8} - c:program filesskypetoolbarsinternet explorerskypeieplugin.dll Handler: skype4com - {FFC8B962-9B40-4DFF-9458-1830C7DD7F5D} - c:program filescommon filesskypeSkype4COM.dll Handler: viprotocol - {B658800C-F66E-4EF3-AB85-6C0C227862A9} - c:program filescommon filesavg secure searchviprotocolinstaller17.0.12ViProtocol.dll Handler: wlpg - {E43EF6CD-A37A-4A9B-9E6F-83F89B8E6324} - c:program fileswindows livephoto galleryAlbumDownloadProtocolHandler.dll Notify: igfxcui - igfxdev.dll SSODL: WebCheck - <orphaned> SEH: Groove GFS Stub Execution Hook - {B5A7F190-DDA6-4420-B3BA-52453494E6CD} - c:program filesmicrosoft officeoffice14GROOVEEX.DLL LSA: Security Packages =  kerberos msv1_0 schannel wdigest tspkg pku2u livessp mASetup: {8A69D345-D564-463c-AFF1-A69D9E530F96} - "c:program filesgooglechromeapplication30.0.1599.69installerchrmstp.exe" --configure-user-settings --verbose-logging --system-level --multi-install --chrome . ================= FIREFOX =================== . FF - ProfilePath - c:usersuserappdataroamingmozillafirefoxprofilesptoklpuh.default FF - prefs.js: browser.search.defaulturl - FF - prefs.js: browser.search.selectedEngine - Search The Web (privitize) FF - plugin: c:progra~1micros~2office14NPAUTHZ.DLL FF - plugin: c:progra~1micros~2office14NPSPWRAP.DLL FF - plugin: c:program filescommon filesavg secure searchsitesafetyinstaller17.0.12npsitesafety.dll FF - plugin: c:program filesgooglegoogle earthpluginnpgeplugin.dll FF - plugin: c:program filesgoogleupdate1.3.21.153npGoogleUpdate3.dll FF - plugin: c:program filesjavajre7binplugin2npjp2.dll FF - plugin: c:program filesmicrosoft silverlight5.1.20513.0npctrlui.dll FF - plugin: c:program filesmywebsearchbar1.binNPMYWEBS.DLL FF - plugin: c:program filespando networksmedia boosternpPandoWebPlugin.dll FF - plugin: c:program fileswindows livephoto galleryNPWLPG.dll FF - plugin: c:programdatanexoneungmnpNxGameEU.dll FF - plugin: c:usersuserappdatalocalfacebookvideoskypenpFacebookVideoCalling.dll FF - plugin: c:windowssystem32macromedflashNPSWF32_11_8_800_168.dll FF - plugin: c:windowssystem32npDeployJava1.dll FF - plugin: c:windowssystem32npmproxy.dll . ---- FIREFOX POLICIES ---- FF - user.js: extensions.softonic_i.newTab - false FF - user.js: extensions.softonic_i.id - d65288460000000000002c27d72d77db FF - user.js: extensions.softonic_i.instlDay - 15401 FF - user.js: extensions.softonic_i.vrsn - FF - user.js: extensions.softonic_i.vrsni - FF - user.js: extensions.softonic_i.vrsnTs - FF - user.js: extensions.softonic_i.prtnrId - softonic FF - user.js: extensions.softonic_i.prdct - softonic FF - user.js: extensions.softonic_i.aflt - orgnl FF - user.js: extensions.softonic_i.smplGrp - eng7 FF - user.js: extensions.softonic_i.tlbrId - eng7 FF - user.js: extensions.softonic_i.instlRef - MON00001 FF - user.js: extensions.softonic_i.dfltLng - FF - user.js: extensions.softonic_i.excTlbr - false FF - user.js: extensions.privitize.id - d65288460000000000002c27d72d77db FF - user.js: extensions.privitize.appId - {301966DF-A84B-4255-AAB9-574B5CE237E4} FF - user.js: extensions.privitize.instlDay - 15876 FF - user.js: extensions.privitize.vrsn - FF - user.js: extensions.privitize.vrsni - FF - user.js: extensions.privitize.vrsnTs - FF - user.js: extensions.privitize.prtnrId - privitize FF - user.js: extensions.privitize.prdct - privitize FF - user.js: extensions.privitize.aflt - 5 FF - user.js: extensions.privitize.smplGrp - none FF - user.js: extensions.privitize.tlbrId - base FF - user.js: extensions.privitize.instlRef - FF - user.js: extensions.privitize.dfltLng - FF - user.js: extensions.privitize.excTlbr - false FF - user.js: extensions.privitize.ffxUnstlRst - false FF - user.js: extensions.privitize.admin - false FF - user.js: extensions.privitize.autoRvrt - false FF - user.js: extensions.privitize.rvrt - false FF - user.js: extensions.privitize.hmpg - true FF - user.js: extensions.privitize.dfltSrch - true FF - user.js: extensions.privitize.srchPrvdr - Search The Web (privitize) FF - user.js: extensions.privitize.dnsErr - true FF - user.js: extensions.privitize.newTab - true . ============= SERVICES / DRIVERS =============== . R0 MpFilter;Microsoft Malware Protection Driver;c:windowssystem32driversMpFilter.sys [2013-6-18 211560] R1 avgtp;avgtp;c:windowssystem32driversavgtpx86.sys [2012-7-22 37664] R1 dtsoftbus01;DAEMON Tools Virtual Bus Driver;c:windowssystem32driversdtsoftbus01.sys [2011-8-5 232512] R2 Application Updater;Application Updater;c:program filesapplication updaterApplicationUpdater.exe [2013-9-2 807800] R2 Hamachi2Svc;LogMeIn Hamachi Tunneling Engine;d:downloadsmyнова папкаhamachi-2.exe [2013-10-1 1612112] R2 MyWebSearchService;My Web Search Service;c:progra~1mywebs~1bar1.binmwssvc.exe [2011-9-19 34320] R2 RzKLService;RzKLService;d:mcrazer game boosterRzKLService.exe [2013-9-19 106472] R2 Skype C2C Service;Skype C2C Service;c:programdataskypetoolbarsskype c2c servicec2c_service.exe [2013-9-16 3273088] R2 TeamViewer8;TeamViewer 8;c:program filesteamviewerversion8TeamViewer_Service.exe [2013-8-16 4308320] R2 vToolbarUpdater17.0.12;vToolbarUpdater17.0.12;c:program filescommon filesavg secure searchvtoolbarupdater17.0.12ToolbarUpdater.exe [2013-10-2 1734680] R2 WindowsServices;Windows Debug Service;c:windowssystem32driverssfuservice.exe [2011-7-8 785920] R3 RTL8167;Realtek 8167 NT Driver;c:windowssystem32driversRt86win7.sys [2009-3-2 139776] S2 clr_optimization_v4.0.30319_32;Microsoft .NET Framework NGEN v4.0.30319_X86;c:windowsmicrosoft.netframeworkv4.0.30319mscorsvw.exe [2012-7-9 104912] S2 gupdate;Услуга на Google Актуализация (gupdate);c:program filesgoogleupdateGoogleUpdate.exe [2011-8-16 136176] S2 SkypeUpdate;Skype Updater;c:program filesskypeupdaterUpdater.exe [2013-6-21 162408] S3 AdobeFlashPlayerUpdateSvc;Adobe Flash Player Update Service;c:windowssystem32macromedflashFlashPlayerUpdateService.exe [2012-3-30 257416] S3 b57nd60x;Broadcom NetXtreme Gigabit Ethernet - NDIS 6.0;c:windowssystem32driversb57nd60x.sys [2009-7-14 229888] S3 dmvsc;dmvsc;c:windowssystem32driversdmvsc.sys [2010-11-21 62464] S3 GoogleDesktopManager-051210-111108;Диспечер на Google Desktop 5.9.1005.12335;c:program filesgooglegoogle desktop searchGoogleDesktop.exe [2011-9-10 30192] S3 gupdatem;Услуга на Google Актуализация (gupdatem);c:program filesgoogleupdateGoogleUpdate.exe [2011-8-16 136176] S3 Microsoft SharePoint Workspace Audit Service;Microsoft SharePoint Workspace Audit Service;c:program filesmicrosoft officeoffice14GROOVE.EXE [2012-9-20 30785672] S3 MozillaMaintenance;Mozilla Maintenance Service;c:program filesmozilla maintenance servicemaintenanceservice.exe [2012-7-22 118680] S3 NisDrv;Microsoft Network Inspection System;c:windowssystem32driversNisDrvWFP.sys [2011-4-27 107392] S3 NisSrv;Мрежова проверка на Microsoft;c:program filesmicrosoft security clientNisSrv.exe [2013-6-20 295376] S3 osppsvc;Office Software Protection Platform;c:program filescommon filesmicrosoft sharedofficesoftwareprotectionplatformOSPPSVC.EXE [2010-1-9 4640000] S3 RdpVideoMiniport;Remote Desktop Video Miniport Driver;c:windowssystem32driversrdpvideominiport.sys [2010-11-21 15872] S3 StorSvc;Storage Service;c:windowssystem32svchost.exe -k LocalSystemNetworkRestricted [2009-7-14 20992] S3 Synth3dVsc;Synth3dVsc;c:windowssystem32driversSynth3dVsc.sys [2010-11-21 77184] S3 terminpt;Microsoft Remote Desktop Input Driver;c:windowssystem32driversterminpt.sys [2010-11-21 25600] S3 TsUsbFlt;TsUsbFlt;c:windowssystem32driversTsUsbFlt.sys [2010-11-21 52224] S3 TsUsbGD;Remote Desktop Generic USB Device;c:windowssystem32driversTsUsbGD.sys [2010-11-21 27264] S3 tsusbhub;tsusbhub;c:windowssystem32driverstsusbhub.sys [2010-11-21 112640] S3 vvftav211;vvftav211;c:windowssystem32driversvvftav211.sys [2011-8-27 480128] S3 WatAdminSvc;Услуга на технологиите за активиране на Windows;c:windowssystem32watWatAdminSvc.exe [2011-8-5 1343400] S3 ZSMC30x;USB PC Camera Service ZSMC30x;c:windowssystem32driversZS211.sys [2011-8-27 1537024] . =============== Created Last 30 ================ . 2013-10-06 18:30:38  7328304  ----a-w-  c:programdatamicrosoftmicrosoft antimalwaredefinition updates{8127aff6-5691-460e-853c-9df99258f093}mpengine.dll 2013-10-05 17:39:19  --------  d-----w-  c:usersuserappdataroaming.minecraft 2013-10-05 17:28:55  7328304  ----a-w-  c:programdatamicrosoftmicrosoft antimalwaredefinition updatesbackupmpengine.dll 2013-10-03 10:17:21  --------  d-----w-  c:usersuserappdatalocalLogMeIn 2013-10-03 10:17:21  --------  d-----w-  c:programdataLogMeIn 2013-09-30 17:52:09  --------  d-----w-  c:program filesAcclaim Entertainment 2013-09-30 16:10:23  --------  d-----w-  c:program filesSimilarSites 2013-09-30 16:10:19  --------  d-----w-  c:usersuserappdataroamingSimilarSites 2013-09-11 17:49:49  --------  d-----w-  c:programdataNexon 2013-09-11 17:33:20  --------  d-----w-  c:programdataNexonEU 2013-09-11 16:49:56  --------  d-----w-  c:usersuserappdatalocalAkamai 2013-09-09 17:09:22  --------  d--h--w-  c:program filesTemp . ==================== Find3M  ==================== . 2013-10-02 15:06:23  37664  ----a-w-  c:windowssystem32driversavgtpx86.sys 2013-09-21 18:08:08  692616  ----a-w-  c:windowssystem32FlashPlayerApp.exe 2013-09-21 18:08:07  71048  ----a-w-  c:windowssystem32FlashPlayerCPLApp.cpl 2013-08-10 03:59:10  1767936  ----a-w-  c:windowssystem32wininet.dll 2013-08-10 03:58:09  2876928  ----a-w-  c:windowssystem32jscript9.dll 2013-08-10 03:58:06  61440  ----a-w-  c:windowssystem32iesetup.dll 2013-08-10 03:58:06  109056  ----a-w-  c:windowssystem32iesysprep.dll 2013-08-10 03:07:50  2706432  ----a-w-  c:windowssystem32mshtml.tlb 2013-08-10 02:17:19  71680  ----a-w-  c:windowssystem32RegisterIEPKEYs.exe 2013-08-08 01:03:07  2348544  ----a-w-  c:windowssystem32win32k.sys 2013-08-05 01:56:47  133056  ----a-w-  c:windowssystem32driversataport.sys 2013-08-02 01:50:36  169984  ----a-w-  c:windowssystem32winsrv.dll 2013-08-02 01:49:19  293376  ----a-w-  c:windowssystem32KernelBase.dll 2013-08-02 00:52:57  271360  ----a-w-  c:windowssystem32conhost.exe 2013-08-02 00:43:05  6144  ---ha-w-  c:windowssystem32api-ms-win-security-base-l1-1-0.dll 2013-08-02 00:43:05  4608  ---ha-w-  c:windowssystem32api-ms-win-core-threadpool-l1-1-0.dll 2013-08-02 00:43:05  3584  ---ha-w-  c:windowssystem32api-ms-win-core-xstate-l1-1-0.dll 2013-08-02 00:43:05  3072  ---ha-w-  c:windowssystem32api-ms-win-core-util-l1-1-0.dll 2013-07-25 08:57:27  1620992  ----a-w-  c:windowssystem32WMVDECOD.DLL 2013-07-19 01:41:01  2048  ----a-w-  c:windowssystem32tzres.dll . ============= FINISH: 19:15:00,70 ===============  








. UNLESS SPECIFICALLY INSTRUCTED, DO NOT POST THIS LOG. IF REQUESTED, ZIP IT UP & ATTACH IT . DDS (Ver_2011-09-30.01) . Microsoft Windows 7 Enterprise Boot Device: DeviceHarddiskVolume1 Install Date: 5.8.2011 г. 12:40:24 System Uptime: 7.10.2013 г. 18:14:02 (1 hours ago) . Motherboard: FOXCONN |  | 2A8C Processor: Pentium® Dual-Core  CPU   E5800  @ 3.20GHz | CPU 1 | 3203/800mhz . ==== Disk Partitions ========================= . C: is FIXED (NTFS) - 49 GiB total, 18,056 GiB free. D: is FIXED (NTFS) - 249 GiB total, 163,313 GiB free. E: is CDROM (CDFS) F: is CDROM () G: is Removable H: is CDROM () . ==== Disabled Device Manager Items ============= . ==== System Restore Points =================== . RP452: 6.10.2013 г. 21:30:22 - Windows Update . ==== Installed Programs ====================== .  toolbar   Фотогалерия на Windows Live µTorrent Русификатор Rettungswagen Simulator 2012 4x4 Hummer Ace of Spades Adobe AIR Adobe Download Assistant Adobe Flash Player 11 ActiveX Adobe Flash Player 11 Plugin Akamai NetSession Interface Animated Wallpaper - Snowy Desktop 3D Apple Software Update Bandisoft MPEG-1 Decoder BeamNG-Techdemo-0.3 (remove only) Cabela's 4x4 Off-Road Adventure  2 Call of Juarez Camtasia Studio 8 CCleaner ClipGrab Clownfish for Skype Combat Arms EU Counter-Strike 1.6 Counter-Strike 1.6 Escom 3d!7!0n - by AmaRelle v1.0 Counter-Strike 1.6: New Era Counter-Strike Mega Edition v2.0 Counter-Strike Source, версия 1765266 Craften Terminal 3.3.4897.28268 CSS_Update_from_v1765266_to_v1765266_210513 1.00 D3DX10 DAEMON Tools Lite Dead Space™ Decal Converter Deer Hunter 2004 - Legendary Hunting Definition Update for Microsoft Office 2010 (KB982726) 32-Bit Edition DJ Studio Pro Driver Genius Professional Edition Driver Sweeper version 3.2.0 Dxtory License Cracked Dxtory version 2.0.112 Euro Truck Simulator 2 Facebook Video Calling FIFA 11 FormatFactory 3.0.1 Fraps (remove only) Free Studio version GamersFirst LIVE! German Truck Simulator Google Земя Google Chrome Google Desktop Google Update Helper Grand Theft Auto Vice City GTA San Andreas Hero_Online Iminent IMinent Toolbar Intel Drivers Update Utility Intel® Graphics Media Accelerator Driver ItaEst - Taka e! Java 7 Update 25 Java Auto Updater Java 6 Update 31 JavaFX 2.1.1 K-Lite Codec Pack 7.5.0 (Standard) League of Legends LogMeIn Hamachi Magic The Gathering Tactics MagniPic Malwarebytes Anti-Malware, версия Medal of Honor Microsoft .NET Framework 1.1 Microsoft .NET Framework 4.5 Microsoft Antimalware Service BG-BG Language Pack Microsoft Application Error Reporting Microsoft Games for Windows - LIVE Microsoft Games for Windows - LIVE Redistributable Microsoft Office 2010 Service Pack 1 (SP1) Microsoft Office Access MUI (English) 2010 Microsoft Office Access Setup Metadata MUI (English) 2010 Microsoft Office Excel MUI (English) 2010 Microsoft Office Groove MUI (English) 2010 Microsoft Office InfoPath MUI (English) 2010 Microsoft Office OneNote MUI (English) 2010 Microsoft Office Outlook MUI (English) 2010 Microsoft Office PowerPoint MUI (English) 2010 Microsoft Office Professional Plus 2010 Microsoft Office Proof (English) 2010 Microsoft Office Proof (French) 2010 Microsoft Office Proof (Spanish) 2010 Microsoft Office Proofing (English) 2010 Microsoft Office Publisher MUI (English) 2010 Microsoft Office Shared MUI (English) 2010 Microsoft Office Shared Setup Metadata MUI (English) 2010 Microsoft Office Word MUI (English) 2010 Microsoft Security Client Microsoft Security Client BG-BG Language Pack Microsoft Security Essentials Microsoft Silverlight Microsoft SQL Server 2005 Compact Edition [ENU] Microsoft Visual C++ 2005 Redistributable Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.17 Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.6161 Microsoft XNA Framework Redistributable 4.0 Minecraft Minecraft 1.6.2 Minecraft1.6.2 Mozilla Firefox 24.0 (x86 bg) Mozilla Maintenance Service MSVCRT MSVCRT Redists MSXML 4.0 SP2 (KB954430) MSXML 4.0 SP2 (KB973688) MTA:SA v1.3.1 My Web Search (MyWebFace) Need For Speed™ World Nokia Connectivity Cable Driver NVIDIA PhysX OMSI - Der Omnibussimulator OpenAL Opera 12.14 Pando Media Booster PunkBuster Services Race Driver: GRID Razer Game Booster Realtek High Definition Audio Driver Recuva Revolt Safari Security Update for CAPICOM (KB931906) Security Update for Microsoft .NET Framework 4.5 (KB2737083) Security Update for Microsoft .NET Framework 4.5 (KB2742613) Security Update for Microsoft .NET Framework 4.5 (KB2789648) Security Update for Microsoft .NET Framework 4.5 (KB2804582) Security Update for Microsoft .NET Framework 4.5 (KB2833957) Security Update for Microsoft .NET Framework 4.5 (KB2840642v2) Security Update for Microsoft Excel 2010 (KB2597126) 32-Bit Edition Security Update for Microsoft Filter Pack 2.0 (KB2553501) 32-Bit Edition Security Update for Microsoft InfoPath 2010 (KB2687417) 32-Bit Edition Security Update for Microsoft InfoPath 2010 (KB2687422) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2553091) Security Update for Microsoft Office 2010 (KB2553096) Security Update for Microsoft Office 2010 (KB2553371) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2553447) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2589320) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2598243) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2687501) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2687510) 32-Bit Edition Security Update for Microsoft OneNote 2010 (KB2760600) 32-Bit Edition Security Update for Microsoft Visio 2010 (KB2760762) 32-Bit Edition Security Update for Microsoft Visio Viewer 2010 (KB2687505) 32-Bit Edition Security Update for Microsoft Word 2010 (KB2760410) 32-Bit Edition Skype Click to Call Skype™ 6.6 Speccy Steam System Requirements Lab CYRI System Requirements Lab for Intel TeamViewer 8 TOAoT-315-UTMod-v2 uGet, версия 2.0.6 Update for Microsoft .NET Framework 4.5 (KB2750147) Update for Microsoft .NET Framework 4.5 (KB2805221) Update for Microsoft .NET Framework 4.5 (KB2805226) Update for Microsoft Office 2010 (KB2494150) Update for Microsoft Office 2010 (KB2553065) Update for Microsoft Office 2010 (KB2553092) Update for Microsoft Office 2010 (KB2553181) 32-Bit Edition Update for Microsoft Office 2010 (KB2553267) 32-Bit Edition Update for Microsoft Office 2010 (KB2553310) 32-Bit Edition Update for Microsoft Office 2010 (KB2553378) 32-Bit Edition Update for Microsoft Office 2010 (KB2566458) Update for Microsoft Office 2010 (KB2596964) 32-Bit Edition Update for Microsoft Office 2010 (KB2598242) 32-Bit Edition Update for Microsoft Office 2010 (KB2687503) 32-Bit Edition Update for Microsoft Office 2010 (KB2687509) 32-Bit Edition Update for Microsoft Office 2010 (KB2760631) 32-Bit Edition Update for Microsoft Office 2010 (KB2767886) 32-Bit Edition Update for Microsoft OneNote 2010 (KB2553290) 32-Bit Edition Update for Microsoft Outlook 2010 (KB2597090) 32-Bit Edition Update for Microsoft Outlook 2010 (KB2687623) 32-Bit Edition Update for Microsoft Outlook Social Connector 2010 (KB2553406) 32-Bit Edition Update for Microsoft PowerPoint 2010 (KB2553145) 32-Bit Edition Update for Microsoft PowerPoint 2010 (KB2598240) 32-Bit Edition Update for Microsoft SharePoint Workspace 2010 (KB2589371) 32-Bit Edition Vegas Pro 10.0 Vegas Pro 11.0 VirtualDJ Home FREE Windows Live Communications Platform Windows Live Essentials Windows Live ID Sign-in Assistant Windows Live Installer Windows Live Movie Maker Windows Live Photo Common Windows Live Photo Gallery Windows Live PIMT Platform Windows Live SOXE Windows Live SOXE Definitions Windows Live UX Platform Windows Live UX Platform Language Pack WinRAR 4.01 (32-bit) WolfQuest World of Warcraft Trial YTD Toolbar v7.6 ZSMC USB PC Camera (ZS0211) . ==== Event Viewer Messages From Past Week ======== . 7.10.2013 г. 18:14:19, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 7.10.2013 г. 15:48:24, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 7.10.2013 г. 15:48:24, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 7.10.2013 г. 14:00:17, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 21:19:09, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 17:01:23, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 14:51:05, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 6.10.2013 г. 14:51:05, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 6.10.2013 г. 14:18:05, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 02:02:15, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 6.10.2013 г. 02:02:15, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 5.10.2013 г. 21:55:16, Error: volsnap [36]  - The shadow copies of volume C: were aborted because the shadow copy storage could not grow due to a user imposed limit. 5.10.2013 г. 21:29:31, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 5.10.2013 г. 20:07:11, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 5.10.2013 г. 20:07:11, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 5.10.2013 г. 18:58:06, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 5.10.2013 г. 14:12:14, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 5.10.2013 г. 12:45:09, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 4.10.2013 г. 22:51:38, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 4.10.2013 г. 19:20:14, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 4.10.2013 г. 19:20:14, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 4.10.2013 г. 17:06:51, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 4.10.2013 г. 17:06:51, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 4.10.2013 г. 16:37:10, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 4.10.2013 г. 16:37:09, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 4.10.2013 г. 15:27:47, Error: bowser [8003]  - The master browser has received a server announcement from the computer SKIOOOO-PC that believes that it is the master browser for the domain on transport NetBT_Tcpip_{86D84905-0331-4FB8-A5E0-AAB038C. The master browser is stopping or an election is being forced. 4.10.2013 г. 13:20:44, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 30.9.2013 г. 21:07:08, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 21:07:08, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 20:14:39, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 20:14:39, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 20:11:32, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 30.9.2013 г. 18:28:52, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 18:28:52, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 18:01:50, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 30.9.2013 г. 15:08:31, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 15:08:31, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 14:46:07, Error: bowser [8003]  - The master browser has received a server announcement from the computer SKIOOOO-PC that believes that it is the master browser for the domain on transport NetBT_Tcpip_{86D84905-0331-4FB8-A5E0-AAB038C. The master browser is stopping or an election is being forced. 30.9.2013 г. 14:43:25, Error: volsnap [36]  - The shadow copies of volume C: were aborted because the shadow copy storage could not grow due to a user imposed limit. 30.9.2013 г. 13:51:20, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 3.10.2013 г. 19:57:52, Error: bowser [8003]  - The master browser has received a server announcement from the computer SKIOOOO-PC that believes that it is the master browser for the domain on transport NetBT_Tcpip_{86D84905-0331-4FB8-A5E0-AAB038C. The master browser is stopping or an election is being forced. 3.10.2013 г. 15:14:42, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 3.10.2013 г. 15:14:42, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 3.10.2013 г. 14:56:51, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 3.10.2013 г. 14:56:51, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 3.10.2013 г. 14:18:33, Error: volsnap [36]  - The shadow copies of volume C: were aborted because the shadow copy storage could not grow due to a user imposed limit. 3.10.2013 г. 13:16:54, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 2.10.2013 г. 19:41:38, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 2.10.2013 г. 19:41:38, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 2.10.2013 г. 18:07:00, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга LogMeIn Hamachi Tunneling Engine да се свърже. 2.10.2013 г. 18:07:00, Error: Service Control Manager [7000]  - Услуга LogMeIn Hamachi Tunneling Engine не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 2.10.2013 г. 18:06:36, Error: Service Control Manager [7030]  - Услуга LogMeIn Hamachi Tunneling Engine е маркирана като интерактивна услуга. Обаче системата е конфигурирана да не допуска интерактивни услуги. Тази услуга може да не функционира правилно. 2.10.2013 г. 18:05:49, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 1.10.2013 г. 21:20:10, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 1.10.2013 г. 21:20:10, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 1.10.2013 г. 19:11:04, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 1.10.2013 г. 19:11:04, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 1.10.2013 г. 18:14:14, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 1.10.2013 г. 16:14:45, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 1.10.2013 г. 16:14:45, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 1.10.2013 г. 15:22:26, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. . ==== End Of File ===========================  

Сподели този отговор

Линк към този отговор
Сподели в други сайтове





# AdwCleaner v3.006 - Report created 08/10/2013 at 14:17:20
# Updated 01/10/2013 by Xplode
# Operating System : Windows 7 Enterprise Service Pack 1 (32 bits)
# Username : User - HP
# Running from : C:UsersUserDownloadsadwcleaner.exe
# Option : Clean

***** [ Services ] *****

Service Deleted : Application Updater
Service Deleted : MyWebSearchService

***** [ Files / Folders ] *****

Folder Deleted : C:ProgramDataAVG Secure Search
Folder Deleted : C:ProgramDataBabylon
Folder Deleted : C:ProgramDataclsoft ltd
Folder Deleted : C:ProgramDataIminent
Folder Deleted : C:ProgramDataPremium
Folder Deleted : C:ProgramDataMaginiPPicc
Folder Deleted : C:ProgramDataMicrosoftWindowsStart MenuProgramsTheBflix
Folder Deleted : C:ProgramDataMicrosoftWindowsStart MenuProgramsMaginiPPicc
Folder Deleted : C:Program FilesApplication Updater
Folder Deleted : C:Program FilesAVG Secure Search
Folder Deleted : C:Program FilesIndustriya
Folder Deleted : C:Program FilesMagniPic
Folder Deleted : C:Program FilesMyWebSearch
Folder Deleted : C:Program FilesSimilarSites
Folder Deleted : C:Program FilesCommon FilesAVG Secure Search
Folder Deleted : C:Program FilesCommon Filesspigot
Folder Deleted : C:UsersUserAppDataLocalAVG Secure Search
Folder Deleted : C:UsersUserAppDataLocalBabylon
Folder Deleted : C:UsersUserAppDataLocalLowAVG Secure Search
Folder Deleted : C:UsersUserAppDataLocalLowFunWebProducts
Folder Deleted : C:UsersUserAppDataLocalLowIndustriya
Folder Deleted : C:UsersUserAppDataLocalLowMyWebSearch
Folder Deleted : C:UsersUserAppDataLocalLowSearch Settings
Folder Deleted : C:UsersUserAppDataLocalLowTheBflix
Folder Deleted : C:UsersUserAppDataLocalLowMaginiPPicc
Folder Deleted : C:UsersUserAppDataRoamingdvdvideosoftiehelpers
Folder Deleted : C:UsersUserAppDataRoamingIminent
Folder Deleted : C:UsersUserAppDataRoamingIndustriya
Folder Deleted : C:UsersUserAppDataRoamingSimilarSites
File Deleted : C:END
File Deleted : C:Program FilesMozilla Firefoxsearchpluginsavg-secure-search.xml
File Deleted : C:Program FilesMozilla FirefoxsearchpluginsBabylon.xml
File Deleted : C:UsersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultsearchpluginsSearchTheWeb.xml
File Deleted : C:UsersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultuser.js

***** [ Shortcuts ] *****

***** [ Registry ] *****

Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [{ACAA314B-EEBA-48E4-AD47-84E31C44796C}]
Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [Avg@toolbar]
Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [m3ffxtbr@mywebsearch.com]
Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [webbooster@iminent.com]
Key Deleted : HKLMSOFTWAREGoogleChromeExtensionsigdhbblpcellaljokkpfhcjlagemhgjl
Key Deleted : HKLMSOFTWAREGoogleChromeExtensionsndibdjnfmopecpmkdieinmbadjfpblof
Key Deleted : HKLMSOFTWAREClassesAppIDescort.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDescortApp.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDescortEng.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDescorTlbr.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDesrv.EXE
Key Deleted : HKLMSOFTWAREClassesAppIDIminent.WebBooster.InternetExplorer.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDScriptHelper.EXE
Key Deleted : HKLMSOFTWAREClassesAppIDTbCommonUtils.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDTbHelper.EXE
Key Deleted : HKLMSOFTWAREClassesAppIDViProtocol.DLL
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.BrowserWndAPI
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.BrowserWndAPI.1
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.PugiObj
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.PugiObj.1
Key Deleted : HKLMSOFTWAREClassesbhoclass.bho.bhoclass.bho
Key Deleted : HKLMSOFTWAREClassesescort.escortIEPane
Key Deleted : HKLMSOFTWAREClassesescort.escortIEPane.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.DataControl
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.DataControl.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistoryKillerScheduler
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistoryKillerScheduler.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistorySwatterControlBar
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistorySwatterControlBar.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HTMLMenu
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HTMLMenu.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HTMLMenu.2
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.IECookiesManager
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.IECookiesManager.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.KillerObjManager
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.KillerObjManager.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterBarButton
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterBarButton.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterSettingsControl
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterSettingsControl.1
Key Deleted : HKLMSOFTWAREClassesIminent
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ChatSessionPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ChatSessionPlugin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.HTMLPanel
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.HTMLPanel.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.MultipleButton
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.MultipleButton.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.OutlookAddin
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.OutlookAddin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.PseudoTransparentPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.PseudoTransparentPlugin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ThirdPartyInstaller
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ThirdPartyInstaller.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.UrlAlertButton
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.UrlAlertButton.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.SettingsPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.SettingsPlugin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.ToolbarPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.ToolbarPlugin.1
Key Deleted : HKLMSOFTWAREClassesprivitize.privitizeHlpr
Key Deleted : HKLMSOFTWAREClassesprivitize.privitizeHlpr.1
Key Deleted : HKLMSOFTWAREClassesProd.cap
Key Deleted : HKLMSOFTWAREClassesprotocolshandlerviprotocol
Key Deleted : HKLMSOFTWAREClassesS
Key Deleted : HKLMSOFTWAREClassesScreenSaverControl.ScreenSaverInstaller
Key Deleted : HKLMSOFTWAREClassesScreenSaverControl.ScreenSaverInstaller.1
Key Deleted : HKLMSOFTWAREClassesScriptHelper.ScriptHelperApi
Key Deleted : HKLMSOFTWAREClassesScriptHelper.ScriptHelperApi.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbDownloadManager
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbDownloadManager.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbPropertyManager
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbPropertyManager.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbRequest
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbRequest.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbTask
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbTask.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.ToolbarHelper
Key Deleted : HKLMSOFTWAREClassesTbHelper.ToolbarHelper.1
Key Deleted : HKLMSOFTWAREClassesToolbar3.ContextMenuNotifier
Key Deleted : HKLMSOFTWAREClassesToolbar3.ContextMenuNotifier.1
Key Deleted : HKLMSOFTWAREClassesToolbar3.CustomInternetSecurityImpl
Key Deleted : HKLMSOFTWAREClassesToolbar3.CustomInternetSecurityImpl.1
Key Deleted : HKLMSOFTWAREClassesViProtocol.ViProtocolOLE
Key Deleted : HKLMSOFTWAREClassesViProtocol.ViProtocolOLE.1
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsRunDll32Policyf3ScrCtr.dll
Key Deleted : HKLMSOFTWAREMicrosoftMultimediaWMPlayerSchemesf3pss
Key Deleted : HKLMSOFTWAREMicrosoftOfficeOutlookAddinsMyWebSearch.OutlookAddin
Key Deleted : HKLMSOFTWAREMicrosoftOfficeWordAddinsMyWebSearch.OutlookAddin
Key Deleted : HKLMSOFTWAREMicrosoftShared ToolsMSConfigstartupregIminent
Key Deleted : HKLMSOFTWAREMicrosoftShared ToolsMSConfigstartupregIminentMessenger
Key Deleted : HKLMSOFTWAREMicrosoftTracingAskPIP_FF__RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingAskPIP_FF__RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingIminent_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingIminent_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingsoftonic_ggl_1_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingsoftonic_ggl_1_RASMANCS
Value Deleted : HKLMSOFTWAREMicrosoftWindows MediaWmsdkSources [F3PopularScreenSavers]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionInternet Settings5.0User AgentPost Platform [FunWebProducts]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionInternet SettingsUser Agentpost platform [FunWebProducts]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionRun [searchSettings]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionRun [vProt]
Key Deleted : HKLMSOFTWAREMozillaPlugins@avg.com/AVG SiteSafety plugin,version=,application/x-avg-sitesafety-plugin
Key Deleted : HKLMSOFTWAREMozillaPlugins@mywebsearch.com/Plugin
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstallSP_d8283021
Key Deleted : HKLMSOFTWAREClassesTBSB01620.IEToolbar
Key Deleted : HKLMSOFTWAREClassesTBSB01620.IEToolbar.1
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_brawl-busters_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_brawl-busters_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_c-medieval_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_c-medieval_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_camstudio_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_camstudio_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_everest_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_everest_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_flashget_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_flashget_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_format-factory_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_format-factory_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gravity-defied---trial-racing_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gravity-defied---trial-racing_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas(1)_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas(1)_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hamachi_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hamachi_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_happy-wheels_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_happy-wheels_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hero-online_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hero-online_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_league-of-legends_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_league-of-legends_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_microsoft-flight-simulator_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_microsoft-flight-simulator_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_san-andreas-multiplayer_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_san-andreas-multiplayer_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_second-life_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_second-life_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_sony-vegas-video_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_sony-vegas-video_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_tactical-ops-assault-on-terror_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_tactical-ops-assault-on-terror_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_talking-tom-cat_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_talking-tom-cat_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_virtual-families_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_virtual-families_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_world-of-warcraft_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_world-of-warcraft_RASMANCS
Key Deleted : HKLMSOFTWAREClassesAppID{01994268-3C10-4044-A1EA-7A9C1B739A11}
Key Deleted : HKLMSOFTWAREClassesAppID{09C554C3-109B-483C-A06B-F14172F1A947}
Key Deleted : HKLMSOFTWAREClassesAppID{1FDFF5A2-7BB1-48E1-8081-7236812B12B2}
Key Deleted : HKLMSOFTWAREClassesAppID{4CE516A7-F7AC-4628-B411-8F886DC5733E}
Key Deleted : HKLMSOFTWAREClassesAppID{4E1E9D45-8BF9-4139-915C-9F83CC3D5921}
Key Deleted : HKLMSOFTWAREClassesAppID{628F3201-34D0-49C0-BB9A-82A26AEFB291}
Key Deleted : HKLMSOFTWAREClassesAppID{B12E99ED-69BD-437C-86BE-C862B9E5444D}
Key Deleted : HKLMSOFTWAREClassesAppID{BB711CB0-C70B-482E-9852-EC05EBD71DBB}
Key Deleted : HKLMSOFTWAREClassesAppID{D7EE8177-D51E-4F89-92B6-83EA2EC40800}
Key Deleted : HKLMSOFTWAREClassesCLSID{02054E11-5113-4BE3-8153-AA8DFB5D3761}
Key Deleted : HKLMSOFTWAREClassesCLSID{02C9C7B0-C7C8-4AAC-A9E4-55295BF60F8F}
Key Deleted : HKLMSOFTWAREClassesCLSID{0398B101-6DA7-473F-A290-17D2FBC88CC0}
Key Deleted : HKLMSOFTWAREClassesCLSID{08858AF6-42AD-4914-95D2-AC3AB0DC8E28}
Key Deleted : HKLMSOFTWAREClassesCLSID{0CC36196-8589-4B80-A771-D659411D7F90}
Key Deleted : HKLMSOFTWAREClassesCLSID{0F8ECF4F-3646-4C3A-8881-8E138FFCAF70}
Key Deleted : HKLMSOFTWAREClassesCLSID{143D96F9-EB64-48B3-B192-91C2C41A1F43}
Key Deleted : HKLMSOFTWAREClassesCLSID{147A976F-EEE1-4377-8EA7-4716E4CDD239}
Key Deleted : HKLMSOFTWAREClassesCLSID{14F7D91F-F669-45C9-9F42-BACBFDB86EAD}
Key Deleted : HKLMSOFTWAREClassesCLSID{187A6488-6E71-4A2A-B118-7BEFBFE58257}
Key Deleted : HKLMSOFTWAREClassesCLSID{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKLMSOFTWAREClassesCLSID{25560540-9571-4D7B-9389-0F166788785A}
Key Deleted : HKLMSOFTWAREClassesCLSID{2D065204-A024-4C39-8A38-EE7078EC7ACF}
Key Deleted : HKLMSOFTWAREClassesCLSID{30F5476C-677B-4DB0-B397-51F5BFD86840}
Key Deleted : HKLMSOFTWAREClassesCLSID{3223F2FB-D9B9-45FC-9D66-CD717FFA4EE5}
Key Deleted : HKLMSOFTWAREClassesCLSID{351798B1-C1D2-45AB-92B4-4D6C2D6AB5AF}
Key Deleted : HKLMSOFTWAREClassesCLSID{35B8892D-C3FB-4D88-990D-31DB2EBD72BD}
Key Deleted : HKLMSOFTWAREClassesCLSID{3AEA1BEF-6195-46F4-ACA2-0ED14F7EFA1B}
Key Deleted : HKLMSOFTWAREClassesCLSID{3D7F9AC3-BAC3-4E51-81D7-D121D79E550A}
Key Deleted : HKLMSOFTWAREClassesCLSID{3DC201FB-E9C9-499C-A11F-23C360D7C3F8}
Key Deleted : HKLMSOFTWAREClassesCLSID{3E720452-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesCLSID{4498C5E9-93C6-4142-B6BE-F0C6DC48B77A}
Key Deleted : HKLMSOFTWAREClassesCLSID{479BF2D6-E362-4A99-B1AB-BC764D7B97AE}
Key Deleted : HKLMSOFTWAREClassesCLSID{492A108F-51D0-4BD8-899D-AD4AB2893064}
Key Deleted : HKLMSOFTWAREClassesCLSID{4B6D6E60-FBD2-4E79-BF4B-886BC98F1797}
Key Deleted : HKLMSOFTWAREClassesCLSID{4E92DB5F-AAD9-49D3-8EAB-B40CBE5B1FF7}
Key Deleted : HKLMSOFTWAREClassesCLSID{60893E02-2E5B-43F9-A93A-BAD60C2DF6EF}
Key Deleted : HKLMSOFTWAREClassesCLSID{63D0ED2C-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREClassesCLSID{67FA02C4-AB30-4E77-A640-78EE8EC8673B}
Key Deleted : HKLMSOFTWAREClassesCLSID{6D39931F-451E-4BDD-BAF4-37FB96DBBA5D}
Key Deleted : HKLMSOFTWAREClassesCLSID{7473D292-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{7473D294-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{7473D296-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{76C684D2-C35D-4284-976A-D862F53ADB81}
Key Deleted : HKLMSOFTWAREClassesCLSID{796D822A-C3F9-4A97-BAAB-42FE7628EA63}
Key Deleted : HKLMSOFTWAREClassesCLSID{799391D3-EB86-4BAC-9BD3-CBFEA58A0E15}
Key Deleted : HKLMSOFTWAREClassesCLSID{79EF3691-EC1A-4705-A01A-D2E36EC11758}
Key Deleted : HKLMSOFTWAREClassesCLSID{819FFE22-35C7-4925-8CDA-4E0E2DB94302}
Key Deleted : HKLMSOFTWAREClassesCLSID{82F41418-8E64-47EB-A7F1-4702A974D289}
Key Deleted : HKLMSOFTWAREClassesCLSID{84DA4FDF-A1CF-4195-8688-3E961F505983}
Key Deleted : HKLMSOFTWAREClassesCLSID{85D920CE-63A7-46DC-8992-41D1D2E07FAD}
Key Deleted : HKLMSOFTWAREClassesCLSID{895ED5E8-ABB4-40C3-A0CA-2571964268E2}
Key Deleted : HKLMSOFTWAREClassesCLSID{898EA8C8-E7FF-479B-8935-AEC46303B9E5}
Key Deleted : HKLMSOFTWAREClassesCLSID{8AAC123A-1959-4A45-BFC5-E2D50783098A}
Key Deleted : HKLMSOFTWAREClassesCLSID{8E6F1832-9607-4440-8530-13BE7C4B1D14}
Key Deleted : HKLMSOFTWAREClassesCLSID{933B95E2-E7B7-4AD9-B952-7AC336682AE3}
Key Deleted : HKLMSOFTWAREClassesCLSID{938AA51A-996C-4884-98CE-80DD16A5C9DA}
Key Deleted : HKLMSOFTWAREClassesCLSID{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKLMSOFTWAREClassesCLSID{98D9753D-D73B-42D5-8C85-4469CDA897AB}
Key Deleted : HKLMSOFTWAREClassesCLSID{9AFB8248-617F-460D-9366-D71CDEDA3179}
Key Deleted : HKLMSOFTWAREClassesCLSID{9FF05104-B030-46FC-94B8-81276E4E27DF}
Key Deleted : HKLMSOFTWAREClassesCLSID{A07956CD-81F8-4A03-B524-5D87E690DC83}
Key Deleted : HKLMSOFTWAREClassesCLSID{A4730EBE-43A6-443E-9776-36915D323AD3}
Key Deleted : HKLMSOFTWAREClassesCLSID{A9571378-68A1-443D-B082-284F960C6D17}
Key Deleted : HKLMSOFTWAREClassesCLSID{ADB01E81-3C79-4272-A0F1-7B2BE7A782DC}
Key Deleted : HKLMSOFTWAREClassesCLSID{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKLMSOFTWAREClassesCLSID{B25AEDC4-8086-41E3-8349-328223FA9FCB}
Key Deleted : HKLMSOFTWAREClassesCLSID{B5E3B26B-6E5C-4865-A63D-58D04B10E245}
Key Deleted : HKLMSOFTWAREClassesCLSID{B658800C-F66E-4EF3-AB85-6C0C227862A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{B813095C-81C0-4E40-AA14-67520372B987}
Key Deleted : HKLMSOFTWAREClassesCLSID{B84D2DC5-42B2-4E5E-BF61-7B48152FF8EF}
Key Deleted : HKLMSOFTWAREClassesCLSID{B89D5309-0367-4494-A92F-3D4C94F88307}
Key Deleted : HKLMSOFTWAREClassesCLSID{C014EBF8-8854-448B-B5A4-557C4090EDCE}
Key Deleted : HKLMSOFTWAREClassesCLSID{C31191DB-2F64-464C-B97C-6AC81ACB7AAC}
Key Deleted : HKLMSOFTWAREClassesCLSID{C342C7A7-F622-4EF3-8B7F-ABB9FBE73F14}
Key Deleted : HKLMSOFTWAREClassesCLSID{C4765B07-BC2F-477B-925C-B2BF24887823}
Key Deleted : HKLMSOFTWAREClassesCLSID{C875C0A1-09E3-48D5-9F8E-BD337796FD14}
Key Deleted : HKLMSOFTWAREClassesCLSID{C9D7BE3E-141A-4C85-8CD6-32461F3DF2C7}
Key Deleted : HKLMSOFTWAREClassesCLSID{CD126DA6-FF5B-4181-AC13-54A62240D2FA}
Key Deleted : HKLMSOFTWAREClassesCLSID{CFF4CE82-3AA2-451F-9B77-7165605FB835}
Key Deleted : HKLMSOFTWAREClassesCLSID{D858DAFC-9573-4811-B323-7011A3AA7E61}
Key Deleted : HKLMSOFTWAREClassesCLSID{D9FFFB27-D62A-4D64-8CEC-1FF006528805}
Key Deleted : HKLMSOFTWAREClassesCLSID{DD438708-AAB4-422D-A322-B619589F5680}
Key Deleted : HKLMSOFTWAREClassesCLSID{DE9028D0-5FFA-4E69-94E3-89EE8741F468}
Key Deleted : HKLMSOFTWAREClassesCLSID{E79DFBCA-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesCLSID{E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39}
Key Deleted : HKLMSOFTWAREClassesCLSID{E812AE43-7799-4E67-8CF8-4104297A2D16}
Key Deleted : HKLMSOFTWAREClassesCLSID{F0BAAEC7-9AE0-49FF-9C4B-86E774FF397F}
Key Deleted : HKLMSOFTWAREClassesCLSID{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKLMSOFTWAREClassesCLSID{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKLMSOFTWAREClassesCLSID{F92193FD-2243-4401-9ACC-49FF30885898}
Key Deleted : HKLMSOFTWAREClassesCLSID{FD21B8A2-910B-45AC-9C10-45E6A8B84984}
Key Deleted : HKLMSOFTWAREClassesInterface{01947140-417F-46B6-8751-A3A2B8345E1A}
Key Deleted : HKLMSOFTWAREClassesInterface{021B4049-F57D-4565-A693-FD3B04786BFA}
Key Deleted : HKLMSOFTWAREClassesInterface{0362AA09-808D-48E9-B360-FB51A8CBCE09}
Key Deleted : HKLMSOFTWAREClassesInterface{03E2A1F3-4402-4121-8B35-733216D61217}
Key Deleted : HKLMSOFTWAREClassesInterface{06844020-CD0B-3D3D-A7FE-371153013E49}
Key Deleted : HKLMSOFTWAREClassesInterface{07B18EAC-A523-4961-B6BB-170DE4475CCA}
Key Deleted : HKLMSOFTWAREClassesInterface{0ADC01BB-303B-3F8E-93DA-12C140E85460}
Key Deleted : HKLMSOFTWAREClassesInterface{1093995A-BA37-41D2-836E-091067C4AD17}
Key Deleted : HKLMSOFTWAREClassesInterface{10D3722F-23E6-3901-B6C1-FF6567121920}
Key Deleted : HKLMSOFTWAREClassesInterface{120927BF-1700-43BC-810F-FAB92549B390}
Key Deleted : HKLMSOFTWAREClassesInterface{1675E62B-F911-3B7B-A046-EB57261212F3}
Key Deleted : HKLMSOFTWAREClassesInterface{17DE5E5E-BFE3-4E83-8E1F-8755795359EC}
Key Deleted : HKLMSOFTWAREClassesInterface{192929F2-9273-3894-91B0-F54671C4C861}
Key Deleted : HKLMSOFTWAREClassesInterface{1F52A5FA-A705-4415-B975-88503B291728}
Key Deleted : HKLMSOFTWAREClassesInterface{247A115F-06C2-4FB3-967D-2D62D3CF4F0A}
Key Deleted : HKLMSOFTWAREClassesInterface{2932897E-3036-43D9-8A64-B06447992065}
Key Deleted : HKLMSOFTWAREClassesInterface{2DE92D29-A042-3C37-BFF8-07C7D8893EFA}
Key Deleted : HKLMSOFTWAREClassesInterface{2E3537FC-CF2F-4F56-AF54-5A6A3DD375CC}
Key Deleted : HKLMSOFTWAREClassesInterface{2E9937FC-CF2F-4F56-AF54-5A6A3DD375CC}
Key Deleted : HKLMSOFTWAREClassesInterface{31E3BC75-2A09-4CFF-9C92-8D0ED8D1DC0F}
Key Deleted : HKLMSOFTWAREClassesInterface{32B80AD6-1214-45F4-994E-78A5D482C000}
Key Deleted : HKLMSOFTWAREClassesInterface{3A8E103F-B2B7-3BEF-B3B0-88E29B2420E4}
Key Deleted : HKLMSOFTWAREClassesInterface{3E1656ED-F60E-4597-B6AA-B6A58E171495}
Key Deleted : HKLMSOFTWAREClassesInterface{3E53E2CB-86DB-4A4A-8BD9-FFEB7A64DF82}
Key Deleted : HKLMSOFTWAREClassesInterface{3E720451-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesInterface{3E720453-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesInterface{3F607E46-0D3C-4442-B1DE-DE7FA4768F5C}
Key Deleted : HKLMSOFTWAREClassesInterface{478CE5D3-D38E-3FFE-8DBE-8C4A0F1C4D8D}
Key Deleted : HKLMSOFTWAREClassesInterface{48B7DA4E-69ED-39E3-BAD5-3E3EFF22CFB0}
Key Deleted : HKLMSOFTWAREClassesInterface{4E92DB5F-AAD9-49D3-8EAB-B40CBE5B1FF7}
Key Deleted : HKLMSOFTWAREClassesInterface{5982F405-44E4-3BBB-BAC4-CF8141CBBC5C}
Key Deleted : HKLMSOFTWAREClassesInterface{5D8C3CC3-3C05-38A1-B244-924A23115FE9}
Key Deleted : HKLMSOFTWAREClassesInterface{63D0ED2B-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREClassesInterface{63D0ED2D-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREClassesInterface{641593AF-D9FD-30F7-B783-36E16F7A2E08}
Key Deleted : HKLMSOFTWAREClassesInterface{6E74766C-4D93-4CC0-96D1-47B8E07FF9CA}
Key Deleted : HKLMSOFTWAREClassesInterface{711FC48A-1356-3932-94D8-A8B733DBC7E4}
Key Deleted : HKLMSOFTWAREClassesInterface{72227B7F-1F02-3560-95F5-592E68BACC0C}
Key Deleted : HKLMSOFTWAREClassesInterface{72EE7F04-15BD-4845-A005-D6711144D86A}
Key Deleted : HKLMSOFTWAREClassesInterface{741DE825-A6F0-4497-9AA6-8023CF9B0FFF}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D291-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D293-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D295-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D297-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{79FB5FC8-44B9-4AF5-BADD-CCE547F953E5}
Key Deleted : HKLMSOFTWAREClassesInterface{7B5E8CE3-4722-4C0E-A236-A6FF731BEF37}
Key Deleted : HKLMSOFTWAREClassesInterface{819FFE21-35C7-4925-8CDA-4E0E2DB94302}
Key Deleted : HKLMSOFTWAREClassesInterface{890D4F59-5ED0-3CB4-8E0E-74A5A86E7ED0}
Key Deleted : HKLMSOFTWAREClassesInterface{8C68913C-AC3C-4494-8B9C-984D87C85003}
Key Deleted : HKLMSOFTWAREClassesInterface{8D019513-083F-4AA5-933F-7D43A6DA82C4}
Key Deleted : HKLMSOFTWAREClassesInterface{90449521-D834-4703-BB4E-D3AA44042FF8}
Key Deleted : HKLMSOFTWAREClassesInterface{923F6FB8-A390-370E-A0D2-DD505432481D}
Key Deleted : HKLMSOFTWAREClassesInterface{991AAC62-B100-47CE-8B75-253965244F69}
Key Deleted : HKLMSOFTWAREClassesInterface{9BBB26EF-B178-35D6-9D3D-B485F4279FE5}
Key Deleted : HKLMSOFTWAREClassesInterface{9E3B11F6-4179-4603-A71B-A55F4BCB0BEC}
Key Deleted : HKLMSOFTWAREClassesInterface{A626CDBD-3D13-4F78-B819-440A28D7E8FC}
Key Deleted : HKLMSOFTWAREClassesInterface{A62DDBE0-8D2A-339A-B089-8CBCC5CD322A}
Key Deleted : HKLMSOFTWAREClassesInterface{A82AD04D-0B8E-3A49-947B-6A69A8A9C96D}
Key Deleted : HKLMSOFTWAREClassesInterface{ADEB3CC9-A05D-4FCC-BD09-9025456AA3EA}
Key Deleted : HKLMSOFTWAREClassesInterface{B06D4521-D09C-3F41-8E39-9D784CCA2A75}
Key Deleted : HKLMSOFTWAREClassesInterface{BBABDC90-F3D5-4801-863A-EE6AE529862D}
Key Deleted : HKLMSOFTWAREClassesInterface{BF921DD3-732A-4A11-933B-A5EA49F2FD2C}
Key Deleted : HKLMSOFTWAREClassesInterface{C06DAD42-6F39-4CE1-83CC-9A8B9105E556}
Key Deleted : HKLMSOFTWAREClassesInterface{C2E799D0-43A5-3477-8A98-FC5F3677F35C}
Key Deleted : HKLMSOFTWAREClassesInterface{C401D2CE-DC27-45C7-BC0C-8E6EA7F085D6}
Key Deleted : HKLMSOFTWAREClassesInterface{CF54BE1C-9359-4395-8533-1657CF209CFE}
Key Deleted : HKLMSOFTWAREClassesInterface{D16107CD-2AD5-46A8-BA59-303B7C32C500}
Key Deleted : HKLMSOFTWAREClassesInterface{D25B101F-8188-3B43-9D85-201F372BC205}
Key Deleted : HKLMSOFTWAREClassesInterface{D2BA7595-5E44-3F1E-880F-03B3139FA5ED}
Key Deleted : HKLMSOFTWAREClassesInterface{D35F5C81-17D9-3E1C-A1FC-4472542E1D25}
Key Deleted : HKLMSOFTWAREClassesInterface{D6FF3684-AD3B-48EB-BBB4-B9E6C5A355C1}
Key Deleted : HKLMSOFTWAREClassesInterface{D83B296A-2FA6-425B-8AE8-A1F33D99FBD6}
Key Deleted : HKLMSOFTWAREClassesInterface{D8FA96CA-B250-312C-AF34-4FF1DD72589D}
Key Deleted : HKLMSOFTWAREClassesInterface{DAFC1E63-3359-416D-9BC2-E7DCA6F7B0F3}
Key Deleted : HKLMSOFTWAREClassesInterface{DC5E5C44-80FD-3697-9E65-9F286D92F3E7}
Key Deleted : HKLMSOFTWAREClassesInterface{DE38C398-B328-4F4C-A3AD-1B5E4ED93477}
Key Deleted : HKLMSOFTWAREClassesInterface{E1B4C9DE-D741-385F-981E-6745FACE6F01}
Key Deleted : HKLMSOFTWAREClassesInterface{E342AF55-B78A-4CD0-A2BB-DA7F52D9D25E}
Key Deleted : HKLMSOFTWAREClassesInterface{E342AF55-B78A-4CD0-A2BB-DA7F52D9D25F}
Key Deleted : HKLMSOFTWAREClassesInterface{E79DFBC9-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesInterface{E79DFBCB-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesInterface{E7B623F5-9715-3F9F-A671-D1485A39F8A2}
Key Deleted : HKLMSOFTWAREClassesInterface{EB9E5C1C-B1F9-4C2B-BE8A-27D6446FDAF8}
Key Deleted : HKLMSOFTWAREClassesInterface{ED916A7B-7C68-3198-B87D-2DABC30A5587}
Key Deleted : HKLMSOFTWAREClassesInterface{EFA1BDB2-BB3D-3D9A-8EB5-D0D22E0F64F4}
Key Deleted : HKLMSOFTWAREClassesInterface{F4CBF4DD-F8FE-35BA-BB7E-68304DAAB70B}
Key Deleted : HKLMSOFTWAREClassesInterface{FC32005D-E27C-32E0-ADFA-152F598B75E7}
Key Deleted : HKLMSOFTWAREClassesInterface{FE0273D1-99DF-4AC0-87D5-1371C6271785}
Key Deleted : HKLMSOFTWAREClassesTypeLib{0D26BC71-A633-4E71-AD31-EADC3A1B6A3A}
Key Deleted : HKLMSOFTWAREClassesTypeLib{13ABD093-D46F-40DF-A608-47E162EC799D}
Key Deleted : HKLMSOFTWAREClassesTypeLib{29D67D3C-509A-4544-903F-C8C1B8236554}
Key Deleted : HKLMSOFTWAREClassesTypeLib{2BF2028E-3F3C-4C05-AB45-B2F1DCFE0759}
Key Deleted : HKLMSOFTWAREClassesTypeLib{3E720450-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesTypeLib{4E1E9D45-8BF9-4139-915C-9F83CC3D5921}
Key Deleted : HKLMSOFTWAREClassesTypeLib{7473D290-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesTypeLib{74FB6AFD-DD77-4CEB-83BD-AB2B63E63C93}
Key Deleted : HKLMSOFTWAREClassesTypeLib{819FFE20-35C7-4925-8CDA-4E0E2DB94302}
Key Deleted : HKLMSOFTWAREClassesTypeLib{8CA01F0E-987C-49C3-B852-2F1AC4A7094C}
Key Deleted : HKLMSOFTWAREClassesTypeLib{8E6F1830-9607-4440-8530-13BE7C4B1D14}
Key Deleted : HKLMSOFTWAREClassesTypeLib{8FFDF636-0D87-4B33-B9E9-79A53F6E1DAE}
Key Deleted : HKLMSOFTWAREClassesTypeLib{93E3D79C-0786-48FF-9329-93BC9F6DC2B3}
Key Deleted : HKLMSOFTWAREClassesTypeLib{9C049BA6-EA47-4AC3-AED6-A66D8DC9E1D8}
Key Deleted : HKLMSOFTWAREClassesTypeLib{C2AC8A0E-E48E-484B-A71C-C7A937FAAB94}
Key Deleted : HKLMSOFTWAREClassesTypeLib{C8CECDE3-1AE1-4C4A-AD82-6D5B00212144}
Key Deleted : HKLMSOFTWAREClassesTypeLib{D518921A-4A03-425E-9873-B9A71756821E}
Key Deleted : HKLMSOFTWAREClassesTypeLib{D7EE8177-D51E-4F89-92B6-83EA2EC40800}
Key Deleted : HKLMSOFTWAREClassesTypeLib{DB538320-D3C5-433C-BCA9-C4081A054FCF}
Key Deleted : HKLMSOFTWAREClassesTypeLib{E2343056-CC08-46AC-B898-BFC7ACF4E755}
Key Deleted : HKLMSOFTWAREClassesTypeLib{E47CAEE0-DEEA-464A-9326-3F2801535A4D}
Key Deleted : HKLMSOFTWAREClassesTypeLib{E79DFBC0-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesTypeLib{F42228FB-E84E-479E-B922-FBBD096E792C}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{07B18EAB-A523-4961-B6BB-170DE4475CCA}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{116BA71C-8187-4F15-9A1F-C9D6289155D1}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{2974C985-8151-4DE5-B23C-B875F0A8522F}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{07B18EAB-A523-4961-B6BB-170DE4475CCA}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{08858AF6-42AD-4914-95D2-AC3AB0DC8E28}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{25560540-9571-4D7B-9389-0F166788785A}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{3DC201FB-E9C9-499C-A11F-23C360D7C3F8}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{3E720452-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{63D0ED2C-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{7473D294-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{98D9753D-D73B-42D5-8C85-4469CDA897AB}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{9FF05104-B030-46FC-94B8-81276E4E27DF}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{C6FDD0C3-266A-4DC3-B459-28C697C44CDC}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{E79DFBCA-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerExtensions{898EA8C8-E7FF-479B-8935-AEC46303B9E5}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{59C7FC09-1C83-4648-B3E6-003D2BBC7481}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{628F3201-34D0-49C0-BB9A-82A26AEFB291}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{68AF847F-6E91-45DD-9B68-D6A12C30E5D7}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{9170B96C-28D4-4626-8358-27E6CAEEF907}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{D1A71FA0-FF48-48DD-9B6D-7A13A3E42127}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{DDB1968E-EAD6-40FD-8DAE-FF14757F60C7}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{F138D901-86F0-4383-99B6-9CDD406036DA}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKCUSoftwareMicrosoftInternet ExplorerSearchScopes{0ECDF796-C2DC-4D79-A620-CCE0C0A66CC9}
Key Deleted : HKCUSoftwareMicrosoftInternet ExplorerSearchScopes{70D46D94-BF1E-45ED-B567-48701376298E}
Key Deleted : HKCUSoftwareMicrosoftInternet ExplorerSearchScopes{95B7759C-8C7F-4BF1-B163-73684A933233}
Value Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerToolbar [{07B18EA9-A523-4961-B6BB-170DE4475CCA}]
Value Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerToolbar [{95B7759C-8C7F-4BF1-B163-73684A933233}]
Value Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerToolbar [{F3FEE66E-E034-436A-86E4-9690573BEE8A}]
Value Deleted : HKCUSoftwareMicrosoftInternet ExplorerToolbarWebBrowser [{E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39}]
Value Deleted : HKCUSoftwareMicrosoftInternet ExplorerURLSearchHooks [{00A6FAF6-072E-44CF-8957-5838F569A31D}]
Value Deleted : HKCUSoftwareMicrosoftInternet ExplorerURLSearchHooks [{F3FEE66E-E034-436A-86E4-9690573BEE8A}]
Key Deleted : HKCUSoftwareAPN PIP
Key Deleted : HKCUSoftwareAVG Secure Search
Key Deleted : HKCUSoftwareIGearSettings
Key Deleted : HKCUSoftwareMyWebSearch
Key Deleted : HKCUSoftwarePIP
Key Deleted : HKCUSoftwarePrivitizeVPNInstallDates
Key Deleted : HKCUSoftwareSearch Settings
Key Deleted : HKCUSoftwareSoftonic
Key Deleted : HKCUSoftwareStartSearch
Key Deleted : HKCUSoftwareAppDataLowSoftwareFun Web Products
Key Deleted : HKCUSoftwareAppDataLowSoftwareFunWebProducts
Key Deleted : HKCUSoftwareAppDataLowSoftwareMyWebSearch
Key Deleted : HKCUSoftwareAppDataLowSoftwareSearch Settings
Key Deleted : HKLMSoftwareApplication Updater
Key Deleted : HKLMSoftwareAVG Secure Search
Key Deleted : HKLMSoftwareAVG Security Toolbar
Key Deleted : HKLMSoftwareBabylon
Key Deleted : HKLMSoftwareFocusInteractive
Key Deleted : HKLMSoftwareFun Web Products
Key Deleted : HKLMSoftwareIminent
Key Deleted : HKLMSoftwareMyWebSearch
Key Deleted : HKLMSoftwarePIP
Key Deleted : HKLMSoftwareSearch Settings
Key Deleted : HKLMSoftwareSP Global
Key Deleted : HKLMSoftwareSProtector
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstall{A76AA284-E52D-47E6-9E4F-B85DBF8E35C3}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstall{A92DAB39-4E2C-4304-9AB6-BC44E68B55E2}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstall{F7CF0E9A-D48B-4942-9537-259ED0568DF4}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstallmywebsearch bar uninstall
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstallSearchTheWebARP
Data Deleted : HKLMSOFTWAREMicrosoftWindows NTCurrentVersionWindows [AppInit_DLLs] - c:progra~1magnipicsprote~1.dll
Product Deleted : IMinent Toolbar

***** [ Browsers ] *****

- Internet Explorer v10.0.9200.16686

Setting Restored : HKCUSoftwareMicrosoftInternet ExplorerMain [start Page]

- Mozilla Firefox v24.0 (bg)

[ File : C:UsersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultprefs.js ]

Line Deleted : user_pref("aol_toolbar.default.homepage.check", false);
Line Deleted : user_pref("aol_toolbar.default.search.check", false);
Line Deleted : user_pref("browser.babylon.HPOnNewTab", "search.babylon.com");
Line Deleted : user_pref("browser.search.defaultenginename", "Search The Web (privitize)");
Line Deleted : user_pref("browser.search.order.1", "Search The Web (privitize)");
Line Deleted : user_pref("browser.search.selectedEngine", "Search The Web (privitize)");
Line Deleted : user_pref("dom.ipc.plugins.enabled.npmywebs.dll", false);
Line Deleted : user_pref("extensions.5159a25736caa.scode", "(function(){try{if('aol.com,mail.google.com,premiumreports.info,search.babylon.com,search.gboxapp.com'.indexOf(window.self.location.hostname)>-1) return;}c[...]
Line Deleted : user_pref("extensions.BabylonToolbar.prtkDS", 0);
Line Deleted : user_pref("extensions.BabylonToolbar.prtkHmpg", 0);
Line Deleted : user_pref("extensions.BabylonToolbar_i.newTab", true);

Line Deleted : user_pref("extensions.privitize.srchPrvdr", "Search The Web (privitize)");
Line Deleted : user_pref("extensions.softonic.admin", false);
Line Deleted : user_pref("extensions.softonic.aflt", "orgnl");
Line Deleted : user_pref("extensions.softonic.dfltLng", "");
Line Deleted : user_pref("extensions.softonic.dfltSrch", false);
Line Deleted : user_pref("extensions.softonic.excTlbr", false);
Line Deleted : user_pref("extensions.softonic.hmpg", false);
Line Deleted : user_pref("extensions.softonic.id", "d65288460000000000002c27d72d77db");
Line Deleted : user_pref("extensions.softonic.instlDay", "15401");
Line Deleted : user_pref("extensions.softonic.instlRef", "MON00001");
Line Deleted : user_pref("extensions.softonic.lastVrsnTs", "");
Line Deleted : user_pref("extensions.softonic.newTab", false);
Line Deleted : user_pref("extensions.softonic.noFFXTlbr", false);
Line Deleted : user_pref("extensions.softonic.prdct", "softonic");
Line Deleted : user_pref("extensions.softonic.prtnrId", "softonic");
Line Deleted : user_pref("extensions.softonic.smplGrp", "eng7");
Line Deleted : user_pref("extensions.softonic.tlbrId", "eng7");

Line Deleted : user_pref("extensions.softonic.vrsn", "");
Line Deleted : user_pref("extensions.softonic.vrsnTs", "");
Line Deleted : user_pref("extensions.softonic.vrsni", "");
Line Deleted : user_pref("extensions.softonic_i.aflt", "orgnl");
Line Deleted : user_pref("extensions.softonic_i.dfltLng", "");
Line Deleted : user_pref("extensions.softonic_i.excTlbr", false);
Line Deleted : user_pref("extensions.softonic_i.id", "d65288460000000000002c27d72d77db");
Line Deleted : user_pref("extensions.softonic_i.instlDay", "15401");
Line Deleted : user_pref("extensions.softonic_i.instlRef", "MON00001");
Line Deleted : user_pref("extensions.softonic_i.newTab", false);
Line Deleted : user_pref("extensions.softonic_i.prdct", "softonic");
Line Deleted : user_pref("extensions.softonic_i.prtnrId", "softonic");
Line Deleted : user_pref("extensions.softonic_i.smplGrp", "eng7");
Line Deleted : user_pref("extensions.softonic_i.tlbrId", "eng7");

Line Deleted : user_pref("extensions.softonic_i.vrsn", "");
Line Deleted : user_pref("extensions.softonic_i.vrsnTs", "");
Line Deleted : user_pref("extensions.softonic_i.vrsni", "");
Line Deleted : user_pref("sweetim.toolbar.previous.browser.search.defaultenginename", "");
Line Deleted : user_pref("sweetim.toolbar.previous.browser.search.selectedEngine", "");
Line Deleted : user_pref("sweetim.toolbar.previous.browser.startup.homepage", "");
Line Deleted : user_pref("sweetim.toolbar.previous.keyword.URL", "");
Line Deleted : user_pref("sweetim.toolbar.scripts.1.domain-blacklist", "");
Line Deleted : user_pref("sweetim.toolbar.searchguard.UserRejectedGuard_DS", "");
Line Deleted : user_pref("sweetim.toolbar.searchguard.UserRejectedGuard_HP", "");
Line Deleted : user_pref("sweetim.toolbar.searchguard.enable", "");

- Google Chrome v30.0.1599.69

[ File : C:UsersUserAppDataLocalGoogleChromeUser DataDefaultpreferences ]


AdwCleaner[R0].txt - [42354 octets] - [08/10/2013 14:16:42]
AdwCleaner[s0].txt - [43150 octets] - [08/10/2013 14:17:20]

########## EOF - C:AdwCleanerAdwCleaner[s0].txt - [43211 octets] ##########







Junkware Removal Tool (JRT) by Thisisu
Version: 6.0.4 (10.06.2013:1)
OS: Windows 7 Enterprise x86
Ran by User on ўв 08.10.2013 Ј. at 14:21:51,90

~~~ Services

~~~ Registry Values

Successfully deleted: [Registry Value] HKEY_LOCAL_MACHINESoftwareMicrosoftWindowsCurrentVersionRundriver genius
Successfully deleted: [Registry Value] HKEY_LOCAL_MACHINESoftwareMicrosoftInternet ExplorerToolbar{1C46A0DD-D53E-46C4-A435-CA11103E255E}
Successfully repaired: [Registry Value] HKEY_LOCAL_MACHINESoftwareMicrosoftInternet ExplorerAboutURLsTabs

~~~ Registry Keys

Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_1_rasapi32
Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_1_rasmancs
Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_rasapi32
Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_rasmancs
Successfully deleted: [Registry Key] HKEY_CURRENT_USERSoftwareMicrosoftInternet ExplorerSearchScopes{C0A82207-8344-41F1-A040-BEBAA81FEE54}

~~~ Files

Successfully deleted: [File] C:Windowssystem32RENA6DE.tmp
Successfully deleted: [File] C:Windowssystem32RENA6DF.tmp

~~~ Folders

Successfully deleted: [Folder] "C:UsersUserappdatalocallowytd"
Successfully deleted: [Folder] "C:Windowssystem32ai_recyclebin"
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{1CFCDD62-6187-4378-8E2D-24833D1CCB5B}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{3DB399A4-5370-40A7-83EF-75CA91C3AFCE}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{7D560449-D69C-4CCA-9FFC-D1E3CE3CC7F6}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{A18883CF-114E-49F7-9963-DAE6FDDEFEE9}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{CDCD390C-BDB3-40B6-BF5C-0EE64591247B}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{DBCD12A3-7171-4FA6-AD55-4E2088D6EB5B}

~~~ FireFox

Successfully deleted: [File] C:UsersUserAppDataRoamingmozillafirefoxprofilesptoklpuh.defaultsearchpluginsprivitize.xml
Successfully deleted the following from C:UsersUserAppDataRoamingmozillafirefoxprofilesptoklpuh.defaultprefs.js

user_pref("extensions.privitize.admin", false);
user_pref("extensions.privitize.aflt", "5");
user_pref("extensions.privitize.appId", "{301966DF-A84B-4255-AAB9-574B5CE237E4}");
user_pref("extensions.privitize.autoRvrt", "false");
user_pref("extensions.privitize.dfltLng", "");
user_pref("extensions.privitize.dfltSrch", true);
user_pref("extensions.privitize.dnsErr", true);
user_pref("extensions.privitize.excTlbr", false);
user_pref("extensions.privitize.ffxUnstlRst", false);
user_pref("extensions.privitize.hmpg", true);

user_pref("extensions.privitize.id", "d65288460000000000002c27d72d77db");
user_pref("extensions.privitize.instlDay", "15876");
user_pref("extensions.privitize.instlRef", "");

user_pref("extensions.privitize.newTab", true);

user_pref("extensions.privitize.prdct", "privitize");
user_pref("extensions.privitize.prtnrId", "privitize");
user_pref("extensions.privitize.rvrt", "false");
user_pref("extensions.privitize.smplGrp", "none");
user_pref("extensions.privitize.tlbrId", "base");

user_pref("extensions.privitize.vrsn", "");
user_pref("extensions.privitize.vrsnTs", "");
user_pref("extensions.privitize.vrsni", "");

Emptied folder: C:UsersUserAppDataRoamingmozillafirefoxprofilesptoklpuh.defaultminidumps [1016 files]

~~~ Event Viewer Logs were cleared

Scan was completed on ўв 08.10.2013 Ј. at 14:24:01,13
End of JRT log



Malwarebytes Anti-Malware





Malwarebytes Anti-Malware

Database version: v2013.10.08.04

Windows 7 Service Pack 1 x86 NTFS
Internet Explorer 10.0.9200.16686
User :: HP [administrator]

8.10.2013 г. 14:30:19 ч.
MBAM-log-2013-10-08 (15-53-04).txt

Scan type: Full scan (C:|D:|)
Scan options enabled: Memory | Startup | Registry | File System | Heuristics/Extra | Heuristics/Shuriken | PUP | PUM
Scan options disabled: P2P
Objects scanned: 377679
Time elapsed: 1 hour(s), 20 minute(s), 49 second(s)

Memory Processes Detected: 0
(No malicious items detected)

Memory Modules Detected: 0
(No malicious items detected)

Registry Keys Detected: 0
(No malicious items detected)

Registry Values Detected: 0
(No malicious items detected)

Registry Data Items Detected: 0
(No malicious items detected)

Folders Detected: 0
(No malicious items detected)

Files Detected: 6
C:UsersUserAppDataLocalTempfUgRjIO1.zip.part (Trojan.Agent.HE) -> No action taken.
C:UsersUserDesktopНова папкаCDHackcdhack.dll (Trojan.Agent.H) -> No action taken.
D:DownloadsmarketSoftonicDownloader_for_tactical-ops-assault-on-terror.exe (PUP.Optional.Softonic.A) -> No action taken.
D:DownloadstalismanMedal.of.Honor.2010.Multi3.RU.RepackAutorun.exe (Trojan.Agent) -> No action taken.
D:DownloadstalismanMedal.of.Honor.2010.Multi3.RU.RepackMedal of HonorBinariesloader.dll (Riskware.Tool.CK) -> No action taken.
D:LFSLFSip-patch.exe (Backdoor.Bifrose) -> No action taken.


Редактирано от hippnozis (преглед на промените)

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Сканирайте отново с Malwarebytes Anti-Malware но този път маркирайте всички намерени обекти и натиснете Публикувано изображение .
..след това..:


Публикувано изображение Изтеглете ComboFix Публикувано изображение от тук и го запазете на десктопа си
Изключете вашата антивирусна и антишпионска програма, обикновено това става чрез натискане на десния бутон на мишката върху иконата на програма в системния трей.
Бележка: Ако не можете я спрете или не сте сигурни коя програма да изключите, моля прегледайте информацията от този линк: How to disable your security applications by amateur

Стартирайте Combo-Fix.com Публикувано изображение и следвайте инструкциите.
Бележка: ComboFix ще се стартира без инсталирана Recovery Console.
Като част от неговата работа, ComboFix ще провери дали Microsoft Windows Recovery Console е инсталирана. Предвид бързо развиващия се зловреден софтуер е силно препоръчително да бъде инсталирана преди премахването на зловредния софтуер. Това ще Ви позволи да влезете в специален recovery/repai режим, който ще ни позволи по-лесно да решите проблем, който би могъл да възникне при премахване на зловредния софтуер.

  • [*]Следвайте инструкциите, за да позволите на
ComboFix да изтегли и инсталира Microsoft Windows Recovery Console.В един момент ще бъдете попитани дали сте съгласни с лицензното споразумение. Необходимо е да потвърдите, че сте съгласни, за да инсталирате Microsoft Windows Recovery Console.

** Забележете: Ако Microsoft Windows Recovery Console е вече инсталирана, ComboFix ще продължи към процеса по премахване на зловредния софтуер.
Публикувано изображение
След като Microsoft Windows Recovery Console е инсталирана, използвайки ComboFix, Вие ще видите следното съобщение:
Публикувано изображение


Изберете Yes, за да продължи сканирането за зловреден софтуер.

Когато процесът приключи успешно, инструментът ще създаде лог файл. Моля, включете съдържанието на C:ComboFix.txt в следващия Ви коментар в тази тема.
Публикувано изображение Моля, не прикачвайте лог файла/овете от програмата, а го/ги копирайте и поставете в следващия Ви коментар в тази тема.

  • Харесва ми 2

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Malwarebytes Anti-Malware го оправих но не ми са създаде лог :no-no:

ако може да ми обясните пораженията по системата .. :)

ето лога от  ComboFix


ComboFix 13-10-08.01 - User 10.2013 г.  16:26:31.1.2 - x86
Microsoft Windows 7 Enterprise 6.1.7601.1.1251.359.1026.18.1917.1251 [GMT 3:00]
Running from: c:usersUserDownloadsComboFix.exe
AV: Microsoft Security Essentials *Disabled/Updated* {641105E6-77ED-3F35-A304-765193BCB75F}
SP: Microsoft Security Essentials *Disabled/Updated* {DF70E402-51D7-30BB-99B4-4D23E83BFDE2}
SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
 * Created a new restore point
((((((((((((((((((((((((((((((((((((((( Other Deletions )))))))))))))))))))))))))))))))))))))))))))))))))
c:usersUserAppDataLocalGoogleChromeUser DataDefaultPreferences
((((((((((((((((((((((((((((((((((((((( Drivers/Services )))))))))))))))))))))))))))))))))))))))))))))))))
((((((((((((((((((((((((( Files Created from 2013-09-09 to 2013-10-09  )))))))))))))))))))))))))))))))
2013-10-08 11:29 . 2013-10-08 11:29  --------  d-----w-  c:program filesMalwarebytes' Anti-Malware
2013-10-08 11:29 . 2013-04-04 11:50  22856  ----a-w-  c:windowssystem32driversmbam.sys
2013-10-08 11:21 . 2013-10-08 11:21  --------  d-----w-  c:windowsERUNT
2013-10-08 11:14 . 2013-10-08 11:17  --------  d-----w-  C:AdwCleaner
2013-10-05 17:39 . 2013-10-08 18:07  --------  d-----w-  c:usersUserAppDataRoaming.minecraft
2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:usersUserAppDataLocalLogMeIn
2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:programdataLogMeIn
2013-09-30 17:52 . 2013-09-30 17:52  --------  d-----w-  c:program filesAcclaim Entertainment
2013-09-11 17:49 . 2013-09-11 17:49  --------  d-----w-  c:programdataNexon
2013-09-11 16:49 . 2013-09-11 16:50  --------  d-----w-  c:usersUserAppDataLocalAkamai
2013-09-09 17:09 . 2013-09-09 17:09  --------  d--h--w-  c:program filesTemp
(((((((((((((((((((((((((((((((((((((((( Find3M Report ))))))))))))))))))))))))))))))))))))))))))))))))))))
2013-10-09 13:23 . 2013-10-09 13:23  40392  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{2757D113-8F0B-4D07-B3E8-681947E139C5}MpKsl70dd4d28.sys
2013-10-09 13:08 . 2012-03-30 11:00  692616  ----a-w-  c:windowssystem32FlashPlayerApp.exe
2013-10-09 13:08 . 2011-08-07 14:11  71048  ----a-w-  c:windowssystem32FlashPlayerCPLApp.cpl
2013-10-02 15:06 . 2012-07-21 23:29  37664  ----a-w-  c:windowssystem32driversavgtpx86.sys
2013-09-06 17:07 . 2013-09-06 17:07  718712  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{A791E496-9C9C-4EC1-BCB5-B6B12246FAC6}gapaengine.dll
2013-09-05 05:02 . 2013-10-09 11:31  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{2757D113-8F0B-4D07-B3E8-681947E139C5}mpengine.dll
2013-09-05 05:02 . 2013-10-08 11:31  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesBackupmpengine.dll
2013-08-22 18:02 . 2011-08-11 08:57  697992  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesNISBackupgapaengine.dll
2013-07-25 08:57 . 2013-08-14 11:25  1620992  ----a-w-  c:windowssystem32WMVDECOD.DLL
2013-07-19 01:41 . 2013-08-14 11:25  2048  ----a-w-  c:windowssystem32tzres.dll
2011-09-10 00:24 . 2013-10-01 15:48  119808  ----a-w-  c:program filesmozilla firefoxcomponentsGoogleDesktopMozilla.dll
((((((((((((((((((((((((((((((((((((( Reg Loading Points ))))))))))))))))))))))))))))))))))))))))))))))))))
*Note* empty entries & legit default entries are not shown
"DAEMON Tools Lite"="c:program filesDAEMON Tools LiteDTLite.exe" [2011-08-02 4910912]
"Sidebar"="c:program filesWindows Sidebarsidebar.exe" [2010-11-20 1174016]
"Skype"="c:program filesSkypePhoneSkype.exe" [2013-07-25 20684656]
"Akamai NetSession Interface"="c:usersUserAppDataLocalAkamainetsession_win.exe" [2013-06-04 4489472]
"BCSSync"="c:program filesMicrosoft OfficeOffice14BCSSync.exe" [2010-03-13 91520]
"ZSSnp211"="c:windowsZSSnp211.exe" [2007-04-06 57344]
"Google Desktop Search"="c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe" [2011-09-10 30192]
"MSC"="c:program filesMicrosoft Security Clientmsseces.exe" [2013-06-20 995176]
"IgfxTray"="c:windowssystem32igfxtray.exe" [2012-11-13 138784]
"HotKeysCmds"="c:windowssystem32hkcmd.exe" [2012-11-13 172064]
"Persistence"="c:windowssystem32igfxpers.exe" [2012-11-13 173600]
"SunJavaUpdateSched"="c:program filesCommon FilesJavaJava Updatejusched.exe" [2013-03-12 253816]
"LogMeIn Hamachi Ui"="d:downloadsmyНова папкаhamachi-2-ui.exe" [2013-10-01 2345296]
"ConsentPromptBehaviorUser"= 3 (0x3)
"EnableUIADesktopToggle"= 0 (0x0)
[HKEY_LOCAL_MACHINEsoftwaremicrosoftwindows ntcurrentversionwindows]
[HKLM~startupfolderC:^Users^User^AppData^Roaming^Microsoft^Windows^Start Menu^Programs^Startup^GamersFirst LIVE!.lnk]
path=c:usersUserAppDataRoamingMicrosoftWindowsStart MenuProgramsStartupGamersFirst LIVE!.lnk
backup=c:windowspssGamersFirst LIVE!.lnk.Startup
[HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregDomino]
2006-08-18 13:58  49152  ----a-w-  c:windowsDomino.exe
[HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregFacebook Update]
2012-07-11 20:44  138096  ----atw-  c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe
R2 SkypeUpdate;Skype Updater;c:program filesSkypeUpdaterUpdater.exe [2013-07-25 162672]
R2 vToolbarUpdater17.0.12;vToolbarUpdater17.0.12;c:program filesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exe [x]
R3 dmvsc;dmvsc;c:windowssystem32driversdmvsc.sys [2010-11-20 62464]
R3 EagleXNt;EagleXNt;c:windowssystem32driversEagleXNt.sys [x]
R3 FairplayKD;FairplayKD;c:programdataMTA San Andreas All1.3tempFairplayKD.sys [x]
R3 GoogleDesktopManager-051210-111108;Диспечер на Google Desktop 5.9.1005.12335;c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe [2011-09-10 30192]
R3 NisDrv;Microsoft Network Inspection System;c:windowssystem32DRIVERSNisDrvWFP.sys [2013-06-18 107392]
R3 NisSrv;Мрежова проверка на Microsoft;c:program filesMicrosoft Security ClientNisSrv.exe [2013-06-20 295376]
R3 RdpVideoMiniport;Remote Desktop Video Miniport Driver;c:windowssystem32driversrdpvideominiport.sys [2010-11-20 15872]
R3 Synth3dVsc;Synth3dVsc;c:windowssystem32driverssynth3dvsc.sys [2010-11-20 77184]
R3 terminpt;Microsoft Remote Desktop Input Driver;c:windowssystem32driversterminpt.sys [2010-11-20 25600]
R3 TsUsbFlt;TsUsbFlt;c:windowssystem32driverstsusbflt.sys [2010-11-20 52224]
R3 TsUsbGD;Remote Desktop Generic USB Device;c:windowssystem32driversTsUsbGD.sys [2010-11-20 27264]
R3 tsusbhub;tsusbhub;c:windowssystem32driverstsusbhub.sys [2010-11-20 112640]
R3 VGPU;VGPU;c:windowssystem32driversrdvgkmd.sys [x]
R3 vvftav211;vvftav211;c:windowssystem32driversvvftav211.sys [2007-12-10 480128]
R3 WatAdminSvc;Услуга на технологиите за активиране на Windows;c:windowssystem32WatWatAdminSvc.exe [2011-08-05 1343400]
R3 WinRing0_1_2_0;WinRing0_1_2_0;d:mcRazer Game BoosterDriverWinRing0.sys [x]
R3 XDva394;XDva394;c:windowssystem32XDva394.sys [x]
R3 XDva397;XDva397;c:windowssystem32XDva397.sys [x]
R3 XDva399;XDva399;c:windowssystem32XDva399.sys [x]
R3 XDva401;XDva401;c:windowssystem32XDva401.sys [x]
R3 ZSMC30x;USB PC Camera Service ZSMC30x;c:windowssystem32DriversZS211.sys [2007-12-05 1537024]
S1 avgtp;avgtp;c:windowssystem32driversavgtpx86.sys [2013-10-02 37664]
S1 dtsoftbus01;DAEMON Tools Virtual Bus Driver;c:windowssystem32DRIVERSdtsoftbus01.sys [2011-08-05 232512]
S1 MpKsl70dd4d28;MpKsl70dd4d28;c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{2757D113-8F0B-4D07-B3E8-681947E139C5}MpKsl70dd4d28.sys [2013-10-09 40392]
S2 Hamachi2Svc;LogMeIn Hamachi Tunneling Engine;d:downloadsmyНова папкаhamachi-2.exe [2013-10-01 1612112]
S2 RzKLService;RzKLService;d:mcRazer Game BoosterRzKLService.exe [2013-09-18 106472]
S2 Skype C2C Service;Skype C2C Service;c:programdataSkypeToolbarsSkype C2C Servicec2c_service.exe [2013-09-16 3273088]
S2 TeamViewer8;TeamViewer 8;c:program filesTeamViewerVersion8TeamViewer_Service.exe [2013-08-07 4308320]
S3 RTL8167;Realtek 8167 NT Driver;c:windowssystem32DRIVERSRt86win7.sys [2009-03-01 139776]
--- Other Services/Drivers In Memory ---
*NewlyCreated* - WS2IFSL
[HKEY_LOCAL_MACHINEsoftwaremicrosoftactive setupinstalled components{8A69D345-D564-463c-AFF1-A69D9E530F96}]
2013-10-06 11:22  1185744  ----a-w-  c:program filesGoogleChromeApplication30.0.1599.69Installerchrmstp.exe
Contents of the 'Scheduled Tasks' folder
2013-10-09 c:windowsTasksAdobe Flash Player Updater.job
- c:windowssystem32MacromedFlashFlashPlayerUpdateService.exe [2012-03-30 13:08]
2013-10-05 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000Core.job
- c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44]
2013-10-09 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000UA.job
- c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44]
2013-10-09 c:windowsTasksGoogleUpdateTaskMachineCore.job
- c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14]
2013-10-09 c:windowsTasksGoogleUpdateTaskMachineUA.job
- c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14]
------- Supplementary Scan -------

uInternet Settings,ProxyOverride = <local>
IE: Download all by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm
IE: Download by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm
IE: E&xport to Microsoft Excel - c:progra~1MICROS~2Office14EXCEL.EXE/3000
IE: Free YouTube Download - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeytvdownloader.htm
IE: Free YouTube to MP3 Converter - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeyoutubetomp3converter.htm
IE: Se&nd to OneNote - c:progra~1MICROS~2Office14ONBttnIE.dll/105
IE: ????3?? - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm
IE: ????3?????? - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm
Trusted Zone: clonewarsadventures.com
Trusted Zone: freerealms.com
Trusted Zone: soe.com
Trusted Zone: sony.com
FF - ProfilePath - c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.default
FF - prefs.js: browser.search.defaulturl -

FF - ExtSQL: 2013-09-30 19:10; WebSiteRecommendation@weliketheweb.com; c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultextensionsWebSiteRecommendation@weliketheweb.com
- - - - ORPHANS REMOVED - - - -
HKCU-Run-Clownfish - c:program filesClownfishClownfish.exe
MSConfigStartUp-Clownfish - c:program filesClownfishClownfish.exe
MSConfigStartUp-Steam - c:program filesSteamSteam.exe
AddRemove-Clownfish - c:program filesClownfishuninstall.exe
AddRemove-Driver Genius Professional Edition_is1 - d:downloadskamioniDriverGeniusunins000.exe
AddRemove-Minecraft 1.6.2 - c:usersUserAppDataRoaming.minecraftUninstal.exe
AddRemove-Minecraft1.6.2 - c:usersUserAppDataRoaming.minecraftminecraft launcherUninstall.exe
AddRemove-privitize - c:program filesIndustriyaprivitize1.8.21.6uninstall.exe
AddRemove-BeamNG-Techdemo-0.3 - d:mda eBeamNG-Techdemo-0.3uninst-BeamNG-Techdemo-0.3.exe
AddRemove-Counter-Strike 1.6 Escom 3d!7!0n - by AmaRelle v1.0 - d:downloadsskiiUninstal.exe
AddRemove-GamersFirst LIVE! - c:usersUserAppDataLocalGamersFirstLIVE!uninstall.exe
AddRemove-SOE-Magic The Gathering Tactics - d:downloadsНова папкаUninstaller.exe
AddRemove-World of Warcraft Trial - c:usersPublicDocumentsBlizzard EntertainmentWorld of Warcraft Trial (2)Uninstall.exe
--------------------- LOCKED REGISTRY KEYS ---------------------
[HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}Џ]
@Allowed: (Read) (RestrictedCode)
@="c:Program FilesFlashGet NetworkFlashGet 3GetUrl.htm"
[HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}ЏhQиђю”Ґc]
@Allowed: (Read) (RestrictedCode)
@="c:Program FilesFlashGet NetworkFlashGet 3GetAllUrl.htm"
@Denied: (A) (Users)
@Denied: (A) (Everyone)
@Allowed: (B 1 2 3 4 5) (S-1-5-20)
@Denied: (Full) (Everyone)
------------------------ Other Running Processes ------------------------
c:program filesMicrosoft Security ClientMsMpEng.exe
c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSVC.EXE
c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSvcM.exe
c:program filesWindows Media Playerwmpnetwk.exe
Completion time: 2013-10-09  16:37:58 - machine was rebooted
ComboFix-quarantined-files.txt  2013-10-09 13:37
Pre-Run: 19 964 141 568 bytes free
Post-Run: 19 761 917 952 bytes free
- - End Of File - - B349F3FA563916209B179A5B0B6BCCD9

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Копирайте текста в карето на notepad и го запазвате с име CFScript.txt на десктопа си:

KILLALL::ClearJavaCache::File::c:windowssystem32driversavgtpx86.sysc:program filesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exeFolder::c:usersUserAppDataRoaming.minecraftDriver::vToolbarUpdater17.0.12avgtpDDS::Trusted Zone: clonewarsadventures.comTrusted Zone: freerealms.comTrusted Zone: soe.comTrusted Zone: sony.com

След съхранението преместете  CFScript.txt на иконата на ComboFix.exe

Публикувано изображение

Генерирания рапорт копирайте  и го поставете в следващия си коментар...!

  • Харесва ми 1

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Ето лога






ComboFix 13-10-08.01 - User 10.2013 г.  16:48:42.2.2 - x86 Microsoft Windows 7 Enterprise 6.1.7601.1.1251.359.1026.18.1917.1130 [GMT 3:00] Running from: c:usersUserDownloadsComboFix.exe Command switches used :: c:usersUserDownloadsCFScript.txt.txt AV: Microsoft Security Essentials *Disabled/Updated* {641105E6-77ED-3F35-A304-765193BCB75F} SP: Microsoft Security Essentials *Disabled/Updated* {DF70E402-51D7-30BB-99B4-4D23E83BFDE2} SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}  * Created a new restore point . FILE :: "c:program filesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exe" "c:windowssystem32driversavgtpx86.sys" . . ((((((((((((((((((((((((((((((((((((((( Other Deletions ))))))))))))))))))))))))))))))))))))))))))))))))) . . c:usersUserAppDataLocalGoogleChromeUser DataDefaultPreferences c:usersUserAppDataRoaming.minecraft c:usersUserAppDataRoaming.minecraftassetsiconsicon_16x16.png c:usersUserAppDataRoaming.minecraftassetsiconsicon_32x32.png c:usersUserAppDataRoaming.minecraftassetsiconsminecraft.icns c:usersUserAppDataRoaming.minecraftassetslangaf_ZA.lang c:usersUserAppDataRoaming.minecraftassetslangar_SA.lang c:usersUserAppDataRoaming.minecraftassetslangbg_BG.lang c:usersUserAppDataRoaming.minecraftassetslangca_ES.lang c:usersUserAppDataRoaming.minecraftassetslangcs_CZ.lang c:usersUserAppDataRoaming.minecraftassetslangcy_GB.lang c:usersUserAppDataRoaming.minecraftassetslangda_DK.lang c:usersUserAppDataRoaming.minecraftassetslangde_DE.lang c:usersUserAppDataRoaming.minecraftassetslangel_GR.lang c:usersUserAppDataRoaming.minecraftassetslangen_AU.lang c:usersUserAppDataRoaming.minecraftassetslangen_CA.lang c:usersUserAppDataRoaming.minecraftassetslangen_GB.lang c:usersUserAppDataRoaming.minecraftassetslangen_PT.lang c:usersUserAppDataRoaming.minecraftassetslangeo_UY.lang c:usersUserAppDataRoaming.minecraftassetslanges_AR.lang c:usersUserAppDataRoaming.minecraftassetslanges_ES.lang c:usersUserAppDataRoaming.minecraftassetslanges_MX.lang c:usersUserAppDataRoaming.minecraftassetslanges_UY.lang c:usersUserAppDataRoaming.minecraftassetslanges_VE.lang c:usersUserAppDataRoaming.minecraftassetslanget_EE.lang c:usersUserAppDataRoaming.minecraftassetslangeu_ES.lang c:usersUserAppDataRoaming.minecraftassetslangfi_FI.lang c:usersUserAppDataRoaming.minecraftassetslangfr_CA.lang c:usersUserAppDataRoaming.minecraftassetslangfr_FR.lang c:usersUserAppDataRoaming.minecraftassetslangga_IE.lang c:usersUserAppDataRoaming.minecraftassetslanggl_ES.lang c:usersUserAppDataRoaming.minecraftassetslanghe_IL.lang c:usersUserAppDataRoaming.minecraftassetslanghi_IN.lang c:usersUserAppDataRoaming.minecraftassetslanghr_HR.lang c:usersUserAppDataRoaming.minecraftassetslanghu_HU.lang c:usersUserAppDataRoaming.minecraftassetslanghy_AM.lang c:usersUserAppDataRoaming.minecraftassetslangid_ID.lang c:usersUserAppDataRoaming.minecraftassetslangis_IS.lang c:usersUserAppDataRoaming.minecraftassetslangit_IT.lang c:usersUserAppDataRoaming.minecraftassetslangja_JP.lang c:usersUserAppDataRoaming.minecraftassetslangka_GE.lang c:usersUserAppDataRoaming.minecraftassetslangko_KR.lang c:usersUserAppDataRoaming.minecraftassetslangkw_GB.lang c:usersUserAppDataRoaming.minecraftassetslangky_KG.lang c:usersUserAppDataRoaming.minecraftassetslangla_LA.lang c:usersUserAppDataRoaming.minecraftassetslanglt_LT.lang c:usersUserAppDataRoaming.minecraftassetslanglv_LV.lang c:usersUserAppDataRoaming.minecraftassetslangmi_NZ.lang c:usersUserAppDataRoaming.minecraftassetslangms_MY.lang c:usersUserAppDataRoaming.minecraftassetslangmt_MT.lang c:usersUserAppDataRoaming.minecraftassetslangnb_NO.lang c:usersUserAppDataRoaming.minecraftassetslangnl_NL.lang c:usersUserAppDataRoaming.minecraftassetslangnn_NO.lang c:usersUserAppDataRoaming.minecraftassetslangno_NO.lang c:usersUserAppDataRoaming.minecraftassetslangoc_FR.lang c:usersUserAppDataRoaming.minecraftassetslangpl_PL.lang c:usersUserAppDataRoaming.minecraftassetslangpt_BR.lang c:usersUserAppDataRoaming.minecraftassetslangpt_PT.lang c:usersUserAppDataRoaming.minecraftassetslangqya_AA.lang c:usersUserAppDataRoaming.minecraftassetslangro_RO.lang c:usersUserAppDataRoaming.minecraftassetslangru_RU.lang c:usersUserAppDataRoaming.minecraftassetslangsk_SK.lang c:usersUserAppDataRoaming.minecraftassetslangsl_SI.lang c:usersUserAppDataRoaming.minecraftassetslangsr_SP.lang c:usersUserAppDataRoaming.minecraftassetslangsv_SE.lang c:usersUserAppDataRoaming.minecraftassetslangth_TH.lang c:usersUserAppDataRoaming.minecraftassetslangtlh_AA.lang c:usersUserAppDataRoaming.minecraftassetslangtr_TR.lang c:usersUserAppDataRoaming.minecraftassetslanguk_UA.lang c:usersUserAppDataRoaming.minecraftassetslangvi_VN.lang c:usersUserAppDataRoaming.minecraftassetslangzh_CN.lang c:usersUserAppDataRoaming.minecraftassetslangzh_TW.lang c:usersUserAppDataRoaming.minecraftassetsmusiccalm1.ogg c:usersUserAppDataRoaming.minecraftassetsmusiccalm2.ogg c:usersUserAppDataRoaming.minecraftassetsmusiccalm3.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal1.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal2.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal3.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal4.ogg c:usersUserAppDataRoaming.minecraftassetsmusicnuance1.ogg c:usersUserAppDataRoaming.minecraftassetsmusicnuance2..ogg c:usersUserAppDataRoaming.minecraftassetsmusicnuance2.ogg c:usersUserAppDataRoaming.minecraftassetsmusicpiano1.ogg c:usersUserAppDataRoaming.minecraftassetsmusicpiano2.ogg c:usersUserAppDataRoaming.minecraftassetsmusicpiano3.ogg c:usersUserAppDataRoaming.minecraftassetspack.mcmeta c:usersUserAppDataRoaming.minecraftassetsREAD_ME_I_AM_VERY_IMPORTANT c:usersUserAppDataRoaming.minecraftassetsrecords11.ogg c:usersUserAppDataRoaming.minecraftassetsrecords13.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsblocks.ogg c:usersUserAppDataRoaming.minecraftassetsrecordscat.ogg c:usersUserAppDataRoaming.minecraftassetsrecordschirp.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsfar.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsmall.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsmellohi.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsstal.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsstrad.ogg c:usersUserAppDataRoaming.minecraftassetsrecordswait.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsward.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave1.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave10.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave11.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave12.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave13.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave2.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave3.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave4.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave5.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave6.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave7.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave8.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave9.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain1.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain2.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain3.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain4.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherthunder1.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherthunder2.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherthunder3.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagefallbig.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagefallsmall.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagehit1.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagehit2.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagehit3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth4.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass1.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass2.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass3.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass4.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel1.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel2.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel3.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundfirefire.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireignite.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworksblast_far1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworksblast1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkslargeBlast_far1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkslargeBlast1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkslaunch1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkstwinkle_far1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkstwinkle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidlava.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidlavapop.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidsplash.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidsplash2.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim1.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim2.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim3.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim4.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidwater.ogg c:usersUserAppDataRoaming.minecraftassetssoundminecartbase.ogg c:usersUserAppDataRoaming.minecraftassetssoundminecartinside.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatloop.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbattakeoff.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathiss1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathiss2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathiss3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathitt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathitt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathitt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurr1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurr2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurr3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurreow1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurreow2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenplop.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickensay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickensay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickensay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreeperdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonend.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermendeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenportal.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenportal2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenstare.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastaffectionate_scream.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastcharge.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastfireball4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan7.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseangry1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsearmor.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsebreathe1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsebreathe2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsebreathe3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyangry1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyangry2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeydeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsejump.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseland.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseleather.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletondeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombieidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombieidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombieidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemthrow.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepshear.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishkill.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletondeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimeattack1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimeattack2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhaggle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhaggle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhaggle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageridle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageridle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageridle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerno1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerno2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerno3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageryes1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageryes2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageryes3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwithershoot.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherspawn.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfbark1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfbark2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfbark3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfgrowl1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfgrowl2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfgrowl3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhowl1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhowl2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfpanting.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfshake.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfwhine.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiehurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiehurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombieinfect.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiemetal1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiemetal2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiemetal3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombieremedy.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiesay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiesay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiesay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombieunfect.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewoodbreak.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpighurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpighurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotebass.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotebassattack.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotebd.ogg c:usersUserAppDataRoaming.minecraftassetssoundnoteharp.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotehat.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotepling.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotesnare.ogg c:usersUserAppDataRoaming.minecraftassetssoundportalportal.ogg c:usersUserAppDataRoaming.minecraftassetssoundportaltravel.ogg c:usersUserAppDataRoaming.minecraftassetssoundportaltrigger.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomanvil_break.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomanvil_land.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomanvil_use.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombow.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombreak.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombreath.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomburp.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomchestclosed.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomchestopen.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomclassic_hurt.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomclick.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomdoor_close.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomdoor_open.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomdrink.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomeat1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomeat2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomeat3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode4.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomfizz.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomfuse.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomglass1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomglass2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomglass3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomlevelup.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomorb.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandompop.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomsplash.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomsuccessful_hit.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomwood_click.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass6.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone6.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood6.ogg c:usersUserAppDataRoaming.minecraftassetssoundtilepistonin.ogg c:usersUserAppDataRoaming.minecraftassetssoundtilepistonout.ogg c:usersUserAppDataRoaming.minecraftgamefiles.zip c:usersUserAppDataRoaming.minecrafths_err_pid1008.log c:usersUserAppDataRoaming.minecrafths_err_pid3184.log c:usersUserAppDataRoaming.minecrafths_err_pid4160.log c:usersUserAppDataRoaming.minecraftlauncheroptions.txt c:usersUserAppDataRoaming.minecraftlibrariesargo-2.25_fixed.jar c:usersUserAppDataRoaming.minecraftlibrariesasm-all-4.1.jar c:usersUserAppDataRoaming.minecraftlibrariesbcprov-jdk15on-1.47.jar c:usersUserAppDataRoaming.minecraftlibrariescodecjorbis-20101023.jar c:usersUserAppDataRoaming.minecraftlibrariescodecwav-20101023.jar c:usersUserAppDataRoaming.minecraftlibrariescommons-io-2.4.jar c:usersUserAppDataRoaming.minecraftlibrariescommons-lang3-3.1.jar c:usersUserAppDataRoaming.minecraftlibrariesgson-2.2.2.jar c:usersUserAppDataRoaming.minecraftlibrariesguava-14.0.jar c:usersUserAppDataRoaming.minecraftlibrariesjinput-2.0.5.jar c:usersUserAppDataRoaming.minecraftlibrariesjinput-platform-2.0.5-natives-windows.jar c:usersUserAppDataRoaming.minecraftlibrariesjopt-simple-4.5.jar c:usersUserAppDataRoaming.minecraftlibrariesjutils-1.0.0.jar c:usersUserAppDataRoaming.minecraftlibrarieslibraryjavasound-20101123.jar c:usersUserAppDataRoaming.minecraftlibrarieslibrarylwjglopenal-20100824.jar c:usersUserAppDataRoaming.minecraftlibrarieslwjgl-2.9.0.jar c:usersUserAppDataRoaming.minecraftlibrarieslwjgl-platform-2.9.0-natives-windows.jar c:usersUserAppDataRoaming.minecraftlibrarieslwjgl_util-2.9.0.jar c:usersUserAppDataRoaming.minecraftlibrarieslzma-0.0.1.jar c:usersUserAppDataRoaming.minecraftlibrariessoundsystem-20120107.jar c:usersUserAppDataRoaming.minecraftMinecraft.exe c:usersUserAppDataRoaming.minecraftoptions.txt c:usersUserAppDataRoaming.minecraftoptionsof.txt c:usersUserAppDataRoaming.minecraftoutput-client.log c:usersUserAppDataRoaming.minecraftoutput-client.log.1 c:usersUserAppDataRoaming.minecraftoutput-client.log.2 c:usersUserAppDataRoaming.minecraftoutput-client.log.3 c:usersUserAppDataRoaming.minecraftoutput-server.log c:usersUserAppDataRoaming.minecraftoutput-server.log.1 c:usersUserAppDataRoaming.minecraftoutput-server.log.1.lck c:usersUserAppDataRoaming.minecraftoutput-server.log.2 c:usersUserAppDataRoaming.minecraftresourcepacks1.6_Flows_HD_128x_beta.zip c:usersUserAppDataRoaming.minecraftsavesasddataMineshaft.dat c:usersUserAppDataRoaming.minecraftsavesasddatavillages.dat c:usersUserAppDataRoaming.minecraftsavesasdlevel.dat c:usersUserAppDataRoaming.minecraftsavesasdlevel.dat_mcr c:usersUserAppDataRoaming.minecraftsavesasdlevel.dat_old c:usersUserAppDataRoaming.minecraftsavesasdplayershippnozis.dat c:usersUserAppDataRoaming.minecraftsavesasdregionr.-1.-1.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.-1.0.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.-2.-1.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.-2.0.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.0.-1.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.0.0.mca c:usersUserAppDataRoaming.minecraftsavesasdsession.lock c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISdataMineshaft.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISdatavillages.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISlevel.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISlevel.dat_mcr c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISlevel.dat_old c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISplayershippnozis.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.-1.-1.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.-1.0.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.0.-1.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.0.0.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISsession.lock c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdataMineshaft.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdataStronghold.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdataTemple.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdatavillages.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGlevel.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGlevel.dat_mcr c:usersUserAppDataRoaming.minecraftsaveshippnozisBGlevel.dat_old c:usersUserAppDataRoaming.minecraftsaveshippnozisBGplayershippnozis.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-1.-1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-1.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-2.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-2.1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-2.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.3.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-4.1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-4.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-4.3.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-5.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-5.3.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.0.-1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.0.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGsession.lock c:usersUserAppDataRoaming.minecraftscreenshots2013-10-05_20.44.58.png c:usersUserAppDataRoaming.minecraftscreenshots2013-10-05_20.59.59.png c:usersUserAppDataRoaming.minecraftstatsstats_hippnozis_unsent.dat c:usersUserAppDataRoaming.minecraftstatsstats_hippnozis_unsent.old c:usersUserAppDataRoaming.minecraftversions1. c:usersUserAppDataRoaming.minecraftversions1.6.4Optifine1.6.4Optifine.jar c:usersUserAppDataRoaming.minecraftversionsnativesjinput-dx8.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-dx8_64.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-raw.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-raw_64.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-wintab.dll c:usersUserAppDataRoaming.minecraftversionsnativeslwjgl.dll c:usersUserAppDataRoaming.minecraftversionsnativeslwjgl64.dll c:usersUserAppDataRoaming.minecraftversionsnativesOpenAL32.dll c:usersUserAppDataRoaming.minecraftversionsnativesOpenAL64.dll c:windowssystem32driversavgtpx86.sys c:windowssystem32frapsvid.dll . . ((((((((((((((((((((((((((((((((((((((( Drivers/Services ))))))))))))))))))))))))))))))))))))))))))))))))) . . -------Legacy_AVGTP -------Service_avgtp . . ((((((((((((((((((((((((( Files Created from 2013-09-10 to 2013-10-10  ))))))))))))))))))))))))))))))) . . 2013-10-08 11:29 . 2013-10-08 11:29  --------  d-----w-  c:program filesMalwarebytes' Anti-Malware 2013-10-08 11:29 . 2013-04-04 11:50  22856  ----a-w-  c:windowssystem32driversmbam.sys 2013-10-08 11:21 . 2013-10-08 11:21  --------  d-----w-  c:windowsERUNT 2013-10-08 11:14 . 2013-10-08 11:17  --------  d-----w-  C:AdwCleaner 2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:usersUserAppDataLocalLogMeIn 2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:programdataLogMeIn 2013-09-30 17:52 . 2013-09-30 17:52  --------  d-----w-  c:program filesAcclaim Entertainment 2013-09-11 17:49 . 2013-09-11 17:49  --------  d-----w-  c:programdataNexon 2013-09-11 16:49 . 2013-09-11 16:50  --------  d-----w-  c:usersUserAppDataLocalAkamai . . . (((((((((((((((((((((((((((((((((((((((( Find3M Report )))))))))))))))))))))))))))))))))))))))))))))))))))) . 2013-10-10 13:45 . 2013-10-10 13:45  40392  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{22508C58-C50A-41F9-89D2-F57EA351158A}MpKsl83bfdb04.sys 2013-10-09 13:08 . 2012-03-30 11:00  692616  ----a-w-  c:windowssystem32FlashPlayerApp.exe 2013-10-09 13:08 . 2011-08-07 14:11  71048  ----a-w-  c:windowssystem32FlashPlayerCPLApp.cpl 2013-09-06 17:07 . 2013-09-06 17:07  718712  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{A791E496-9C9C-4EC1-BCB5-B6B12246FAC6}gapaengine.dll 2013-09-05 05:02 . 2013-10-09 16:59  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{22508C58-C50A-41F9-89D2-F57EA351158A}mpengine.dll 2013-09-05 05:02 . 2013-10-09 14:55  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesBackupmpengine.dll 2013-08-22 18:02 . 2011-08-11 08:57  697992  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesNISBackupgapaengine.dll 2013-07-25 08:57 . 2013-08-14 11:25  1620992  ----a-w-  c:windowssystem32WMVDECOD.DLL 2013-07-19 01:41 . 2013-08-14 11:25  2048  ----a-w-  c:windowssystem32tzres.dll 2011-09-10 00:24 . 2013-10-01 15:48  119808  ----a-w-  c:program filesmozilla firefoxcomponentsGoogleDesktopMozilla.dll . . ((((((((((((((((((((((((((((((((((((( Reg Loading Points )))))))))))))))))))))))))))))))))))))))))))))))))) . . *Note* empty entries & legit default entries are not shown REGEDIT4 . [HKEY_CURRENT_USERSOFTWAREMicrosoftWindowsCurrentVersionRun] "DAEMON Tools Lite"="c:program filesDAEMON Tools LiteDTLite.exe" [2011-08-02 4910912] "Sidebar"="c:program filesWindows Sidebarsidebar.exe" [2010-11-20 1174016] "Skype"="c:program filesSkypePhoneSkype.exe" [2013-10-02 20472992] "Akamai NetSession Interface"="c:usersUserAppDataLocalAkamainetsession_win.exe" [2013-06-04 4489472] . [HKEY_LOCAL_MACHINESOFTWAREMicrosoftWindowsCurrentVersionRun] "BCSSync"="c:program filesMicrosoft OfficeOffice14BCSSync.exe" [2010-03-13 91520] "ZSSnp211"="c:windowsZSSnp211.exe" [2007-04-06 57344] "Google Desktop Search"="c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe" [2011-09-10 30192] "MSC"="c:program filesMicrosoft Security Clientmsseces.exe" [2013-06-20 995176] "IgfxTray"="c:windowssystem32igfxtray.exe" [2012-11-13 138784] "HotKeysCmds"="c:windowssystem32hkcmd.exe" [2012-11-13 172064] "Persistence"="c:windowssystem32igfxpers.exe" [2012-11-13 173600] "SunJavaUpdateSched"="c:program filesCommon FilesJavaJava Updatejusched.exe" [2013-03-12 253816] "LogMeIn Hamachi Ui"="d:downloadsmyНова папкаhamachi-2-ui.exe" [2013-10-01 2345296] . [HKEY_LOCAL_MACHINEsoftwaremicrosoftwindowscurrentversionpoliciessystem] "ConsentPromptBehaviorUser"= 3 (0x3) "EnableUIADesktopToggle"= 0 (0x0) . [HKEY_LOCAL_MACHINEsoftwaremicrosoftwindows ntcurrentversionwindows] "AppInit_DLLs"=c:progra~1GoogleGOOGLE~2GoogleDesktopNetwork3.dll . [HKEY_LOCAL_MACHINESYSTEMCurrentControlSetControlSafeBootMinimalMsMpSvc] @="Service" . [HKLM~startupfolderC:^Users^User^AppData^Roaming^Microsoft^Windows^Start Menu^Programs^Startup^GamersFirst LIVE!.lnk] path=c:usersUserAppDataRoamingMicrosoftWindowsStart MenuProgramsStartupGamersFirst LIVE!.lnk backup=c:windowspssGamersFirst LIVE!.lnk.Startup backupExtension=.Startup . [HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregDomino] 2006-08-18 13:58  49152  ----a-w-  c:windowsDomino.exe . [HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregFacebook Update] 2012-07-11 20:44  138096  ----atw-  c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe . R2 SkypeUpdate;Skype Updater;c:program filesSkypeUpdaterUpdater.exe [2013-09-05 171680] R3 dmvsc;dmvsc;c:windowssystem32driversdmvsc.sys [2010-11-20 62464] R3 EagleXNt;EagleXNt;c:windowssystem32driversEagleXNt.sys [x] R3 FairplayKD;FairplayKD;c:programdataMTA San Andreas All1.3tempFairplayKD.sys [x] R3 GoogleDesktopManager-051210-111108;Диспечер на Google Desktop 5.9.1005.12335;c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe [2011-09-10 30192] R3 NisDrv;Microsoft Network Inspection System;c:windowssystem32DRIVERSNisDrvWFP.sys [2013-06-18 107392] R3 NisSrv;Мрежова проверка на Microsoft;c:program filesMicrosoft Security ClientNisSrv.exe [2013-06-20 295376] R3 RdpVideoMiniport;Remote Desktop Video Miniport Driver;c:windowssystem32driversrdpvideominiport.sys [2010-11-20 15872] R3 Synth3dVsc;Synth3dVsc;c:windowssystem32driverssynth3dvsc.sys [2010-11-20 77184] R3 terminpt;Microsoft Remote Desktop Input Driver;c:windowssystem32driversterminpt.sys [2010-11-20 25600] R3 TsUsbFlt;TsUsbFlt;c:windowssystem32driverstsusbflt.sys [2010-11-20 52224] R3 TsUsbGD;Remote Desktop Generic USB Device;c:windowssystem32driversTsUsbGD.sys [2010-11-20 27264] R3 tsusbhub;tsusbhub;c:windowssystem32driverstsusbhub.sys [2010-11-20 112640] R3 VGPU;VGPU;c:windowssystem32driversrdvgkmd.sys [x] R3 vvftav211;vvftav211;c:windowssystem32driversvvftav211.sys [2007-12-10 480128] R3 WatAdminSvc;Услуга на технологиите за активиране на Windows;c:windowssystem32WatWatAdminSvc.exe [2011-08-05 1343400] R3 WinRing0_1_2_0;WinRing0_1_2_0;d:mcRazer Game BoosterDriverWinRing0.sys [x] R3 XDva394;XDva394;c:windowssystem32XDva394.sys [x] R3 XDva397;XDva397;c:windowssystem32XDva397.sys [x] R3 XDva399;XDva399;c:windowssystem32XDva399.sys [x] R3 XDva401;XDva401;c:windowssystem32XDva401.sys [x] R3 ZSMC30x;USB PC Camera Service ZSMC30x;c:windowssystem32DriversZS211.sys [2007-12-05 1537024] S1 dtsoftbus01;DAEMON Tools Virtual Bus Driver;c:windowssystem32DRIVERSdtsoftbus01.sys [2011-08-05 232512] S1 MpKsl83bfdb04;MpKsl83bfdb04;c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{22508C58-C50A-41F9-89D2-F57EA351158A}MpKsl83bfdb04.sys [2013-10-10 40392] S2 Hamachi2Svc;LogMeIn Hamachi Tunneling Engine;d:downloadsmyНова папкаhamachi-2.exe [2013-10-01 1612112] S2 RzKLService;RzKLService;d:mcRazer Game BoosterRzKLService.exe [2013-09-18 106472] S2 Skype C2C Service;Skype C2C Service;c:programdataSkypeToolbarsSkype C2C Servicec2c_service.exe [2013-09-16 3273088] S2 TeamViewer8;TeamViewer 8;c:program filesTeamViewerVersion8TeamViewer_Service.exe [2013-08-07 4308320] S3 RTL8167;Realtek 8167 NT Driver;c:windowssystem32DRIVERSRt86win7.sys [2009-03-01 139776] . . [HKEY_LOCAL_MACHINEsoftwaremicrosoftactive setupinstalled components{8A69D345-D564-463c-AFF1-A69D9E530F96}] 2013-10-06 11:22  1185744  ----a-w-  c:program filesGoogleChromeApplication30.0.1599.69Installerchrmstp.exe . Contents of the 'Scheduled Tasks' folder . 2013-10-10 c:windowsTasksAdobe Flash Player Updater.job - c:windowssystem32MacromedFlashFlashPlayerUpdateService.exe [2012-03-30 13:08] . 2013-10-05 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000Core.job - c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44] . 2013-10-10 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000UA.job - c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44] . 2013-10-10 c:windowsTasksGoogleUpdateTaskMachineCore.job - c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14] . 2013-10-10 c:windowsTasksGoogleUpdateTaskMachineUA.job - c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14] . . ------- Supplementary Scan ------- . uInternet Settings,ProxyOverride = <local> IE: Download all by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm IE: Download by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm IE: E&xport to Microsoft Excel - c:progra~1MICROS~2Office14EXCEL.EXE/3000 IE: Free YouTube Download - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeytvdownloader.htm IE: Free YouTube to MP3 Converter - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeyoutubetomp3converter.htm IE: Se&nd to OneNote - c:progra~1MICROS~2Office14ONBttnIE.dll/105 IE: ????3?? - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm IE: ????3?????? - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm FF - ProfilePath - c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.default FF - prefs.js: browser.search.defaulturl - FF - ExtSQL: 2013-09-30 19:10; WebSiteRecommendation@weliketheweb.com; c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultextensionsWebSiteRecommendation@weliketheweb.com . . --------------------- LOCKED REGISTRY KEYS --------------------- . [HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}Џ] @Allowed: (Read) (RestrictedCode) @="c:Program FilesFlashGet NetworkFlashGet 3GetUrl.htm" "contexts"=dword:00000022 . [HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}ЏhQиђю”Ґc] @Allowed: (Read) (RestrictedCode) @="c:Program FilesFlashGet NetworkFlashGet 3GetAllUrl.htm" "contexts"=dword:000000f3 . [HKEY_LOCAL_MACHINESYSTEMControlSet001ControlClass{4D36E96D-E325-11CE-BFC1-08002BE10318}0000AllUserSettings] @Denied: (A) (Users) @Denied: (A) (Everyone) @Allowed: (B 1 2 3 4 5) (S-1-5-20) "BlindDial"=dword:00000000 . [HKEY_LOCAL_MACHINESYSTEMControlSet001ControlPCWSecurity] @Denied: (Full) (Everyone) . ------------------------ Other Running Processes ------------------------ . c:program filesMicrosoft Security ClientMsMpEng.exe c:windowssystem32PnkBstrA.exe c:windowssystem32taskhost.exe c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSVC.EXE c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSvcM.exe d:downloadsmyd:downloadsmyd:downloadsmyd:downloadsmyc:windowssystem32svchost.exe c:windowsSystem32WUDFHost.exe c:windowssystem32conhost.exe c:windowssystem32DllHost.exe c:windowssystem32sppsvc.exe c:program filesWindows Media Playerwmpnetwk.exe c:windowssystem32taskhost.exe . ************************************************************************** . Completion time: 2013-10-10  17:00:57 - machine was rebooted ComboFix-quarantined-files.txt  2013-10-10 14:00 ComboFix2.txt  2013-10-09 13:37 . Pre-Run: 20 357 251 072 bytes free Post-Run: 20 209 168 384 bytes free . - - End Of File - - 393043544EF5FC5DEAE02717291FDDBF A36C5E4F47E84449FF07ED3517B43A31  

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Какво е положението със системата ви след процедурите до тук..? Наблюдавате ли първоначалните проблеми...?

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Системата се държи доста добре.Имам чувството че все едно е преинсталирана .. :)


Радвам се ,че съм бил полезен..! :)



Деинсталирайте ComboFix така:

[*]Натиснете Start ==> Run ==> въведете командата Combofix /Uninstall ==> OK

[*]Публикувано изображение

[*]Моля, следвайте инструкциите, за да деинсталирате ComboFix. Ще получите съобщение, в което се казва ComboFix е деинсталиран успешно.


Публикувано изображение Изтеглете Delfix.exe и го стартирайте. Сложете отметка пред Remove disinfection tools => натиснете бутона Run Инструмента ще се самоизтрие след като приключи своята задача!


Публикувано изображение Деинсталирайте adwcleaner.exe

[*]Моля, затворете всички отворени програми и интернет браузъри.

[*]Кликнете два пъти върху adwcleaner.exe за да стартирате инструмента.

[*]Кликнете върху Uninstall .

[*]Щракнете върху Yes за да деинсталирате Adwcleaner


Публикувано изображение Изтрийте всичко друго което е останало след процедурите (използвано в лечението).Препоръчвам програмата Malwarebytes' Anti-Malware  да остане на вашия компютър и периодично да сканирате системата си с нея (поне един -два пъти в седмицата),като не забравяйте да обновите дефинициите и преди всяко сканиране..!


Стартирайте PatchMyPC и инсталирайте всички ъпдейти, които инструмента ви предложи.


Ако няма други проблеми,маркирам случая за "РЕШЕН"..Бъдете здрави и ви пожелавам безопасен интернет..! :)

  • Харесва ми 2

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Регистрирайте се или влезете в профила си за да коментирате

Трябва да имате регистрация за да може да коментирате това

Регистрирайте се

Създайте нова регистрация в нашия форум. Лесно е!

Нова регистрация


Имате регистрация? Влезте от тук.


  • Горещи теми в момента

  • Подобни теми

    • от mamasve
      Здравейте , 
      имам вирус на компютъра , който постоянно ми инсталира икона на десктопа Panda viewer и когато отворя който и да е браузър започва да ме пренасочва към всевъзможни сайтове и практически не мога да си ползвам компа вече . Помощ , моля ! 
    • от AHybuC
      От тази сутрин не съм способен нормално да стартирам компютъра си. Веднага щом зареди Windows-a, появява се прозорче, в което пише "Windows has encountered a critical problem and will restart automatically in one minute" и както съобщението гласи, след една минута се рестартирва компютъра. Понякога дори се появява директно синия екран, още преди да е успял да зареди Windows-a, с код на грешката 0x000000F4. Направих пълно сканиране с Malwarebytes и Kaspersky Rescue CD 10, отстраниха проблемите, които откриха, но проблемът с рестартирването е все още присъстващ. Редно е да спомена, че в Safe Mode не изпитвам автоматични рестартирвания. Също така, премахнах отметката от Startup and Recovery -> System Failure -> Automatically Restart, но продължават да са налични рестартирванията, само че отметката я бях премахнал, докато бях в Safe Mode. Не знам дали това е от значение, но все пак исках да спомена това.
      Scan result of Farbar Recovery Scan Tool (FRST) (x86) Version: 15.04.2018
      Ran by IvailoCOMP (administrator) on IVAILOCOMP-PC (18-04-2018 19:02:33)
      Running from C:\Users\IvailoCOMP\Desktop
      Loaded Profiles: IvailoCOMP (Available Profiles: IvailoCOMP)
      Platform: Microsoft Windows 7 Ultimate  Service Pack 1 (X86) Language: English (United States)
      Internet Explorer Version 11 (Default browser: FF)
      Boot Mode: Safe Mode (with Networking)
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      (LogMeIn Inc.) C:\Program Files\LogMeIn Hamachi\hamachi-2.exe
      (LogMeIn, Inc.) C:\Program Files\LogMeIn Hamachi\LMIGuardianSvc.exe
      (Malwarebytes) C:\Program Files\Malwarebytes\Anti-Malware\MBAMService.exe
      (Microsoft Corporation) C:\Windows\System32\dllhost.exe
      (Malwarebytes) C:\Program Files\Malwarebytes\Anti-Malware\mbam.exe
      (Malwarebytes) C:\Program Files\Malwarebytes\Anti-Malware\mbamtray.exe
      (Mozilla Corporation) C:\Program Files\Mozilla Firefox\firefox.exe
      (Mozilla Corporation) C:\Program Files\Mozilla Firefox\firefox.exe
      (Mozilla Corporation) C:\Program Files\Mozilla Firefox\firefox.exe
      (Mozilla Corporation) C:\Program Files\Mozilla Firefox\firefox.exe
      (Mozilla Corporation) C:\Program Files\Mozilla Firefox\firefox.exe
      (Mozilla Corporation) C:\Program Files\Mozilla Firefox\firefox.exe
      (Microsoft Corporation) C:\Windows\System32\dllhost.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [] => [X]
      HKU\S-1-5-21-1339006810-3010099187-1440784813-1001\...\Policies\Explorer: [NoLowDiskSpaceChecks] 1
      HKU\S-1-5-21-1339006810-3010099187-1440784813-1001\...\Policies\Explorer: [NoSMBalloonTip] 0
      HKU\S-1-5-21-1339006810-3010099187-1440784813-1001\...\Policies\Explorer: [NoDesktopCleanupWizard] 1
      HKU\S-1-5-21-1339006810-3010099187-1440784813-1001\Control Panel\Desktop\\SCRNSAVE.EXE -> C:\Windows\system32\scrnsave.scr [10240 2009-07-14] (Microsoft Corporation)
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      Hosts: There are more than one entry in Hosts. See Hosts section of Addition.txt
      Tcpip\..\Interfaces\{1290CD49-798E-4B6B-9CB6-A0F176F07BD0}: [DhcpNameServer]
      Internet Explorer:
      BHO: Adobe PDF Reader Link Helper -> {06849E9F-C8D7-4D59-B87D-784B7D6BE0B3} -> C:\Program Files\Common Files\Adobe\Acrobat\ActiveX\AcroIEHelper.dll [2012-09-23] (Adobe Systems Incorporated)
      BHO: BitComet Helper -> {39F7E362-828A-4B5A-BCAF-5B79BFDFEA60} -> C:\Program Files\BitComet\tools\BitCometBHO_1.5.4.11.dll [2011-04-11] (BitComet)
      BHO: Groove GFS Browser Helper -> {72853161-30C5-4D22-B7F9-0BBC1D38A37E} -> C:\Program Files\Microsoft Office\Office14\GROOVEEX.DLL [2013-12-19] (Microsoft Corporation)
      BHO: Java(tm) Plug-In SSV Helper -> {761497BB-D6F0-462C-B6EB-D4DAF1D92D43} -> C:\Program Files\Java\jre1.8.0_91\bin\ssv.dll [2016-05-12] (Oracle Corporation)
      BHO: ArcPluginIEBHO Class -> {84BFE29A-8139-402a-B2A4-C23AE9E1A75F} -> C:\Program Files\Perfect World Entertainment\Arc\plugins\ArcPluginIE.dll => No File
      BHO: Microsoft Web Test Recorder 10.0 Helper -> {876d9f09-c6d6-4324-a2cc-04dd9a4de12f} -> C:\Program Files\Microsoft Visual Studio 11.0\Common7\IDE\PrivateAssemblies\Microsoft.VisualStudio.QualityTools.RecorderBarBHO100.dll [2012-07-26] (Microsoft Corporation)
      BHO: Adobe Acrobat Create PDF Helper -> {AE7CD045-E861-484f-8273-0445EE161910} -> C:\Program Files\Common Files\Adobe\Acrobat\WCIEActiveX\AcroIEFavClient.dll [2014-09-12] (Adobe Systems Incorporated)
      BHO: Office Document Cache Handler -> {B4F3A835-0E21-4959-BA22-42B3008E02FF} -> C:\Program Files\Microsoft Office\Office14\URLREDIR.DLL [2013-03-06] (Microsoft Corporation)
      BHO: Java(tm) Plug-In 2 SSV Helper -> {DBC80044-A445-435b-BC74-9C25C1C588A9} -> C:\Program Files\Java\jre1.8.0_91\bin\jp2ssv.dll [2016-05-12] (Oracle Corporation)
      BHO: Adobe Acrobat Create PDF from Selection -> {F4971EE7-DAA0-4053-9964-665D8EE6A077} -> C:\Program Files\Common Files\Adobe\Acrobat\WCIEActiveX\AcroIEFavClient.dll [2014-09-12] (Adobe Systems Incorporated)
      Toolbar: HKLM - Adobe Acrobat Create PDF Toolbar - {47833539-D0C5-4125-9FA8-0819E2EAAC93} - C:\Program Files\Common Files\Adobe\Acrobat\WCIEActiveX\AcroIEFavClient.dll [2014-09-12] (Adobe Systems Incorporated)
      Handler: skype4com - {FFC8B962-9B40-4DFF-9458-1830C7DD7F5D} - C:\Program Files\Common Files\Skype\Skype4COM.dll [2017-07-18] (Skype Technologies)
      FF ProfilePath: C:\Users\IvailoCOMP\AppData\Roaming\Mozilla\Firefox\Profiles\qhtq97on.default [2018-04-18]
      FF Homepage: Mozilla\Firefox\Profiles\qhtq97on.default -> google.bg
      FF NewTab: Mozilla\Firefox\Profiles\qhtq97on.default -> about:home
      FF Session Restore: Mozilla\Firefox\Profiles\qhtq97on.default -> is enabled.
      FF NewTabOverride: Mozilla\Firefox\Profiles\qhtq97on.default -> Enabled: newtaboverride@agenedia.com
      FF Extension: (Adblocker X) - C:\Users\IvailoCOMP\AppData\Roaming\Mozilla\Firefox\Profiles\qhtq97on.default\Extensions\@adblock57.xpi [2018-04-11]
      FF Extension: (MEGA) - C:\Users\IvailoCOMP\AppData\Roaming\Mozilla\Firefox\Profiles\qhtq97on.default\Extensions\firefox@mega.co.nz.xpi [2018-04-13]
      FF Extension: (UniverseView Extension) - C:\Users\IvailoCOMP\AppData\Roaming\Mozilla\Firefox\Profiles\qhtq97on.default\Extensions\firefox@universeview.ext.xpi [2017-03-01]
      FF Extension: (h264ify) - C:\Users\IvailoCOMP\AppData\Roaming\Mozilla\Firefox\Profiles\qhtq97on.default\Extensions\jid1-TSgSxBhncsPBWQ@jetpack.xpi [2017-08-03]
      FF Extension: (New Tab Override) - C:\Users\IvailoCOMP\AppData\Roaming\Mozilla\Firefox\Profiles\qhtq97on.default\Extensions\newtaboverride@agenedia.com.xpi [2018-02-04]
      FF Extension: (Greasemonkey) - C:\Users\IvailoCOMP\AppData\Roaming\Mozilla\Firefox\Profiles\qhtq97on.default\Extensions\{e4a8a97b-f2ed-450b-b12d-ee082ba24781}.xpi [2018-03-17]
      FF Extension: (TLS 1.3 gradual roll-out) - C:\Users\IvailoCOMP\AppData\Roaming\Mozilla\Firefox\Profiles\qhtq97on.default\features\{15eba6de-45fd-4321-9dcb-85b0a795c148}\tls13-rollout-bug1442042@mozilla.org.xpi [2018-04-08] [Legacy]
      FF SearchPlugin: C:\Users\IvailoCOMP\AppData\Roaming\Mozilla\Firefox\Profiles\qhtq97on.default\searchplugins\yahoo-lavasoft.xml [2016-07-21]
      FF HKLM\...\Firefox\Extensions: [web2pdfextension@web2pdf.adobedotcom] - C:\Program Files\Adobe\Acrobat 11.0\Acrobat\Browser\WCFirefoxExtn
      FF Extension: (Adobe Acrobat - Create PDF) - C:\Program Files\Adobe\Acrobat 11.0\Acrobat\Browser\WCFirefoxExtn [2014-09-28] [Legacy] [not signed]
      FF Plugin: @adobe.com/FlashPlayer -> C:\Windows\system32\Macromed\Flash\NPSWF32_29_0_0_140.dll [2018-04-11] ()
      FF Plugin: @java.com/DTPlugin,version=11.91.2 -> C:\Program Files\Java\jre1.8.0_91\bin\dtplugin\npDeployJava1.dll [2016-05-12] (Oracle Corporation)
      FF Plugin: @java.com/JavaPlugin,version=11.91.2 -> C:\Program Files\Java\jre1.8.0_91\bin\plugin2\npjp2.dll [2016-05-12] (Oracle Corporation)
      FF Plugin: @microsoft.com/GENUINE -> disabled [No File]
      FF Plugin: @Microsoft.com/NpCtrl,version=1.0 -> C:\Program Files\Microsoft Silverlight\5.1.50907.0\npctrl.dll [2017-05-03] ( Microsoft Corporation)
      FF Plugin: @microsoft.com/OfficeAuthz,version=14.0 -> C:\PROGRA~1\MICROS~2\Office14\NPAUTHZ.DLL [2010-01-09] (Microsoft Corporation)
      FF Plugin: @microsoft.com/SharePoint,version=14.0 -> C:\PROGRA~1\MICROS~2\Office14\NPSPWRAP.DLL [2010-03-24] (Microsoft Corporation)
      FF Plugin: @ngm.nexoneu.com/NxGame -> C:\ProgramData\NexonEU\NGM\npnxgameEU.dll [2017-03-22] (Nexon)
      FF Plugin: @nvidia.com/3DVision -> C:\Program Files\NVIDIA Corporation\3D Vision\npnv3dv.dll [2016-01-29] (NVIDIA Corporation)
      FF Plugin: @nvidia.com/3DVisionStreaming -> C:\Program Files\NVIDIA Corporation\3D Vision\npnv3dvstreaming.dll [2016-01-29] (NVIDIA Corporation)
      FF Plugin: @perfectworld.com/npArcPlayNowPlugin -> C:\Program Files\Perfect World Entertainment\Arc\plugins\npArcPluginFF.dll [No File]
      FF Plugin: @Webzen.com/NPBrowserExt -> C:\Program Files\WEBZEN\BrowserExtension\NPWZCmnCtrl.dll [2012-03-27] (WEBZEN)
      FF Plugin: Adobe Acrobat -> C:\Program Files\Adobe\Acrobat 11.0\Acrobat\Air\nppdf32.dll [2014-09-12] (Adobe Systems Inc.)
      FF Plugin: adobe.com/AdobeAAMDetect -> C:\Program Files\Common Files\Adobe\OOBE\PDApp\CCM\Utilities\npAdobeAAMDetect32.dll [2013-03-21] (Adobe Systems)
      FF Plugin HKU\S-1-5-21-1339006810-3010099187-1440784813-1001: @fancyguo.com/FancyGame,version= -> C:\Users\IvailoCOMP\AppData\Local\Fancy\npfancygame.dll [2015-05-10] (Hongfeng Hengyu (Beijing) Tech Ltd.)
      FF Plugin HKU\S-1-5-21-1339006810-3010099187-1440784813-1001: @unity3d.com/UnityPlayer,version=1.0 -> C:\Users\IvailoCOMP\AppData\LocalLow\Unity\WebPlayer\loader\npUnity3D32.dll [2015-06-13] (Unity Technologies ApS)
      FF Plugin HKU\S-1-5-21-1339006810-3010099187-1440784813-1001: xyzgl-plugin@xyz-soft.com -> C:\Program Files\Alfheim\npxyzgl.dll [2012-06-13] (XYZ-SOFT Inc.)
      CHR HKLM\...\Chrome\Extension: [efaidnbmnnnibpcajpcglclefindmkaj] - C:\Program Files\Adobe\Acrobat 11.0\Acrobat\Browser\WCChromeExtn\WCChromeExtn.crx [2014-09-12]
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      S2 CachemanService; C:\Program Files\Cacheman\CachemanServ.exe [210944 2009-05-16] (Outertech) [File not signed]
      S3 EasyAntiCheat; C:\Windows\system32\EasyAntiCheat.exe [382504 2017-05-17] (EasyAntiCheat Ltd)
      S2 ekrn; C:\Program Files\ESET\ESET NOD32 Antivirus\ekrn.exe [1353720 2015-07-08] (ESET)
      S2 EslWireHelper; D:\Games\EslWire\service\WireHelperSvc.exe [614416 2014-01-28] ()
      S3 fussvc; C:\Program Files\Windows Kits\8.0\App Certification Kit\fussvc.exe [133632 2012-07-25] (Microsoft Corporation) [File not signed]
      S2 GfExperienceService; C:\Program Files\NVIDIA Corporation\GeForce Experience Service\GfExperienceService.exe [930240 2016-06-14] (NVIDIA Corporation)
      R2 Hamachi2Svc; C:\Program Files\LogMeIn Hamachi\hamachi-2.exe [2283432 2017-06-29] (LogMeIn Inc.)
      S2 HiPatchService; D:\Program Files\Hi-Rez Studios\HiPatchService.exe [9728 2017-05-11] (Hi-Rez Studios) [File not signed]
      S2 LMIGuardianSvc; C:\Program Files\LogMeIn Hamachi\LMIGuardianSvc.exe [405424 2016-05-27] (LogMeIn, Inc.)
      R2 MBAMService; C:\Program Files\Malwarebytes\Anti-Malware\mbamservice.exe [4707104 2018-03-27] (Malwarebytes)
      S3 McComponentHostService; C:\Program Files\McAfee Security Scan\3.11.309\McCHSvc.exe [239880 2016-03-11] (McAfee, Inc.)
      S3 npggsvc; C:\Windows\system32\GameMon.des [5284208 2013-10-30] (INCA Internet Co., Ltd.)
      S2 NvNetworkService; C:\Program Files\NVIDIA Corporation\NetService\NvNetworkService.exe [1879488 2016-06-14] (NVIDIA Corporation)
      S3 NvStreamNetworkSvc; C:\Program Files\NVIDIA Corporation\NvStreamSrv\NvStreamNetworkService.exe [2904000 2016-06-14] (NVIDIA Corporation)
      S2 NvStreamSvc; C:\Program Files\NVIDIA Corporation\NvStreamSrv\NvStreamService.exe [2016704 2016-06-14] (NVIDIA Corporation)
      S2 OracleOraDb11g_home1TNSListener; D:\app\IvailoCOMP\product\11.2.0\dbhome_1\BIN\TNSLSNR.exe [512000 2010-03-31] (Oracle Corporation) [File not signed]
      S3 OverwolfUpdater; C:\Program Files\Overwolf\OverwolfUpdater.exe [1453384 2018-04-08] (Overwolf LTD)
      S2 PnkBstrA; C:\Windows\system32\PnkBstrA.exe [66872 2014-10-13] ()
      S3 Te.Service; C:\Program Files\Windows Kits\8.0\Testing\Runtimes\TAEF\Wex.Services.exe [94208 2012-07-25] (Microsoft Corporation) [File not signed]
      S3 TeamViewer; C:\Program Files\TeamViewer\TeamViewer_Service.exe [10803440 2017-07-26] (TeamViewer GmbH)
      R2 WinDefend; C:\Program Files\Windows Defender\mpsvc.dll [680960 2013-05-27] (Microsoft Corporation)
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      S3 1394hub; C:\Windows\System32\svchost.exe [20992 2009-07-14] (Microsoft Corporation)
      S3 apf004; C:\Windows\system32\apf004.sys [15112 2015-02-14] ()
      R1 dtsoftbus01; C:\Windows\System32\DRIVERS\dtsoftbus01.sys [242240 2013-11-22] (DT Soft Ltd)
      S1 eamonm; C:\Windows\System32\DRIVERS\eamonm.sys [202704 2015-07-14] (ESET)
      S1 ehdrv; C:\Windows\System32\DRIVERS\ehdrv.sys [144536 2015-07-14] (ESET)
      S2 epfwwfpr; C:\Windows\System32\DRIVERS\epfwwfpr.sys [132152 2015-07-14] (ESET)
      R0 ESLWireAC; C:\Windows\System32\drivers\ESLWireACD.sys [31008 2015-02-12] (<Turtle Entertainment>)
      S3 EuMusDesignVirtualAudioCableWdm; C:\Windows\System32\DRIVERS\vrtaucbl.sys [42496 2007-05-15] (Eugene V. Muzychenko) [File not signed]
      R3 hamachi; C:\Windows\System32\DRIVERS\hamachi.sys [26176 2009-03-18] (LogMeIn, Inc.)
      R2 MBAMChameleon; C:\Windows\System32\Drivers\MbamChameleon.sys [167656 2018-04-18] (Malwarebytes)
      S3 MBAMProtection; C:\Windows\System32\DRIVERS\mbam.sys [40160 2018-04-18] (Malwarebytes)
      R3 MBAMSwissArmy; C:\Windows\System32\Drivers\mbamswissarmy.sys [220896 2018-04-18] (Malwarebytes)
      S3 NPPTNT2; C:\Windows\system32\npptNT2.sys [4682 2005-01-04] (INCA Internet Co., Ltd.) [File not signed]
      S3 NvStreamKms; C:\Program Files\NVIDIA Corporation\NvStreamSrv\NvStreamKms.sys [26048 2016-06-14] (NVIDIA Corporation)
      S3 nvvad_WaveExtensible; C:\Windows\System32\drivers\nvvad32v.sys [50744 2016-04-14] (NVIDIA Corporation)
      S3 SDGame; C:\Windows\System32\svchost.exe [20992 2009-07-14] (Microsoft Corporation)
      S0 sfdrv01a; C:\Windows\System32\drivers\sfdrv01a.sys [63352 2006-07-05] (Protection Technology (StarForce))
      S0 sfsync04; C:\Windows\System32\drivers\sfsync04.sys [59776 2006-08-11] (Protection Technology (StarForce))
      S3 tap0901; C:\Windows\System32\DRIVERS\tap0901.sys [33664 2016-03-11] (The OpenVPN Project)
      S3 VSPerfDrv110; C:\Program Files\Microsoft Visual Studio 11.0\Team Tools\Performance Tools\VSPerfDrv110.sys [55416 2012-07-13] (Microsoft Corporation)
      U4 CiSvc; no ImagePath
      U4 Messenger; no ImagePath
      S3 VGPU; System32\drivers\rdvgkmd.sys [X]
      S3 xhunter1; \??\C:\Windows\xhunter1.sys [X]
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-04-18 19:02 - 2018-04-18 19:04 - 000014732 _____ C:\Users\IvailoCOMP\Desktop\FRST.txt
      2018-04-18 19:02 - 2018-04-18 19:02 - 000000000 ____D C:\FRST
      2018-04-18 19:01 - 2018-04-18 19:02 - 001763840 _____ (Farbar) C:\Users\IvailoCOMP\Desktop\FRST.exe
      2018-04-18 18:29 - 2018-04-18 18:55 - 000040160 _____ (Malwarebytes) C:\Windows\system32\Drivers\mbam.sys
      2018-04-18 18:29 - 2018-04-18 18:29 - 000167656 _____ (Malwarebytes) C:\Windows\system32\Drivers\MbamChameleon.sys
      2018-04-18 18:28 - 2018-04-18 18:28 - 000220896 _____ (Malwarebytes) C:\Windows\system32\Drivers\mbamswissarmy.sys
      2018-04-18 18:28 - 2018-04-18 18:28 - 000002024 _____ C:\Users\Public\Desktop\Malwarebytes.lnk
      2018-04-18 18:28 - 2018-04-18 18:28 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Malwarebytes
      2018-04-18 18:28 - 2018-04-18 18:28 - 000000000 ____D C:\ProgramData\Malwarebytes
      2018-04-18 18:28 - 2018-04-18 18:28 - 000000000 ____D C:\Program Files\Malwarebytes
      2018-04-18 18:28 - 2018-03-19 12:57 - 000058656 _____ C:\Windows\system32\Drivers\mbae.sys
      2018-04-18 18:27 - 2018-04-18 18:27 - 073254968 _____ (Malwarebytes ) C:\Users\IvailoCOMP\Desktop\mb3-setup-consumer-
      2018-04-18 18:22 - 2018-04-18 18:22 - 000001270 _____ C:\Users\IvailoCOMP\Desktop\asda.lnk
      2018-04-18 18:04 - 2018-04-18 18:07 - 000005192 _____ C:\Users\IvailoCOMP\Desktop\Rkill.txt
      2018-04-18 17:54 - 2018-04-18 17:54 - 000003408 ____N C:\bootsqm.dat
      2018-04-18 17:52 - 2018-04-18 17:52 - 000000000 __SHD C:\found.000
      2018-04-18 17:37 - 2018-04-18 17:37 - 000151072 _____ C:\Windows\Minidump\041818-20997-01.dmp
      2018-04-18 17:11 - 2018-04-18 17:11 - 000151312 _____ C:\Windows\Minidump\041818-23821-01.dmp
      2018-04-18 13:42 - 2018-04-18 20:07 - 000000000 ____D C:\Kaspersky Rescue Disk 10.0
      2018-04-18 10:33 - 2018-04-18 10:33 - 000001261 _____ C:\Users\Public\Desktop\Ashampoo Burning Studio 18.lnk
      2018-04-18 10:33 - 2018-04-18 10:33 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Ashampoo
      2018-04-18 10:26 - 2018-04-18 10:33 - 000000221 _____ C:\Users\Public\Desktop\Ashampoo Deals.url
      2018-04-18 10:26 - 2018-04-18 10:33 - 000000000 ____D C:\ProgramData\Ashampoo
      2018-04-18 10:14 - 2018-04-18 10:18 - 338960384 _____ C:\Users\IvailoCOMP\Desktop\kav_rescue_10.iso
      2018-04-18 10:12 - 2018-04-18 10:12 - 000001270 _____ C:\Users\IvailoCOMP\Desktop\shutdown.exe.lnk
      2018-04-18 10:11 - 2018-04-18 18:54 - 000424982 _____ C:\Windows\ntbtlog.txt
      2018-04-18 10:10 - 2018-04-18 10:10 - 000000000 _____ C:\Users\IvailoCOMP\Desktop\New shortcut.lnk
      2018-04-18 09:57 - 2018-04-18 09:57 - 000151696 _____ C:\Windows\Minidump\041818-19999-01.dmp
      2018-04-18 09:54 - 2018-04-18 09:54 - 000151696 _____ C:\Windows\Minidump\041818-18954-01.dmp
      2018-04-18 09:40 - 2018-04-18 17:37 - 286301067 _____ C:\Windows\MEMORY.DMP
      2018-04-18 09:40 - 2018-04-18 17:37 - 000000000 ____D C:\Windows\Minidump
      2018-04-18 09:40 - 2018-04-18 09:40 - 000152656 _____ C:\Windows\Minidump\041818-29546-01.dmp
      2018-04-16 10:43 - 2018-03-31 04:39 - 004046528 _____ (Microsoft Corporation) C:\Windows\system32\ntkrnlpa.exe
      2018-04-16 10:43 - 2018-03-31 04:39 - 003958464 _____ (Microsoft Corporation) C:\Windows\system32\ntoskrnl.exe
      2018-04-16 10:43 - 2018-03-31 04:39 - 000190144 _____ (Microsoft Corporation) C:\Windows\system32\halmacpi.dll
      2018-04-16 10:43 - 2018-03-31 04:39 - 000190144 _____ (Microsoft Corporation) C:\Windows\system32\hal.dll
      2018-04-16 10:43 - 2018-03-31 04:39 - 000137920 _____ (Microsoft Corporation) C:\Windows\system32\halacpi.dll
      2018-04-16 10:43 - 2018-03-31 04:39 - 000137920 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ksecpkg.sys
      2018-04-16 10:43 - 2018-03-31 04:39 - 000067264 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ksecdd.sys
      2018-04-16 10:43 - 2018-03-31 04:12 - 001310480 _____ (Microsoft Corporation) C:\Windows\system32\ntdll.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 001063424 _____ (Microsoft Corporation) C:\Windows\system32\lsasrv.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000690688 _____ (Microsoft Corporation) C:\Windows\system32\adtschema.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000655360 _____ (Microsoft Corporation) C:\Windows\system32\rpcrt4.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000644096 _____ (Microsoft Corporation) C:\Windows\system32\advapi32.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000554496 _____ (Microsoft Corporation) C:\Windows\system32\kerberos.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000400896 _____ (Microsoft Corporation) C:\Windows\system32\srcore.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000261120 _____ (Microsoft Corporation) C:\Windows\system32\msv1_0.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000254464 _____ (Microsoft Corporation) C:\Windows\system32\schannel.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000223232 _____ (Microsoft Corporation) C:\Windows\system32\ncrypt.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000172032 _____ (Microsoft Corporation) C:\Windows\system32\wdigest.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000146432 _____ (Microsoft Corporation) C:\Windows\system32\msaudite.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000141312 _____ (Microsoft Corporation) C:\Windows\system32\rpchttp.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000099840 _____ (Microsoft Corporation) C:\Windows\system32\sspicli.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000082432 _____ (Microsoft Corporation) C:\Windows\system32\bcrypt.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000070144 _____ (Microsoft Corporation) C:\Windows\system32\TSpkg.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000060416 _____ (Microsoft Corporation) C:\Windows\system32\msobjs.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000050688 _____ (Microsoft Corporation) C:\Windows\system32\appidapi.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000050176 _____ (Microsoft Corporation) C:\Windows\system32\setbcdlocale.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000043008 _____ (Microsoft Corporation) C:\Windows\system32\srclient.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000038912 _____ (Microsoft Corporation) C:\Windows\system32\csrsrv.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000022016 _____ (Microsoft Corporation) C:\Windows\system32\secur32.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000017408 _____ (Microsoft Corporation) C:\Windows\system32\credssp.dll
      2018-04-16 10:43 - 2018-03-31 04:09 - 000007168 _____ (Microsoft Corporation) C:\Windows\system32\apisetschema.dll
      2018-04-16 10:43 - 2018-03-31 03:51 - 000097792 _____ (Microsoft Corporation) C:\Windows\system32\appidpolicyconverter.exe
      2018-04-16 10:43 - 2018-03-31 03:51 - 000050688 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\appid.sys
      2018-04-16 10:43 - 2018-03-31 03:51 - 000050688 _____ (Microsoft Corporation) C:\Windows\system32\auditpol.exe
      2018-04-16 10:43 - 2018-03-31 03:51 - 000029696 _____ (Microsoft Corporation) C:\Windows\system32\appidsvc.dll
      2018-04-16 10:43 - 2018-03-31 03:51 - 000016896 _____ (Microsoft Corporation) C:\Windows\system32\appidcertstorecheck.exe
      2018-04-16 10:43 - 2018-03-31 03:49 - 000262656 _____ (Microsoft Corporation) C:\Windows\system32\rstrui.exe
      2018-04-16 10:43 - 2018-03-31 03:49 - 000107520 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\videoprt.sys
      2018-04-16 10:43 - 2018-03-31 03:47 - 000226304 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mrxsmb10.sys
      2018-04-16 10:43 - 2018-03-31 03:47 - 000124928 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mrxsmb.sys
      2018-04-16 10:43 - 2018-03-31 03:47 - 000098304 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mrxsmb20.sys
      2018-04-16 10:43 - 2018-03-31 03:47 - 000069632 _____ (Microsoft Corporation) C:\Windows\system32\smss.exe
      2018-04-16 10:43 - 2018-03-31 03:47 - 000036352 _____ (Microsoft Corporation) C:\Windows\system32\cryptbase.dll
      2018-04-16 10:43 - 2018-03-31 03:47 - 000022016 _____ (Microsoft Corporation) C:\Windows\system32\lsass.exe
      2018-04-16 10:43 - 2018-03-31 03:47 - 000015872 _____ (Microsoft Corporation) C:\Windows\system32\sspisrv.dll
      2018-04-16 10:43 - 2018-03-28 10:18 - 002404352 _____ (Microsoft Corporation) C:\Windows\system32\win32k.sys
      2018-04-16 10:43 - 2018-03-23 20:59 - 000348824 _____ (Microsoft Corporation) C:\Windows\system32\iedkcs32.dll
      2018-04-16 10:43 - 2018-03-23 00:26 - 020287488 _____ (Microsoft Corporation) C:\Windows\system32\mshtml.dll
      2018-04-16 10:43 - 2018-03-23 00:04 - 002724864 _____ (Microsoft Corporation) C:\Windows\system32\mshtml.tlb
      2018-04-16 10:43 - 2018-03-23 00:04 - 000004096 _____ (Microsoft Corporation) C:\Windows\system32\ieetwcollectorres.dll
      2018-04-16 10:43 - 2018-03-22 23:52 - 000499712 _____ (Microsoft Corporation) C:\Windows\system32\vbscript.dll
      2018-04-16 10:43 - 2018-03-22 23:52 - 000062464 _____ (Microsoft Corporation) C:\Windows\system32\iesetup.dll
      2018-04-16 10:43 - 2018-03-22 23:51 - 000341504 _____ (Microsoft Corporation) C:\Windows\system32\html.iec
      2018-04-16 10:43 - 2018-03-22 23:51 - 000047616 _____ (Microsoft Corporation) C:\Windows\system32\ieetwproxystub.dll
      2018-04-16 10:43 - 2018-03-22 23:50 - 000064000 _____ (Microsoft Corporation) C:\Windows\system32\MshtmlDac.dll
      2018-04-16 10:43 - 2018-03-22 23:48 - 002295296 _____ (Microsoft Corporation) C:\Windows\system32\iertutil.dll
      2018-04-16 10:43 - 2018-03-22 23:45 - 000047104 _____ (Microsoft Corporation) C:\Windows\system32\jsproxy.dll
      2018-04-16 10:43 - 2018-03-22 23:45 - 000030720 _____ (Microsoft Corporation) C:\Windows\system32\iernonce.dll
      2018-04-16 10:43 - 2018-03-22 23:43 - 000476160 _____ (Microsoft Corporation) C:\Windows\system32\ieui.dll
      2018-04-16 10:43 - 2018-03-22 23:42 - 000661504 _____ (Microsoft Corporation) C:\Windows\system32\jscript.dll
      2018-04-16 10:43 - 2018-03-22 23:42 - 000115712 _____ (Microsoft Corporation) C:\Windows\system32\ieUnatt.exe
      2018-04-16 10:43 - 2018-03-22 23:42 - 000104960 _____ (Microsoft Corporation) C:\Windows\system32\ieetwcollector.exe
      2018-04-16 10:43 - 2018-03-22 23:41 - 000620032 _____ (Microsoft Corporation) C:\Windows\system32\jscript9diag.dll
      2018-04-16 10:43 - 2018-03-22 23:36 - 000668160 _____ (Microsoft Corporation) C:\Windows\system32\MsSpellCheckingFacility.exe
      2018-04-16 10:43 - 2018-03-22 23:33 - 000416256 _____ (Microsoft Corporation) C:\Windows\system32\dxtmsft.dll
      2018-04-16 10:43 - 2018-03-22 23:29 - 000060416 _____ (Microsoft Corporation) C:\Windows\system32\JavaScriptCollectionAgent.dll
      2018-04-16 10:43 - 2018-03-22 23:28 - 000091136 _____ (Microsoft Corporation) C:\Windows\system32\inseng.dll
      2018-04-16 10:43 - 2018-03-22 23:28 - 000073216 _____ (Microsoft Corporation) C:\Windows\system32\tdc.ocx
      2018-04-16 10:43 - 2018-03-22 23:25 - 000168960 _____ (Microsoft Corporation) C:\Windows\system32\msrating.dll
      2018-04-16 10:43 - 2018-03-22 23:25 - 000076288 _____ (Microsoft Corporation) C:\Windows\system32\mshtmled.dll
      2018-04-16 10:43 - 2018-03-22 23:24 - 000279040 _____ (Microsoft Corporation) C:\Windows\system32\dxtrans.dll
      2018-04-16 10:43 - 2018-03-22 23:22 - 000130048 _____ (Microsoft Corporation) C:\Windows\system32\occache.dll
      2018-04-16 10:43 - 2018-03-22 23:21 - 004496896 _____ (Microsoft Corporation) C:\Windows\system32\jscript9.dll
      2018-04-16 10:43 - 2018-03-22 23:20 - 013680128 _____ (Microsoft Corporation) C:\Windows\system32\ieframe.dll
      2018-04-16 10:43 - 2018-03-22 23:17 - 000230400 _____ (Microsoft Corporation) C:\Windows\system32\webcheck.dll
      2018-04-16 10:43 - 2018-03-22 23:15 - 000696320 _____ (Microsoft Corporation) C:\Windows\system32\msfeeds.dll
      2018-04-16 10:43 - 2018-03-22 23:15 - 000692224 _____ (Microsoft Corporation) C:\Windows\system32\ie4uinit.exe
      2018-04-16 10:43 - 2018-03-22 23:14 - 002059776 _____ (Microsoft Corporation) C:\Windows\system32\inetcpl.cpl
      2018-04-16 10:43 - 2018-03-22 23:14 - 001155072 _____ (Microsoft Corporation) C:\Windows\system32\mshtmlmedia.dll
      2018-04-16 10:43 - 2018-03-22 22:55 - 002767872 _____ (Microsoft Corporation) C:\Windows\system32\wininet.dll
      2018-04-16 10:43 - 2018-03-22 22:52 - 001313792 _____ (Microsoft Corporation) C:\Windows\system32\urlmon.dll
      2018-04-16 10:43 - 2018-03-22 22:51 - 000710144 _____ (Microsoft Corporation) C:\Windows\system32\ieapfltr.dll
      2018-04-16 10:43 - 2018-03-10 20:11 - 000340480 _____ (Microsoft Corporation) C:\Windows\system32\msexcl40.dll
      2018-04-16 10:43 - 2018-03-09 21:18 - 000309440 _____ (Adobe Systems Incorporated) C:\Windows\system32\atmfd.dll
      2018-04-16 10:43 - 2018-03-09 21:12 - 000111616 _____ (Microsoft Corporation) C:\Windows\system32\t2embed.dll
      2018-04-16 10:43 - 2018-03-09 21:12 - 000071680 _____ (Microsoft Corporation) C:\Windows\system32\fontsub.dll
      2018-04-16 10:43 - 2018-03-09 21:12 - 000026112 _____ (Microsoft Corporation) C:\Windows\system32\lpk.dll
      2018-04-16 10:43 - 2018-03-09 21:11 - 000010240 _____ (Microsoft Corporation) C:\Windows\system32\dciman32.dll
      2018-04-16 10:43 - 2018-03-09 20:31 - 000034304 _____ (Adobe Systems) C:\Windows\system32\atmlib.dll
      2018-04-16 10:43 - 2018-03-06 21:13 - 000148160 _____ (Microsoft Corporation) C:\Windows\system32\basecsp.dll
      2018-04-16 10:43 - 2018-03-06 21:11 - 000184320 _____ (Microsoft Corporation) C:\Windows\system32\scksp.dll
      2018-04-16 10:43 - 2018-03-06 21:11 - 000052224 _____ (Microsoft Corporation) C:\Windows\system32\wsnmp32.dll
      2018-04-16 10:43 - 2018-02-22 06:06 - 000134656 _____ (Microsoft Corporation) C:\Windows\system32\WinSCard.dll
      2018-04-16 10:43 - 2018-02-19 00:34 - 000535616 _____ (Microsoft Corporation) C:\Windows\system32\winload.exe
      2018-04-16 10:43 - 2018-02-10 21:49 - 000162496 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\msrpc.sys
      2018-04-16 10:43 - 2018-02-10 21:49 - 000154304 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\pci.sys
      2018-04-16 10:43 - 2018-02-10 21:49 - 000104640 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\NV_AGP.SYS
      2018-04-16 10:43 - 2018-02-10 21:49 - 000057024 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ULIAGPKX.SYS
      2018-04-16 10:43 - 2018-02-10 21:49 - 000053440 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\termdd.sys
      2018-04-16 10:43 - 2018-02-10 21:49 - 000052928 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\volmgr.sys
      2018-04-16 10:43 - 2018-02-10 21:49 - 000052928 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\VIAAGP.SYS
      2018-04-16 10:43 - 2018-02-10 21:49 - 000051904 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\SISAGP.SYS
      2018-04-16 10:43 - 2018-02-10 21:49 - 000046272 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\isapnp.sys
      2018-04-16 10:43 - 2018-02-10 21:49 - 000032448 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\vdrvroot.sys
      2018-04-16 10:43 - 2018-02-10 21:49 - 000027840 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mssmbios.sys
      2018-04-16 10:43 - 2018-02-10 21:49 - 000021696 _____ (Microsoft Corporation) C:\Windows\system32\streamci.dll
      2018-04-16 10:43 - 2018-02-10 21:49 - 000013504 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\msisadrv.sys
      2018-04-16 10:43 - 2018-02-10 21:49 - 000011840 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\swenum.sys
      2018-04-16 10:43 - 2018-02-10 21:48 - 000274624 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\acpi.sys
      2018-04-16 10:43 - 2018-02-10 21:48 - 000052928 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\AMDAGP.SYS
      2018-04-16 10:43 - 2018-02-10 21:48 - 000052928 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\AGP440.sys
      2018-04-16 10:43 - 2018-02-10 21:23 - 002292224 _____ (Microsoft Corporation) C:\Windows\system32\MSVidCtl.dll
      2018-04-16 10:43 - 2018-02-10 21:23 - 000330240 _____ (Microsoft Corporation) C:\Windows\system32\zipfldr.dll
      2018-04-16 10:43 - 2018-02-10 21:23 - 000111616 _____ (Microsoft Corporation) C:\Windows\system32\racpldlg.dll
      2018-04-16 10:43 - 2018-02-10 21:23 - 000102912 _____ (Microsoft Corporation) C:\Windows\system32\msrahc.dll
      2018-04-16 10:43 - 2018-02-10 20:36 - 000537600 _____ (Microsoft Corporation) C:\Windows\system32\msra.exe
      2018-04-16 10:43 - 2018-02-10 20:36 - 000040960 _____ (Microsoft Corporation) C:\Windows\system32\sdchange.exe
      2018-04-16 10:43 - 2018-02-10 20:36 - 000011264 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\wmiacpi.sys
      2018-04-16 10:43 - 2018-02-10 20:36 - 000007168 _____ (Microsoft Corporation) C:\Windows\system32\MsraLegacy.tlb
      2018-04-16 10:43 - 2018-02-10 20:36 - 000007168 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\errdev.sys
      2018-04-16 10:43 - 2018-02-02 21:54 - 000105152 _____ (Microsoft Corporation) C:\Windows\system32\consent.exe
      2018-04-16 10:43 - 2018-02-02 21:29 - 002365952 _____ (Microsoft Corporation) C:\Windows\system32\msi.dll
      2018-04-16 10:43 - 2018-02-02 21:29 - 000337408 _____ (Microsoft Corporation) C:\Windows\system32\msihnd.dll
      2018-04-16 10:43 - 2018-02-02 21:29 - 000025088 _____ (Microsoft Corporation) C:\Windows\system32\msimsg.dll
      2018-04-16 10:43 - 2018-02-02 21:28 - 001806848 _____ (Microsoft Corporation) C:\Windows\system32\authui.dll
      2018-04-16 10:43 - 2018-02-02 21:28 - 000047104 _____ (Microsoft Corporation) C:\Windows\system32\appinfo.dll
      2018-04-16 10:43 - 2018-02-02 20:46 - 000073216 _____ (Microsoft Corporation) C:\Windows\system32\msiexec.exe
      2018-04-16 10:43 - 2018-01-25 17:04 - 000922944 _____ (Microsoft Corporation) C:\Windows\system32\ucrtbase.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000066392 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-private-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000022360 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-math-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000019800 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-multibyte-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000017752 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-string-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000017752 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-stdio-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000016216 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-runtime-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000015704 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-convert-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000014168 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-time-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000014168 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-localization-l1-2-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000013656 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-filesystem-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000012632 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-process-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000012632 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-heap-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000012632 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-conio-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000012120 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-utility-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000012120 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-locale-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000012120 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-environment-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000012120 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-synch-l1-2-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000012120 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-processthreads-l1-1-1.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000011608 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-xstate-l2-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000011608 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-timezone-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000011608 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-file-l2-1-0.dll
      2018-04-16 10:43 - 2018-01-25 17:04 - 000011608 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-file-l1-2-0.dll
      2018-04-16 10:43 - 2018-01-15 22:40 - 000002048 _____ (Microsoft Corporation) C:\Windows\system32\tzres.dll
      2018-04-16 10:43 - 2018-01-12 19:29 - 001309928 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\tcpip.sys
      2018-04-16 10:43 - 2018-01-12 19:29 - 000250600 _____ (Microsoft Corporation) C:\Windows\system32\clfs.sys
      2018-04-16 10:43 - 2018-01-12 19:29 - 000240872 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\netio.sys
      2018-04-16 10:43 - 2018-01-12 19:29 - 000187624 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\FWPKCLNT.SYS
      2018-04-16 10:43 - 2018-01-12 19:26 - 000363520 _____ (Microsoft Corporation) C:\Windows\system32\StructuredQuery.dll
      2018-04-16 10:43 - 2018-01-12 19:26 - 000308224 _____ (Microsoft Corporation) C:\Windows\system32\scesrv.dll
      2018-04-16 10:43 - 2018-01-12 19:16 - 003405824 _____ (Microsoft Corporation) C:\Windows\system32\xpsrchvw.exe
      2018-04-16 10:43 - 2018-01-12 19:05 - 000055808 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\hidclass.sys
      2018-04-16 10:43 - 2018-01-12 19:05 - 000025728 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\hidparse.sys
      2018-04-16 10:43 - 2018-01-12 19:05 - 000024064 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\hidusb.sys
      2018-04-16 10:43 - 2018-01-11 19:22 - 000805376 _____ (Microsoft Corporation) C:\Windows\system32\cdosys.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 012880384 _____ (Microsoft Corporation) C:\Windows\system32\shell32.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 001499648 _____ (Microsoft Corporation) C:\Windows\system32\ExplorerFrame.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 001417728 _____ (Microsoft Corporation) C:\Windows\system32\ole32.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 001390080 _____ (Microsoft Corporation) C:\Windows\system32\msxml6.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 001155584 _____ (Microsoft Corporation) C:\Windows\system32\sysmain.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 001004032 _____ (Microsoft Corporation) C:\Windows\system32\PeerDistSvc.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000872448 _____ (Microsoft Corporation) C:\Windows\system32\kernel32.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000564736 _____ (Microsoft Corporation) C:\Windows\system32\MPSSVC.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000463360 _____ (Microsoft Corporation) C:\Windows\system32\FirewallAPI.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000377344 _____ (Microsoft Corporation) C:\Windows\system32\rpcss.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000328192 _____ (Microsoft Corporation) C:\Windows\system32\p2psvc.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000294400 _____ (Microsoft Corporation) C:\Windows\system32\KernelBase.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000269824 _____ (Microsoft Corporation) C:\Windows\system32\pnrpsvc.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000217600 _____ (Microsoft Corporation) C:\Windows\system32\P2P.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000171008 _____ (Microsoft Corporation) C:\Windows\system32\winsrv.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000139776 _____ (Microsoft Corporation) C:\Windows\system32\PeerDist.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000095744 _____ (Microsoft Corporation) C:\Windows\system32\PeerDistWSDDiscoProv.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000089088 _____ (Microsoft Corporation) C:\Windows\system32\icfupgd.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000053760 _____ (Microsoft Corporation) C:\Windows\system32\vmicres.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000033280 _____ (Microsoft Corporation) C:\Windows\system32\traffic.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000026112 _____ (Microsoft Corporation) C:\Windows\system32\oleres.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000010752 _____ (Microsoft Corporation) C:\Windows\system32\wshnetbs.dll
      2018-04-16 10:43 - 2018-01-01 05:00 - 000002048 _____ (Microsoft Corporation) C:\Windows\system32\msxml6r.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000005120 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-file-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000004608 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-processthreads-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-sysinfo-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-synch-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-misc-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-localregistry-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-localization-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-processenvironment-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-namedpipe-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-memory-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-libraryloader-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-interlocked-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-heap-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-string-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-rtlsupport-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-profile-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-io-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-handle-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-fibers-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-errorhandling-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-delayload-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-debug-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-datetime-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:59 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-console-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:54 - 001214184 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ntfs.sys
      2018-04-16 10:43 - 2018-01-01 04:54 - 000712936 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ndis.sys
      2018-04-16 10:43 - 2018-01-01 04:54 - 000201960 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\fltMgr.sys
      2018-04-16 10:43 - 2018-01-01 04:54 - 000173288 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\rdyboost.sys
      2018-04-16 10:43 - 2018-01-01 04:50 - 000317952 _____ (Microsoft Corporation) C:\Windows\system32\spoolsv.exe
      2018-04-16 10:43 - 2018-01-01 04:44 - 000043520 _____ (Microsoft Corporation) C:\Windows\system32\PeerDistHttpTrans.dll
      2018-04-16 10:43 - 2018-01-01 04:43 - 000104448 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\pacer.sys
      2018-04-16 10:43 - 2018-01-01 04:43 - 000060416 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mpsdrv.sys
      2018-04-16 10:43 - 2018-01-01 04:43 - 000036352 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\netbios.sys
      2018-04-16 10:43 - 2018-01-01 04:43 - 000018944 _____ (Microsoft Corporation) C:\Windows\system32\wfapigp.dll
      2018-04-16 10:43 - 2018-01-01 04:43 - 000013824 _____ (Microsoft Corporation) C:\Windows\system32\wshqos.dll
      2018-04-16 10:43 - 2018-01-01 04:41 - 000007168 _____ (Microsoft Corporation) C:\Windows\system32\comcat.dll
      2018-04-16 10:43 - 2018-01-01 04:38 - 000271360 _____ (Microsoft Corporation) C:\Windows\system32\conhost.exe
      2018-04-16 10:43 - 2018-01-01 04:38 - 000215552 _____ (Microsoft Corporation) C:\Windows\system32\vmicsvc.exe
      2018-04-16 10:43 - 2018-01-01 04:38 - 000113664 _____ (Microsoft Corporation) C:\Windows\system32\IcCoinstall.dll
      2018-04-16 10:43 - 2018-01-01 04:38 - 000047616 _____ (Microsoft Corporation) C:\Windows\system32\vmictimeprovider.dll
      2018-04-16 10:43 - 2018-01-01 04:36 - 000314368 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\srv2.sys
      2018-04-16 10:43 - 2018-01-01 04:36 - 000313344 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\srv.sys
      2018-04-16 10:43 - 2018-01-01 04:35 - 000514048 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\http.sys
      2018-04-16 10:43 - 2018-01-01 04:35 - 000115712 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\srvnet.sys
      2018-04-16 10:43 - 2018-01-01 04:35 - 000081408 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\dfsc.sys
      2018-04-16 10:43 - 2018-01-01 04:35 - 000006144 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-security-base-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:35 - 000004608 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-threadpool-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:35 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-xstate-l1-1-0.dll
      2018-04-16 10:43 - 2018-01-01 04:35 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-util-l1-1-0.dll
      2018-04-16 10:43 - 2017-12-05 20:08 - 001176576 _____ (Microsoft Corporation) C:\Windows\system32\crypt32.dll
      2018-04-16 10:43 - 2017-12-05 20:08 - 000481792 _____ (Microsoft Corporation) C:\Windows\system32\mscms.dll
      2018-04-16 10:43 - 2017-12-05 20:08 - 000215040 _____ (Microsoft Corporation) C:\Windows\system32\icm32.dll
      2018-04-16 10:43 - 2017-12-05 20:08 - 000179200 _____ (Microsoft Corporation) C:\Windows\system32\wintrust.dll
      2018-04-16 10:43 - 2017-12-05 20:08 - 000145920 _____ (Microsoft Corporation) C:\Windows\system32\cryptsvc.dll
      2018-04-16 10:43 - 2017-12-05 20:08 - 000106496 _____ (Microsoft Corporation) C:\Windows\system32\cryptnet.dll
      2018-04-16 10:43 - 2017-12-05 20:08 - 000072704 _____ (Microsoft Corporation) C:\Windows\system32\TabSvc.dll
      2018-04-16 10:43 - 2017-12-05 18:54 - 000334848 _____ (Microsoft Corporation) C:\Windows\system32\wisptis.exe
      2018-04-16 10:43 - 2017-12-05 18:49 - 000032768 _____ (Microsoft Corporation) C:\Windows\system32\WcsPlugInService.dll
      2018-04-14 17:05 - 2018-04-15 21:31 - 000003238 _____ C:\Users\IvailoCOMP\Desktop\Стражева Кула 14.04.2018.txt
      2018-04-14 14:36 - 2016-06-18 07:13 - 039293587 ____N C:\Users\IvailoCOMP\Desktop\MPS-temi.pdf
      2018-04-11 21:09 - 2018-04-15 22:57 - 000000340 _____ C:\Users\IvailoCOMP\Desktop\Програма за четене на Библията.txt
      2018-04-11 20:05 - 2018-04-11 20:05 - 000724759 _____ C:\Users\IvailoCOMP\Desktop\sbr_BL.pdf
      2018-04-11 02:08 - 2018-03-14 20:18 - 000116928 _____ (Microsoft Corporation) C:\Windows\system32\CompatTelRunner.exe
      2018-04-11 02:08 - 2018-03-14 20:14 - 000535040 _____ (Microsoft Corporation) C:\Windows\system32\aeinv.dll
      2018-04-11 02:08 - 2018-03-14 16:04 - 001893376 _____ (Microsoft Corporation) C:\Windows\system32\aitstatic.exe
      2018-04-11 02:08 - 2018-03-14 16:04 - 001319424 _____ (Microsoft Corporation) C:\Windows\system32\appraiser.dll
      2018-04-11 02:08 - 2018-03-14 16:04 - 000594944 _____ (Microsoft Corporation) C:\Windows\system32\generaltel.dll
      2018-04-11 02:08 - 2018-03-14 16:04 - 000507392 _____ (Microsoft Corporation) C:\Windows\system32\devinv.dll
      2018-04-11 02:08 - 2018-03-14 16:04 - 000338432 _____ (Microsoft Corporation) C:\Windows\system32\invagent.dll
      2018-04-11 02:08 - 2018-03-14 16:04 - 000338432 _____ (Microsoft Corporation) C:\Windows\system32\centel.dll
      2018-04-11 02:08 - 2018-03-14 16:04 - 000238592 _____ (Microsoft Corporation) C:\Windows\system32\acmigration.dll
      2018-04-11 02:08 - 2018-03-14 16:04 - 000190976 _____ (Microsoft Corporation) C:\Windows\system32\aepic.dll
      2018-04-09 21:55 - 2018-04-09 21:55 - 000003743 _____ C:\Users\IvailoCOMP\Desktop\Ще бъде ли тя добра съпруга.txt
      2018-04-01 23:39 - 2018-04-01 23:39 - 010353227 _____ C:\Users\IvailoCOMP\Desktop\yp2_BL.pdf
      2018-03-23 22:10 - 2018-03-23 22:10 - 002276028 _____ C:\Users\IvailoCOMP\Desktop\Илиянка.rar
      2018-03-23 22:02 - 2018-03-23 22:14 - 000000000 ____D C:\Users\IvailoCOMP\Desktop\Илиянка
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-04-18 19:00 - 2010-11-21 00:01 - 000785704 _____ C:\Windows\system32\PerfStringBackup.INI
      2018-04-18 19:00 - 2009-07-14 05:37 - 000000000 ____D C:\Windows\inf
      2018-04-18 18:57 - 2016-11-18 12:35 - 000000000 ____D C:\Users\IvailoCOMP\AppData\LocalLow\Mozilla
      2018-04-18 18:51 - 2013-11-21 16:12 - 000000000 ____D C:\ProgramData\NVIDIA
      2018-04-18 18:51 - 2009-07-14 07:53 - 000000006 ____H C:\Windows\Tasks\SA.DAT
      2018-04-18 18:06 - 2014-10-30 10:05 - 000000000 ____D C:\Windows\pss
      2018-04-18 17:58 - 2017-11-23 09:54 - 000000000 ____D C:\Users\IvailoCOMP\AppData\Local\LogMeIn Hamachi
      2018-04-18 10:38 - 2013-11-21 16:17 - 000000000 ____D C:\Users\IvailoCOMP\AppData\Roaming\BitComet
      2018-04-18 10:34 - 2013-11-21 16:05 - 000000000 ____D C:\Users\IvailoCOMP\AppData\Roaming\Ashampoo
      2018-04-18 10:34 - 2013-11-21 16:05 - 000000000 ____D C:\Users\IvailoCOMP\AppData\Local\Ashampoo
      2018-04-18 10:32 - 2013-11-21 16:00 - 000000000 ____D C:\Program Files\Ashampoo
      2018-04-18 10:19 - 2013-11-22 16:19 - 000000000 ____D C:\Users\IvailoCOMP\AppData\Roaming\DAEMON Tools Lite
      2018-04-18 01:15 - 2009-07-14 07:34 - 000026576 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-1.C7483456-A289-439d-8115-601632D005A0
      2018-04-18 01:15 - 2009-07-14 07:34 - 000026576 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-0.C7483456-A289-439d-8115-601632D005A0
      2018-04-18 01:09 - 2013-12-23 20:48 - 000000000 ____D C:\Users\IvailoCOMP\AppData\Roaming\Skype
      2018-04-17 23:11 - 2016-02-29 01:23 - 000000000 ____D C:\Users\IvailoCOMP\AppData\Local\CrashDumps
      2018-04-17 10:17 - 2009-07-14 07:33 - 000452024 _____ C:\Windows\system32\FNTCACHE.DAT
      2018-04-17 10:13 - 2009-07-14 05:37 - 000000000 ____D C:\Windows\PolicyDefinitions
      2018-04-16 22:13 - 2013-11-21 17:15 - 000000000 ____D C:\Users\IvailoCOMP\AppData\Roaming\vlc
      2018-04-15 10:51 - 2013-11-21 16:04 - 000000000 ____D C:\Windows\system32\Macromed
      2018-04-12 19:52 - 2016-07-07 19:51 - 000000000 ____D C:\Program Files\Common Files\Overwolf
      2018-04-12 19:52 - 2013-12-14 11:50 - 000000000 ____D C:\Program Files\Overwolf
      2018-04-12 01:04 - 2014-12-11 09:05 - 000000000 ____D C:\Windows\system32\appraiser
      2018-04-11 11:04 - 2017-07-31 12:21 - 000804864 _____ (Adobe Systems Incorporated) C:\Windows\system32\FlashPlayerApp.exe
      2018-04-11 11:04 - 2017-07-31 12:21 - 000144896 _____ (Adobe Systems Incorporated) C:\Windows\system32\FlashPlayerCPLApp.cpl
      2018-04-11 03:13 - 2014-07-15 11:08 - 000000000 ____D C:\Windows\system32\MRT
      2018-04-11 03:06 - 2017-10-11 01:18 - 133987696 ____C (Microsoft Corporation) C:\Windows\system32\MRT-KB890830.exe
      2018-04-11 03:06 - 2014-07-15 11:08 - 133987696 ____C (Microsoft Corporation) C:\Windows\system32\MRT.exe
      2018-04-08 17:50 - 2018-03-01 23:22 - 000000000 ____D C:\Users\IvailoCOMP\AppData\Roaming\.minecraft
      2018-03-29 09:46 - 2013-12-21 10:14 - 000000000 ____D C:\Program Files\Mozilla Maintenance Service
      2018-03-28 11:20 - 2016-11-16 21:09 - 000000000 ____D C:\Program Files\Mozilla Firefox
      2018-03-26 12:53 - 2018-02-26 10:26 - 000000000 ____D C:\Users\IvailoCOMP\Desktop\Songs
      ==================== Files in the root of some directories =======
      2016-03-26 15:29 - 2016-03-28 23:17 - 000000646 _____ () C:\Users\IvailoCOMP\AppData\Roaming\MPQEditor.ini
      2013-11-21 17:59 - 2017-11-03 12:59 - 000007599 _____ () C:\Users\IvailoCOMP\AppData\Local\Resmon.ResmonCfg
      Some files in TEMP:
      2017-09-29 10:49 - 2017-10-30 16:41 - 000000000 _____ () C:\Users\IvailoCOMP\AppData\Local\Temp\88653d972532a3bfb1eacaae78f1f650.dll
      2017-09-29 10:49 - 2017-10-30 14:33 - 000000088 _____ () C:\Users\IvailoCOMP\AppData\Local\Temp\a4c3de51ada6927383f066bdc8c54e16.dll
      2018-04-08 08:12 - 2018-04-08 08:12 - 058834376 _____ (Skype Technologies S.A.) C:\Users\IvailoCOMP\AppData\Local\Temp\SkypeSetup.exe
      2018-03-01 23:34 - 2018-03-01 23:23 - 000069259 _____ () C:\Users\IvailoCOMP\AppData\Local\Temp\Uninstall.exe
      2017-08-13 10:55 - 2017-08-13 10:55 - 000750560 _____ (adaware) C:\Users\IvailoCOMP\AppData\Local\Temp\WCU002.exe
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\Windows\explorer.exe => File is digitally signed
      C:\Windows\system32\winlogon.exe => File is digitally signed
      C:\Windows\system32\wininit.exe => File is digitally signed
      C:\Windows\system32\svchost.exe => File is digitally signed
      C:\Windows\system32\services.exe => File is digitally signed
      C:\Windows\system32\User32.dll => File is digitally signed
      C:\Windows\system32\userinit.exe => File is digitally signed
      C:\Windows\system32\rpcss.dll => File is digitally signed
      C:\Windows\system32\dnsapi.dll => File is digitally signed
      C:\Windows\system32\Drivers\volsnap.sys => File is digitally signed
      LastRegBack: 2016-05-09 08:13
      ==================== End of FRST.txt ============================
    • от desperado88
      Здравейте, от няколко дена лаптопа ми започна да работи много бавно, Malwarebytes постоянно ми блокира Уебсайт, който аз не го отварям.Явно вируса кара системата автоматично да зарежда този уебсайт.След сканиране с Malwarebytes изчистих около 500 най различни вируса, сред които и Trojan.BitCoinMiner.За съжаление системата все още е инфектирана.Прилагам и снимка от Malwarebytes със блокирания уебсайт.
      Scan result of Farbar Recovery Scan Tool (FRST) (x64) Version: 14.03.2018
      Ran by Denis (administrator) on DENIS-PC (15-04-2018 13:26:58)
      Running from C:\Users\Denis\Desktop
      Loaded Profiles: Denis (Available Profiles: Denis)
      Platform: Windows 7 Ultimate Service Pack 1 (X64) Language: Английски (Съединени щати)
      Internet Explorer Version 11 (Default browser: Opera)
      Boot Mode: Normal
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      (Intel Corporation) C:\Windows\System32\igfxCUIService.exe
      (Realtek Semiconductor) C:\Program Files\Realtek\Audio\HDA\RtkAudioService64.exe
      (Realtek Semiconductor) C:\Program Files\Realtek\Audio\HDA\RAVBg64.exe
      (AVAST Software) C:\Program Files\AVAST Software\Avast\AvastSvc.exe
      (SUPERAntiSpyware.com) C:\Program Files\SUPERAntiSpyware\SASCore64.exe
      (Synaptics Incorporated) C:\Program Files\Synaptics\SynTP\SynTPEnh.exe
      (AVAST Software) C:\Program Files\AVAST Software\Avast\AvastUI.exe
      (Ralink Technology, Corp.) C:\Program Files (x86)\Ralink\Common\RaUI.exe
      (Ralink Technology, Corp.) C:\Program Files (x86)\Ralink\Common\RaRegistry.exe
      (Ralink Technology, Corp.) C:\Program Files (x86)\Ralink\Common\RaRegistry64.exe
      (Synaptics Incorporated) C:\Program Files\Synaptics\SynTP\SynTPEnhService.exe
      (Malwarebytes) C:\Program Files\Malwarebytes\Anti-Malware\MBAMService.exe
      (Microsoft Corporation) C:\Windows\Microsoft.NET\Framework64\v3.0\WPF\PresentationFontCache.exe
      (Intel Corporation) C:\Windows\System32\igfxEM.exe
      (Intel Corporation) C:\Windows\System32\igfxHK.exe
      (Intel Corporation) C:\Windows\System32\igfxTray.exe
      (Synaptics Incorporated) C:\Program Files\Synaptics\SynTP\SynTPHelper.exe
      (Malwarebytes) C:\Program Files\Malwarebytes\Anti-Malware\mbamtray.exe
      (Opera Software) C:\Program Files\Opera\52.0.2871.64\opera.exe
      (Opera Software) C:\Program Files\Opera\52.0.2871.64\opera_crashreporter.exe
      (Opera Software) C:\Program Files\Opera\52.0.2871.64\opera.exe
      (Opera Software) C:\Program Files\Opera\52.0.2871.64\opera.exe
      (Opera Software) C:\Program Files\Opera\52.0.2871.64\opera.exe
      (Opera Software) C:\Program Files\Opera\52.0.2871.64\opera.exe
      (Opera Software) C:\Program Files\Opera\52.0.2871.64\opera.exe
      (Microsoft Corporation) C:\Windows\System32\wlanext.exe
      (Microsoft Corporation) C:\Windows\System32\wlanext.exe
      (Opera Software) C:\Program Files\Opera\52.0.2871.64\opera.exe
      (Opera Software) C:\Program Files\Opera\52.0.2871.64\opera.exe
      (Opera Software) C:\Program Files\Opera\52.0.2871.64\opera.exe
      (Opera Software) C:\Program Files\Opera\52.0.2871.64\opera.exe
      (Opera Software) C:\Program Files\Opera\52.0.2871.64\opera.exe
      (Opera Software) C:\Program Files\Opera\52.0.2871.64\opera.exe
      (Microsoft Corporation) C:\Windows\System32\dllhost.exe
      (Microsoft Corporation) C:\Windows\System32\mobsync.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [SynTPEnh] => C:\Program Files\Synaptics\SynTP\SynTPEnh.exe [2818800 2014-09-17] (Synaptics Incorporated)
      HKLM\...\Run: [AvastUI.exe] => C:\Program Files\AVAST Software\Avast\AvLaunch.exe [242392 2018-04-13] (AVAST Software)
      HKLM-x32\...\Run: [FxSound Enhancer] => C:\Program Files (x86)\DFX\dfx.exe [1663992 2017-06-25] ()
      HKLM\SOFTWARE\Policies\Microsoft\Windows Defender: Restriction <==== ATTENTION
      HKU\S-1-5-21-2840518248-2148612227-1552303534-1000\...\Run: [FreeAC] => C:\Program Files (x86)\FreeAlarmClock\FreeAlarmClock.exe [3015072 2016-01-19] (Comfort Software Group)
      HKU\S-1-5-21-2840518248-2148612227-1552303534-1000\...\Run: [xACRX1n5Od.exe] => C:\Program Files\Windows Photo Viewer\ZYZV3IM54U2LXOJ32IAQ2X\xACRX1n5Od.exe 
      HKU\S-1-5-21-2840518248-2148612227-1552303534-1000\...\Run: [SUPERAntiSpyware] => C:\Program Files\SUPERAntiSpyware\SUPERAntiSpyware.exe [8887216 2018-03-22] (SUPERAntiSpyware)
      HKU\S-1-5-21-2840518248-2148612227-1552303534-1000\...\MountPoints2: {03fa777c-d793-11e7-aaf8-2c337a8d8b7c} - G:\Lenovo_Suite.exe
      HKU\S-1-5-18\Control Panel\Desktop\\SCRNSAVE.EXE -> 
      Startup: C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Startup\Ralink Wireless Utility.lnk [2017-12-05]
      ShortcutTarget: Ralink Wireless Utility.lnk -> C:\Program Files (x86)\Ralink\Common\RaUI.exe (Ralink Technology, Corp.)
      GroupPolicy: Restriction - Chrome <==== ATTENTION
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      Hosts: There are more than one entry in Hosts. See Hosts section of Addition.txt
      Tcpip\Parameters: [DhcpNameServer]
      Tcpip\..\Interfaces\{268216B3-DCC9-4E85-BC1A-BE63B8E8A6F5}: [DhcpNameServer]
      Internet Explorer:
      HKLM\SOFTWARE\Policies\Microsoft\Internet Explorer: Restriction <==== ATTENTION
      BHO: avast! Online Security -> {8E5E2654-AD2D-48bf-AC2D-D17F00898D06} -> C:\Program Files\AVAST Software\Avast\aswWebRepIE64.dll [2018-04-01] (AVAST Software)
      BHO-x32: avast! Online Security -> {8E5E2654-AD2D-48bf-AC2D-D17F00898D06} -> C:\Program Files\AVAST Software\Avast\aswWebRepIE.dll [2018-04-01] (AVAST Software)
      FF DefaultProfile: du8cfbta.default
      FF ProfilePath: C:\Users\Denis\AppData\Roaming\Mozilla\Firefox\Profiles\du8cfbta.default [2018-04-15]
      FF user.js: detected! => C:\Users\Denis\AppData\Roaming\Mozilla\Firefox\Profiles\du8cfbta.default\user.js [2017-06-30]
      FF Homepage: Mozilla\Firefox\Profiles\du8cfbta.default -> hxxps://www.malwarebytes.org/restorebrowser/
      FF Extension: (Avast SafePrice) - C:\Users\Denis\AppData\Roaming\Mozilla\Firefox\Profiles\du8cfbta.default\Extensions\sp@avast.com.xpi [2018-04-04]
      FF Extension: (Avast Online Security) - C:\Users\Denis\AppData\Roaming\Mozilla\Firefox\Profiles\du8cfbta.default\Extensions\wrc@avast.com.xpi [2018-04-01]
      FF Plugin: @microsoft.com/GENUINE -> disabled [No File]
      FF Plugin-x32: @google.com/npPicasa3,version=3.0.0 -> C:\Program Files (x86)\Google\Picasa3\npPicasa3.dll [2015-10-13] (Google, Inc.)
      FF Plugin-x32: @microsoft.com/GENUINE -> disabled [No File]
      FF Plugin-x32: @tools.google.com/Google Update;version=3 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [No File]
      FF Plugin-x32: @tools.google.com/Google Update;version=9 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [No File]
      FF Plugin-x32: Adobe Reader -> C:\Program Files (x86)\Adobe\Acrobat Reader DC\Reader\AIR\nppdf32.dll [2018-02-12] (Adobe Systems Inc.)
      CHR HKLM-x32\...\Chrome\Extension: [efaidnbmnnnibpcajpcglclefindmkaj] - hxxps://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [eofcbnmajmjmplflapaojjnihcjkigck] - hxxps://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [gomekmidlodglbbmalcneegieacbdmki] - hxxps://clients2.google.com/service/update2/crx
      OPR Extension: (Adblocker for Youtube™) - C:\Users\Denis\AppData\Roaming\Opera Software\Opera Stable\Extensions\epeomjakeffkfofnidikcpbacmfliolc [2018-04-01]
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R2 !SASCORE; C:\Program Files\SUPERAntiSpyware\SASCORE64.EXE [173472 2017-01-31] (SUPERAntiSpyware.com)
      S3 aswbIDSAgent; C:\Program Files\AVAST Software\Avast\x64\aswidsagenta.exe [7603408 2018-04-13] (AVAST Software)
      R2 avast! Antivirus; C:\Program Files\AVAST Software\Avast\AvastSvc.exe [313640 2018-04-13] (AVAST Software)
      R2 igfxCUIService1.0.0.0; C:\Windows\system32\igfxCUIService.exe [330136 2015-08-27] (Intel Corporation)
      R2 MBAMService; C:\Program Files\Malwarebytes\Anti-Malware\mbamservice.exe [6479136 2018-03-27] (Malwarebytes)
      S3 RaMediaServer; C:\Program Files (x86)\Ralink\Common\RaMediaServer.exe [621632 2011-03-04] ()
      R2 RtkAudioService; C:\Program Files\Realtek\Audio\HDA\RtkAudioService64.exe [291032 2014-08-18] (Realtek Semiconductor)
      R2 SynTPEnhService; C:\Program Files\Synaptics\SynTP\SynTPEnhService.exe [191728 2014-09-17] (Synaptics Incorporated)
      R2 WinDefend; C:\Program Files\Windows Defender\mpsvc.dll [1011712 2014-08-16] (Microsoft Corporation)
      S2 gupdate; "C:\Program Files (x86)\Google\Update\GoogleUpdate.exe" /svc [X]
      S3 gupdatem; "C:\Program Files (x86)\Google\Update\GoogleUpdate.exe" /medsvc [X]
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      S3 aswArPot; C:\Windows\System32\drivers\aswArPot.sys [196640 2018-04-13] (AVAST Software)
      S3 aswbidsdriver; C:\Windows\System32\drivers\aswbidsdrivera.sys [227504 2018-04-01] (AVAST Software)
      S3 aswbidsh; C:\Windows\System32\drivers\aswbidsha.sys [199440 2018-04-01] (AVAST Software)
      S3 aswblog; C:\Windows\System32\drivers\aswbloga.sys [343752 2018-04-01] (AVAST Software)
      S3 aswbuniv; C:\Windows\System32\drivers\aswbuniva.sys [57680 2018-04-01] (AVAST Software)
      R1 aswHdsKe; C:\Windows\System32\drivers\aswHdsKe.sys [227784 2018-04-13] (AVAST Software)
      S3 aswHwid; C:\Windows\System32\drivers\aswHwid.sys [46968 2018-04-13] (AVAST Software)
      R2 aswMonFlt; C:\Windows\System32\drivers\aswMonFlt.sys [147224 2018-04-13] (AVAST Software)
      S3 aswRdr; C:\Windows\System32\drivers\aswRdr2.sys [111352 2018-04-13] (AVAST Software)
      R0 aswRvrt; C:\Windows\System32\drivers\aswRvrt.sys [84368 2018-04-13] (AVAST Software)
      S3 aswSnx; C:\Windows\System32\drivers\aswSnx.sys [1026696 2018-04-13] (AVAST Software)
      R1 aswSP; C:\Windows\System32\drivers\aswSP.sys [460520 2018-04-13] (AVAST Software)
      S3 aswStm; C:\Windows\System32\drivers\aswStm.sys [205976 2018-04-13] (AVAST Software)
      S3 aswVmm; C:\Windows\System32\drivers\aswVmm.sys [380528 2018-04-13] (AVAST Software)
      R1 butldsk; C:\Windows\System32\drivers\butldsk.sys [192408 2018-03-21] ()
      S3 DFX11_1; C:\Windows\System32\drivers\dfx11_1x64.sys [28008 2017-06-19] (Windows (R) Win 7 DDK provider)
      R3 DFX12; C:\Windows\System32\drivers\dfx12x64.sys [29688 2017-06-19] (Windows (R) Win 7 DDK provider)
      R0 MBAMSwissArmy; C:\Windows\System32\Drivers\mbamswissarmy.sys [253664 2018-04-01] (Malwarebytes)
      R3 RSP2STOR; C:\Windows\System32\DRIVERS\RtsP2Stor.sys [294104 2014-08-19] (Realtek Semiconductor Corp.)
      R3 RTWlanE; C:\Windows\System32\DRIVERS\rtwlane.sys [3502296 2014-08-04] (Realtek Semiconductor Corporation )
      R1 SASDIFSV; C:\Program Files\SUPERAntiSpyware\SASDIFSV64.SYS [14928 2011-07-22] (SUPERAdBlocker.com and SUPERAntiSpyware.com)
      R1 SASKUTIL; C:\Program Files\SUPERAntiSpyware\SASKUTIL64.SYS [12368 2011-07-13] (SUPERAdBlocker.com and SUPERAntiSpyware.com)
      R3 SmbDrvI; C:\Windows\System32\DRIVERS\Smb_driver_Intel.sys [33008 2014-09-17] (Synaptics Incorporated)
      R3 TXEIx64; C:\Windows\System32\DRIVERS\TXEIx64.sys [97320 2015-05-28] (Intel Corporation)
      U3 aswbdisk; no ImagePath
      S3 VGPU; System32\drivers\rdvgkmd.sys [X]
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-04-15 13:26 - 2018-04-15 13:27 - 000011629 _____ C:\Users\Denis\Desktop\FRST.txt
      2018-04-14 21:08 - 2018-04-14 21:25 - 000000064 _____ C:\Users\Denis\Desktop\rufus.ini
      2018-04-14 21:06 - 2018-04-14 21:08 - 000967800 _____ (Akeo Consulting (hxxp://akeo.ie)) C:\Users\Denis\Desktop\rufus-2.18p.exe
      2018-04-13 07:28 - 2018-04-13 07:28 - 000000000 ____D C:\Windows\System32\Tasks\Avast Software
      2018-04-13 07:27 - 2018-04-13 07:26 - 000376536 _____ (AVAST Software) C:\Windows\system32\aswBoot.exe
      2018-04-12 22:49 - 2018-03-14 20:14 - 000135360 _____ (Microsoft Corporation) C:\Windows\system32\CompatTelRunner.exe
      2018-04-12 22:49 - 2018-03-14 20:09 - 000656384 _____ (Microsoft Corporation) C:\Windows\system32\aeinv.dll
      2018-04-12 22:49 - 2018-03-14 16:05 - 001993728 _____ (Microsoft Corporation) C:\Windows\system32\aitstatic.exe
      2018-04-12 22:49 - 2018-03-14 16:05 - 001559552 _____ (Microsoft Corporation) C:\Windows\system32\appraiser.dll
      2018-04-12 22:49 - 2018-03-14 16:05 - 000739840 _____ (Microsoft Corporation) C:\Windows\system32\generaltel.dll
      2018-04-12 22:49 - 2018-03-14 16:05 - 000599552 _____ (Microsoft Corporation) C:\Windows\system32\devinv.dll
      2018-04-12 22:49 - 2018-03-14 16:05 - 000450048 _____ (Microsoft Corporation) C:\Windows\system32\centel.dll
      2018-04-12 22:49 - 2018-03-14 16:05 - 000414720 _____ (Microsoft Corporation) C:\Windows\system32\invagent.dll
      2018-04-12 22:49 - 2018-03-14 16:05 - 000291840 _____ (Microsoft Corporation) C:\Windows\system32\acmigration.dll
      2018-04-12 22:49 - 2018-03-14 16:05 - 000237056 _____ (Microsoft Corporation) C:\Windows\system32\aepic.dll
      2018-04-11 10:53 - 2018-04-11 10:53 - 000000000 ____D C:\Users\Denis\Downloads\Turkce
      2018-04-11 10:52 - 2018-04-11 11:52 - 000000000 ____D C:\Users\Denis\Downloads\Нова папка (2)
      2018-04-08 16:31 - 2018-04-15 13:26 - 000000000 ____D C:\FRST
      2018-04-08 16:28 - 2018-04-08 16:28 - 002403328 _____ (Farbar) C:\Users\Denis\Desktop\FRST64.exe
      2018-04-02 16:51 - 2018-03-09 06:39 - 000154816 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ksecpkg.sys
      2018-04-02 16:51 - 2018-03-09 06:06 - 000731648 _____ (Microsoft Corporation) C:\Windows\system32\kerberos.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000503808 _____ (Microsoft Corporation) C:\Windows\system32\srcore.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000316928 _____ (Microsoft Corporation) C:\Windows\system32\msv1_0.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000215552 _____ (Microsoft Corporation) C:\Windows\system32\winsrv.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000190464 _____ (Microsoft Corporation) C:\Windows\system32\rpchttp.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000135680 _____ (Microsoft Corporation) C:\Windows\system32\sspicli.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000094720 _____ (Microsoft Corporation) C:\Windows\system32\TSpkg.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000063488 _____ (Microsoft Corporation) C:\Windows\system32\setbcdlocale.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000059904 _____ (Microsoft Corporation) C:\Windows\system32\appidapi.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000050176 _____ (Microsoft Corporation) C:\Windows\system32\srclient.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000044032 _____ (Microsoft Corporation) C:\Windows\system32\csrsrv.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000034816 _____ (Microsoft Corporation) C:\Windows\system32\appidsvc.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000028672 _____ (Microsoft Corporation) C:\Windows\system32\sspisrv.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000028160 _____ (Microsoft Corporation) C:\Windows\system32\secur32.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000022016 _____ (Microsoft Corporation) C:\Windows\system32\credssp.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000016384 _____ (Microsoft Corporation) C:\Windows\system32\ntvdm64.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000013312 _____ (Microsoft Corporation) C:\Windows\system32\wow64cpu.dll
      2018-04-02 16:51 - 2018-03-09 06:06 - 000007168 _____ (Microsoft Corporation) C:\Windows\system32\apisetschema.dll
      2018-04-02 16:51 - 2018-03-09 05:47 - 001314064 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntdll.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000666112 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rpcrt4.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000644096 _____ (Microsoft Corporation) C:\Windows\SysWOW64\advapi32.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000554496 _____ (Microsoft Corporation) C:\Windows\SysWOW64\kerberos.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000342528 _____ (Microsoft Corporation) C:\Windows\SysWOW64\certcli.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000261120 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msv1_0.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000254464 _____ (Microsoft Corporation) C:\Windows\SysWOW64\schannel.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000172032 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wdigest.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000141312 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rpchttp.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000096768 _____ (Microsoft Corporation) C:\Windows\SysWOW64\sspicli.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000070144 _____ (Microsoft Corporation) C:\Windows\SysWOW64\TSpkg.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000050688 _____ (Microsoft Corporation) C:\Windows\SysWOW64\appidapi.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000043008 _____ (Microsoft Corporation) C:\Windows\SysWOW64\srclient.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000022016 _____ (Microsoft Corporation) C:\Windows\SysWOW64\secur32.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000017408 _____ (Microsoft Corporation) C:\Windows\SysWOW64\credssp.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000007168 _____ (Microsoft Corporation) C:\Windows\SysWOW64\apisetschema.dll
      2018-04-02 16:51 - 2018-03-09 05:43 - 000005120 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wow32.dll
      2018-04-02 16:51 - 2018-03-09 05:38 - 000148480 _____ (Microsoft Corporation) C:\Windows\system32\appidpolicyconverter.exe
      2018-04-02 16:51 - 2018-03-09 05:38 - 000017920 _____ (Microsoft Corporation) C:\Windows\system32\appidcertstorecheck.exe
      2018-04-02 16:51 - 2018-03-09 05:37 - 000064512 _____ (Microsoft Corporation) C:\Windows\system32\auditpol.exe
      2018-04-02 16:51 - 2018-03-09 05:34 - 000338432 _____ (Microsoft Corporation) C:\Windows\system32\conhost.exe
      2018-04-02 16:51 - 2018-03-09 05:33 - 000296960 _____ (Microsoft Corporation) C:\Windows\system32\rstrui.exe
      2018-04-02 16:51 - 2018-03-09 05:31 - 000160256 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mrxsmb.sys
      2018-04-02 16:51 - 2018-03-09 05:30 - 000129536 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mrxsmb20.sys
      2018-04-02 16:51 - 2018-03-09 05:29 - 000112640 _____ (Microsoft Corporation) C:\Windows\system32\smss.exe
      2018-04-02 16:51 - 2018-03-09 05:29 - 000030720 _____ (Microsoft Corporation) C:\Windows\system32\lsass.exe
      2018-04-02 16:51 - 2018-03-09 05:26 - 000050688 _____ (Microsoft Corporation) C:\Windows\SysWOW64\auditpol.exe
      2018-04-02 16:51 - 2018-03-09 05:22 - 000025600 _____ (Microsoft Corporation) C:\Windows\SysWOW64\setup16.exe
      2018-04-02 16:51 - 2018-03-09 05:22 - 000014336 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntvdm64.dll
      2018-04-02 16:51 - 2018-03-09 05:22 - 000007680 _____ (Microsoft Corporation) C:\Windows\SysWOW64\instnm.exe
      2018-04-02 16:50 - 2018-03-28 11:31 - 005583040 _____ (Microsoft Corporation) C:\Windows\system32\ntoskrnl.exe
      2018-04-02 16:50 - 2018-03-28 11:09 - 004046016 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntkrnlpa.exe
      2018-04-02 16:50 - 2018-03-28 11:09 - 004026048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntoskrnl.exe
      2018-04-02 16:50 - 2018-03-09 06:39 - 000708288 _____ (Microsoft Corporation) C:\Windows\system32\winload.efi
      2018-04-02 16:50 - 2018-03-09 06:39 - 000262336 _____ (Microsoft Corporation) C:\Windows\system32\hal.dll
      2018-04-02 16:50 - 2018-03-09 06:39 - 000095424 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ksecdd.sys
      2018-04-02 16:50 - 2018-03-09 06:18 - 000631640 _____ (Microsoft Corporation) C:\Windows\system32\winresume.efi
      2018-04-02 16:50 - 2018-03-09 06:09 - 001665336 _____ (Microsoft Corporation) C:\Windows\system32\ntdll.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 001461248 _____ (Microsoft Corporation) C:\Windows\system32\lsasrv.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 001212928 _____ (Microsoft Corporation) C:\Windows\system32\rpcrt4.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 001163264 _____ (Microsoft Corporation) C:\Windows\system32\kernel32.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000880640 _____ (Microsoft Corporation) C:\Windows\system32\advapi32.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000690688 _____ (Microsoft Corporation) C:\Windows\system32\adtschema.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000463872 _____ (Microsoft Corporation) C:\Windows\system32\certcli.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000419840 _____ (Microsoft Corporation) C:\Windows\system32\KernelBase.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000361984 _____ (Microsoft Corporation) C:\Windows\system32\wow64win.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000345600 _____ (Microsoft Corporation) C:\Windows\system32\schannel.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000312320 _____ (Microsoft Corporation) C:\Windows\system32\ncrypt.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000243712 _____ (Microsoft Corporation) C:\Windows\system32\wow64.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000210432 _____ (Microsoft Corporation) C:\Windows\system32\wdigest.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000146432 _____ (Microsoft Corporation) C:\Windows\system32\msaudite.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000123904 _____ (Microsoft Corporation) C:\Windows\system32\bcrypt.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000060416 _____ (Microsoft Corporation) C:\Windows\system32\msobjs.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000043520 _____ (Microsoft Corporation) C:\Windows\system32\cryptbase.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000006144 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-security-base-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000005120 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-file-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000004608 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-threadpool-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000004608 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-processthreads-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-sysinfo-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-synch-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-localregistry-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-localization-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-rtlsupport-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-processenvironment-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-namedpipe-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-misc-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-memory-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-libraryloader-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-heap-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-xstate-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-util-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-string-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-profile-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-io-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-interlocked-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-handle-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-fibers-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-errorhandling-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-delayload-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-debug-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-datetime-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 06:06 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-console-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 001114112 _____ (Microsoft Corporation) C:\Windows\SysWOW64\kernel32.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000690688 _____ (Microsoft Corporation) C:\Windows\SysWOW64\adtschema.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000275456 _____ (Microsoft Corporation) C:\Windows\SysWOW64\KernelBase.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000223232 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ncrypt.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000146432 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msaudite.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000082944 _____ (Microsoft Corporation) C:\Windows\SysWOW64\bcrypt.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000060416 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msobjs.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000005120 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-file-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000004608 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-processthreads-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-sysinfo-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-synch-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-misc-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-localregistry-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-localization-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-processenvironment-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-namedpipe-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-memory-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-libraryloader-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-interlocked-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-heap-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-string-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-rtlsupport-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-profile-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-io-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-handle-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-fibers-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-errorhandling-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-delayload-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-debug-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-datetime-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:43 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-console-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:38 - 000062464 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\appid.sys
      2018-04-02 16:50 - 2018-03-09 05:34 - 000129536 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\videoprt.sys
      2018-04-02 16:50 - 2018-03-09 05:30 - 000291328 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mrxsmb10.sys
      2018-04-02 16:50 - 2018-03-09 05:22 - 000036352 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cryptbase.dll
      2018-04-02 16:50 - 2018-03-09 05:22 - 000002048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\user.exe
      2018-04-02 16:50 - 2018-03-09 05:21 - 000006144 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-security-base-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:21 - 000004608 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-threadpool-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:21 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-xstate-l1-1-0.dll
      2018-04-02 16:50 - 2018-03-09 05:21 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-util-l1-1-0.dll
      2018-04-02 16:50 - 2018-02-19 00:34 - 000634272 _____ (Microsoft Corporation) C:\Windows\system32\winload.exe
      2018-04-01 14:11 - 2018-04-01 14:11 - 000000000 ____D C:\Users\Denis\AppData\Local\AVAST Software
      2018-04-01 12:40 - 2018-02-10 11:44 - 025740288 _____ (Microsoft Corporation) C:\Windows\system32\mshtml.dll
      2018-04-01 12:40 - 2018-02-10 10:29 - 000004096 _____ (Microsoft Corporation) C:\Windows\system32\ieetwcollectorres.dll
      2018-04-01 12:40 - 2018-02-10 10:17 - 000417280 _____ (Microsoft Corporation) C:\Windows\system32\html.iec
      2018-04-01 12:40 - 2018-02-10 10:17 - 000048640 _____ (Microsoft Corporation) C:\Windows\system32\ieetwproxystub.dll
      2018-04-01 12:40 - 2018-02-10 10:16 - 000088064 _____ (Microsoft Corporation) C:\Windows\system32\MshtmlDac.dll
      2018-04-01 12:40 - 2018-02-10 10:10 - 000054784 _____ (Microsoft Corporation) C:\Windows\system32\jsproxy.dll
      2018-04-01 12:40 - 2018-02-10 10:09 - 005782016 _____ (Microsoft Corporation) C:\Windows\system32\jscript9.dll
      2018-04-01 12:40 - 2018-02-10 10:07 - 000615936 _____ (Microsoft Corporation) C:\Windows\system32\ieui.dll
      2018-04-01 12:40 - 2018-02-10 10:06 - 000814080 _____ (Microsoft Corporation) C:\Windows\system32\jscript9diag.dll
      2018-04-01 12:40 - 2018-02-10 10:06 - 000116224 _____ (Microsoft Corporation) C:\Windows\system32\ieetwcollector.exe
      2018-04-01 12:40 - 2018-02-10 10:01 - 000969216 _____ (Microsoft Corporation) C:\Windows\system32\MsSpellCheckingFacility.exe
      2018-04-01 12:40 - 2018-02-10 09:52 - 000077824 _____ (Microsoft Corporation) C:\Windows\system32\JavaScriptCollectionAgent.dll
      2018-04-01 12:40 - 2018-02-10 09:48 - 000092160 _____ (Microsoft Corporation) C:\Windows\system32\mshtmled.dll
      2018-04-01 12:40 - 2018-02-10 09:33 - 001359360 _____ (Microsoft Corporation) C:\Windows\system32\mshtmlmedia.dll
      2018-04-01 12:40 - 2018-02-10 09:27 - 003241472 _____ (Microsoft Corporation) C:\Windows\system32\wininet.dll
      2018-04-01 12:40 - 2018-02-10 09:20 - 020274176 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mshtml.dll
      2018-04-01 12:40 - 2018-02-10 08:57 - 000499712 _____ (Microsoft Corporation) C:\Windows\SysWOW64\vbscript.dll
      2018-04-01 12:40 - 2018-02-10 08:57 - 000341504 _____ (Microsoft Corporation) C:\Windows\SysWOW64\html.iec
      2018-04-01 12:40 - 2018-02-10 08:56 - 000064000 _____ (Microsoft Corporation) C:\Windows\SysWOW64\MshtmlDac.dll
      2018-04-01 12:40 - 2018-02-10 08:52 - 000047104 _____ (Microsoft Corporation) C:\Windows\SysWOW64\jsproxy.dll
      2018-04-01 12:40 - 2018-02-10 08:50 - 000476160 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieui.dll
      2018-04-01 12:40 - 2018-02-10 08:49 - 000662528 _____ (Microsoft Corporation) C:\Windows\SysWOW64\jscript.dll
      2018-04-01 12:40 - 2018-02-10 08:49 - 000620032 _____ (Microsoft Corporation) C:\Windows\SysWOW64\jscript9diag.dll
      2018-04-01 12:40 - 2018-02-10 08:35 - 004498944 _____ (Microsoft Corporation) C:\Windows\SysWOW64\jscript9.dll
      2018-04-01 12:40 - 2018-02-10 08:35 - 000076288 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mshtmled.dll
      2018-04-01 12:40 - 2018-02-10 08:27 - 000694784 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msfeeds.dll
      2018-04-01 12:40 - 2018-02-10 08:26 - 001155072 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mshtmlmedia.dll
      2018-04-01 12:40 - 2018-02-10 08:14 - 002767872 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wininet.dll
      2018-04-01 12:40 - 2018-02-10 08:08 - 000710144 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieapfltr.dll
      2018-04-01 12:39 - 2018-02-10 22:52 - 000395928 _____ (Microsoft Corporation) C:\Windows\system32\iedkcs32.dll
      2018-04-01 12:39 - 2018-02-10 22:03 - 000347296 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iedkcs32.dll
      2018-04-01 12:39 - 2018-02-10 10:30 - 002724864 _____ (Microsoft Corporation) C:\Windows\system32\mshtml.tlb
      2018-04-01 12:39 - 2018-02-10 10:19 - 002900480 _____ (Microsoft Corporation) C:\Windows\system32\iertutil.dll
      2018-04-01 12:39 - 2018-02-10 10:16 - 000577536 _____ (Microsoft Corporation) C:\Windows\system32\vbscript.dll
      2018-04-01 12:39 - 2018-02-10 10:10 - 000034304 _____ (Microsoft Corporation) C:\Windows\system32\iernonce.dll
      2018-04-01 12:39 - 2018-02-10 10:06 - 000816640 _____ (Microsoft Corporation) C:\Windows\system32\jscript.dll
      2018-04-01 12:39 - 2018-02-10 10:06 - 000144384 _____ (Microsoft Corporation) C:\Windows\system32\ieUnatt.exe
      2018-04-01 12:39 - 2018-02-10 09:58 - 000489984 _____ (Microsoft Corporation) C:\Windows\system32\dxtmsft.dll
      2018-04-01 12:39 - 2018-02-10 09:52 - 000087552 _____ (Microsoft Corporation) C:\Windows\system32\tdc.ocx
      2018-04-01 12:39 - 2018-02-10 09:51 - 000107520 _____ (Microsoft Corporation) C:\Windows\system32\inseng.dll
      2018-04-01 12:39 - 2018-02-10 09:49 - 000199680 _____ (Microsoft Corporation) C:\Windows\system32\msrating.dll
      2018-04-01 12:39 - 2018-02-10 09:46 - 000315392 _____ (Microsoft Corporation) C:\Windows\system32\dxtrans.dll
      2018-04-01 12:39 - 2018-02-10 09:45 - 000152064 _____ (Microsoft Corporation) C:\Windows\system32\occache.dll
      2018-04-01 12:39 - 2018-02-10 09:36 - 015283712 _____ (Microsoft Corporation) C:\Windows\system32\ieframe.dll
      2018-04-01 12:39 - 2018-02-10 09:36 - 000262144 _____ (Microsoft Corporation) C:\Windows\system32\webcheck.dll
      2018-04-01 12:39 - 2018-02-10 09:34 - 000807936 _____ (Microsoft Corporation) C:\Windows\system32\msfeeds.dll
      2018-04-01 12:39 - 2018-02-10 09:34 - 000726528 _____ (Microsoft Corporation) C:\Windows\system32\ie4uinit.exe
      2018-04-01 12:39 - 2018-02-10 09:32 - 002134528 _____ (Microsoft Corporation) C:\Windows\system32\inetcpl.cpl
      2018-04-01 12:39 - 2018-02-10 09:14 - 001546240 _____ (Microsoft Corporation) C:\Windows\system32\urlmon.dll
      2018-04-01 12:39 - 2018-02-10 09:08 - 002724864 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mshtml.tlb
      2018-04-01 12:39 - 2018-02-10 09:02 - 000800768 _____ (Microsoft Corporation) C:\Windows\system32\ieapfltr.dll
      2018-04-01 12:39 - 2018-02-10 08:54 - 002294272 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iertutil.dll
      2018-04-01 12:39 - 2018-02-10 08:51 - 000030720 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iernonce.dll
      2018-04-01 12:39 - 2018-02-10 08:49 - 000115712 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieUnatt.exe
      2018-04-01 12:39 - 2018-02-10 08:42 - 000416256 _____ (Microsoft Corporation) C:\Windows\SysWOW64\dxtmsft.dll
      2018-04-01 12:39 - 2018-02-10 08:39 - 000060416 _____ (Microsoft Corporation) C:\Windows\SysWOW64\JavaScriptCollectionAgent.dll
      2018-04-01 12:39 - 2018-02-10 08:38 - 000091136 _____ (Microsoft Corporation) C:\Windows\SysWOW64\inseng.dll
      2018-04-01 12:39 - 2018-02-10 08:38 - 000073216 _____ (Microsoft Corporation) C:\Windows\SysWOW64\tdc.ocx
      2018-04-01 12:39 - 2018-02-10 08:36 - 000168960 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msrating.dll
      2018-04-01 12:39 - 2018-02-10 08:35 - 000279040 _____ (Microsoft Corporation) C:\Windows\SysWOW64\dxtrans.dll
      2018-04-01 12:39 - 2018-02-10 08:34 - 000130048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\occache.dll
      2018-04-01 12:39 - 2018-02-10 08:33 - 013680640 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieframe.dll
      2018-04-01 12:39 - 2018-02-10 08:29 - 000230400 _____ (Microsoft Corporation) C:\Windows\SysWOW64\webcheck.dll
      2018-04-01 12:39 - 2018-02-10 08:27 - 002058752 _____ (Microsoft Corporation) C:\Windows\SysWOW64\inetcpl.cpl
      2018-04-01 12:39 - 2018-02-10 08:10 - 001314304 _____ (Microsoft Corporation) C:\Windows\SysWOW64\urlmon.dll
      2018-04-01 12:39 - 2018-01-12 19:44 - 001894120 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\tcpip.sys
      2018-04-01 12:39 - 2018-01-12 19:27 - 004834816 _____ (Microsoft Corporation) C:\Windows\system32\xpsrchvw.exe
      2018-04-01 12:39 - 2018-01-12 19:16 - 003405824 _____ (Microsoft Corporation) C:\Windows\SysWOW64\xpsrchvw.exe
      2018-04-01 12:39 - 2018-01-11 19:09 - 003224064 _____ (Microsoft Corporation) C:\Windows\system32\win32k.sys
      2018-04-01 12:39 - 2018-01-05 19:25 - 000383720 _____ (Adobe Systems Incorporated) C:\Windows\system32\atmfd.dll
      2018-04-01 12:39 - 2018-01-05 19:14 - 000309480 _____ (Adobe Systems Incorporated) C:\Windows\SysWOW64\atmfd.dll
      2018-04-01 12:39 - 2018-01-01 05:21 - 001680616 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ntfs.sys
      2018-04-01 12:39 - 2018-01-01 05:21 - 000948968 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ndis.sys
      2018-04-01 12:39 - 2018-01-01 05:21 - 000288488 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\fltMgr.sys
      2018-04-01 12:39 - 2018-01-01 05:18 - 014183936 _____ (Microsoft Corporation) C:\Windows\system32\shell32.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 002066432 _____ (Microsoft Corporation) C:\Windows\system32\ole32.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 002004480 _____ (Microsoft Corporation) C:\Windows\system32\msxml6.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 001942016 _____ (Microsoft Corporation) C:\Windows\system32\authui.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 001867776 _____ (Microsoft Corporation) C:\Windows\system32\ExplorerFrame.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 001741312 _____ (Microsoft Corporation) C:\Windows\system32\sysmain.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 001361408 _____ (Microsoft Corporation) C:\Windows\system32\PeerDistSvc.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 001110528 _____ (Microsoft Corporation) C:\Windows\system32\schedsvc.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 000977408 _____ (Microsoft Corporation) C:\Windows\system32\inetcomm.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 000961024 _____ (Microsoft Corporation) C:\Windows\system32\actxprxy.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 000863232 _____ (Microsoft Corporation) C:\Windows\system32\IKEEXT.DLL
      2018-04-01 12:39 - 2018-01-01 05:18 - 000842752 _____ (Microsoft Corporation) C:\Windows\system32\nshwfp.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 000828928 _____ (Microsoft Corporation) C:\Windows\system32\MPSSVC.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 000749568 _____ (Microsoft Corporation) C:\Windows\system32\FirewallAPI.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 000705024 _____ (Microsoft Corporation) C:\Windows\system32\BFE.DLL
      2018-04-01 12:39 - 2018-01-01 05:18 - 000512000 _____ (Microsoft Corporation) C:\Windows\system32\rpcss.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 000473600 _____ (Microsoft Corporation) C:\Windows\system32\taskcomp.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 000444928 _____ (Microsoft Corporation) C:\Windows\system32\winhttp.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 000439296 _____ (Microsoft Corporation) C:\Windows\system32\p2psvc.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 000366592 _____ (Microsoft Corporation) C:\Windows\system32\wcncsvc.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 000327168 _____ (Microsoft Corporation) C:\Windows\system32\pnrpsvc.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 000303104 _____ (Microsoft Corporation) C:\Windows\system32\nlasvc.dll
      2018-04-01 12:39 - 2018-01-01 05:18 - 000223232 _____ (Microsoft Corporation) C:\Windows\system32\ncsi.dll
      2018-04-01 12:39 - 2018-01-01 05:04 - 000559616 _____ (Microsoft Corporation) C:\Windows\system32\spoolsv.exe
      2018-04-01 12:39 - 2018-01-01 05:00 - 012880384 _____ (Microsoft Corporation) C:\Windows\SysWOW64\shell32.dll
      2018-04-01 12:39 - 2018-01-01 05:00 - 001499648 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ExplorerFrame.dll
      2018-04-01 12:39 - 2018-01-01 05:00 - 001417728 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ole32.dll
      2018-04-01 12:39 - 2018-01-01 05:00 - 001390080 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msxml6.dll
      2018-04-01 12:39 - 2018-01-01 05:00 - 000741888 _____ (Microsoft Corporation) C:\Windows\SysWOW64\inetcomm.dll
      2018-04-01 12:39 - 2018-01-01 05:00 - 000666624 _____ (Microsoft Corporation) C:\Windows\SysWOW64\nshwfp.dll
      2018-04-01 12:39 - 2018-01-01 05:00 - 000463360 _____ (Microsoft Corporation) C:\Windows\SysWOW64\FirewallAPI.dll
      2018-04-01 12:39 - 2018-01-01 05:00 - 000351744 _____ (Microsoft Corporation) C:\Windows\SysWOW64\winhttp.dll
      2018-04-01 12:39 - 2018-01-01 05:00 - 000162304 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ncsi.dll
      2018-04-01 12:39 - 2018-01-01 04:59 - 001806848 _____ (Microsoft Corporation) C:\Windows\SysWOW64\authui.dll
      2018-04-01 12:39 - 2018-01-01 04:50 - 000455680 _____ (Microsoft Corporation) C:\Windows\system32\winlogon.exe
      2018-04-01 12:39 - 2018-01-01 04:42 - 000460288 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\srv.sys
      2018-04-01 12:39 - 2018-01-01 04:42 - 000406016 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\srv2.sys
      2018-04-01 12:39 - 2018-01-01 04:41 - 000754176 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\http.sys
      2018-04-01 12:39 - 2017-12-05 20:36 - 001484288 _____ (Microsoft Corporation) C:\Windows\system32\crypt32.dll
      2018-04-01 12:39 - 2017-12-05 20:36 - 000218112 _____ (Microsoft Corporation) C:\Windows\system32\WinSCard.dll
      2018-04-01 12:39 - 2017-12-05 20:08 - 001176576 _____ (Microsoft Corporation) C:\Windows\SysWOW64\crypt32.dll
      2018-04-01 12:39 - 2017-12-05 19:04 - 000404992 _____ (Microsoft Corporation) C:\Windows\system32\wisptis.exe
      2018-04-01 12:38 - 2018-02-10 10:17 - 000066560 _____ (Microsoft Corporation) C:\Windows\system32\iesetup.dll
      2018-04-01 12:38 - 2018-02-10 08:57 - 000062464 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iesetup.dll
      2018-04-01 12:38 - 2018-02-10 08:57 - 000047616 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieetwproxystub.dll
      2018-04-01 12:38 - 2018-01-12 19:44 - 000377064 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\netio.sys
      2018-04-01 12:38 - 2018-01-12 19:44 - 000371432 _____ (Microsoft Corporation) C:\Windows\system32\clfs.sys
      2018-04-01 12:38 - 2018-01-12 19:44 - 000287976 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\FWPKCLNT.SYS
      2018-04-01 12:38 - 2018-01-12 19:40 - 000484864 _____ (Microsoft Corporation) C:\Windows\system32\StructuredQuery.dll
      2018-04-01 12:38 - 2018-01-12 19:26 - 000363520 _____ (Microsoft Corporation) C:\Windows\SysWOW64\StructuredQuery.dll
      2018-04-01 12:38 - 2018-01-12 19:16 - 000076288 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\hidclass.sys
      2018-04-01 12:38 - 2018-01-12 19:16 - 000030208 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\hidusb.sys
      2018-04-01 12:38 - 2018-01-12 19:15 - 000032896 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\hidparse.sys
      2018-04-01 12:38 - 2018-01-11 19:41 - 001133568 _____ (Microsoft Corporation) C:\Windows\system32\cdosys.dll
      2018-04-01 12:38 - 2018-01-11 19:22 - 000805376 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cdosys.dll
      2018-04-01 12:38 - 2018-01-05 19:31 - 000151552 _____ (Microsoft Corporation) C:\Windows\system32\t2embed.dll
      2018-04-01 12:38 - 2018-01-05 19:31 - 000041472 _____ (Microsoft Corporation) C:\Windows\system32\lpk.dll
      2018-04-01 12:38 - 2018-01-05 19:30 - 000100864 _____ (Microsoft Corporation) C:\Windows\system32\fontsub.dll
      2018-04-01 12:38 - 2018-01-05 19:30 - 000046080 _____ (Adobe Systems) C:\Windows\system32\atmlib.dll
      2018-04-01 12:38 - 2018-01-05 19:30 - 000014336 _____ (Microsoft Corporation) C:\Windows\system32\dciman32.dll
      2018-04-01 12:38 - 2018-01-05 19:11 - 000111104 _____ (Microsoft Corporation) C:\Windows\SysWOW64\t2embed.dll
      2018-04-01 12:38 - 2018-01-05 19:11 - 000071168 _____ (Microsoft Corporation) C:\Windows\SysWOW64\fontsub.dll
      2018-04-01 12:38 - 2018-01-05 19:11 - 000025600 _____ (Microsoft Corporation) C:\Windows\SysWOW64\lpk.dll
      2018-04-01 12:38 - 2018-01-05 19:11 - 000010240 _____ (Microsoft Corporation) C:\Windows\SysWOW64\dciman32.dll
      2018-04-01 12:38 - 2018-01-05 18:50 - 000034304 _____ (Adobe Systems) C:\Windows\SysWOW64\atmlib.dll
      2018-04-01 12:38 - 2018-01-01 05:21 - 000213736 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\rdyboost.sys
      2018-04-01 12:38 - 2018-01-01 05:21 - 000114408 _____ (Microsoft Corporation) C:\Windows\system32\consent.exe
      2018-04-01 12:38 - 2018-01-01 05:18 - 000324096 _____ (Microsoft Corporation) C:\Windows\system32\FWPUCLNT.DLL
      2018-04-01 12:38 - 2018-01-01 05:18 - 000264704 _____ (Microsoft Corporation) C:\Windows\system32\P2P.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000181760 _____ (Microsoft Corporation) C:\Windows\system32\PeerDist.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000131584 _____ (Microsoft Corporation) C:\Windows\system32\PeerDistWSDDiscoProv.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000120320 _____ (Microsoft Corporation) C:\Windows\system32\WcnApi.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000108544 _____ (Microsoft Corporation) C:\Windows\system32\icfupgd.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000101376 _____ (Microsoft Corporation) C:\Windows\system32\fdWCN.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000095744 _____ (Microsoft Corporation) C:\Windows\system32\rascfg.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000084480 _____ (Microsoft Corporation) C:\Windows\system32\INETRES.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000076288 _____ (Microsoft Corporation) C:\Windows\system32\rasdiag.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000070656 _____ (Microsoft Corporation) C:\Windows\system32\nlaapi.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000070144 _____ (Microsoft Corporation) C:\Windows\system32\appinfo.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000060928 _____ (Microsoft Corporation) C:\Windows\system32\ndptsp.tsp
      2018-04-01 12:38 - 2018-01-01 05:18 - 000053760 _____ (Microsoft Corporation) C:\Windows\system32\vmicres.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000051200 _____ (Microsoft Corporation) C:\Windows\system32\PeerDistHttpTrans.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000047104 _____ (Microsoft Corporation) C:\Windows\system32\kmddsp.tsp
      2018-04-01 12:38 - 2018-01-01 05:18 - 000041472 _____ (Microsoft Corporation) C:\Windows\system32\rasmxs.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000039424 _____ (Microsoft Corporation) C:\Windows\system32\traffic.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000029696 _____ (Microsoft Corporation) C:\Windows\system32\rasser.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000026112 _____ (Microsoft Corporation) C:\Windows\system32\oleres.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000024576 _____ (Microsoft Corporation) C:\Windows\system32\WcnEapPeerProxy.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000024064 _____ (Microsoft Corporation) C:\Windows\system32\WcnEapAuthProxy.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000022528 _____ (Microsoft Corporation) C:\Windows\system32\wfapigp.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000016896 _____ (Microsoft Corporation) C:\Windows\system32\wshqos.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000013312 _____ (Microsoft Corporation) C:\Windows\system32\wshnetbs.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000008704 _____ (Microsoft Corporation) C:\Windows\system32\comcat.dll
      2018-04-01 12:38 - 2018-01-01 05:18 - 000002048 _____ (Microsoft Corporation) C:\Windows\system32\msxml6r.dll
      2018-04-01 12:38 - 2018-01-01 05:00 - 000304640 _____ (Microsoft Corporation) C:\Windows\SysWOW64\taskcomp.dll
      2018-04-01 12:38 - 2018-01-01 05:00 - 000276992 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wcncsvc.dll
      2018-04-01 12:38 - 2018-01-01 05:00 - 000217600 _____ (Microsoft Corporation) C:\Windows\SysWOW64\P2P.dll
      2018-04-01 12:38 - 2018-01-01 05:00 - 000216576 _____ (Microsoft Corporation) C:\Windows\SysWOW64\FWPUCLNT.DLL
      2018-04-01 12:38 - 2018-01-01 05:00 - 000139776 _____ (Microsoft Corporation) C:\Windows\SysWOW64\PeerDist.dll
      2018-04-01 12:38 - 2018-01-01 05:00 - 000084480 _____ (Microsoft Corporation) C:\Windows\SysWOW64\INETRES.dll
      2018-04-01 12:38 - 2018-01-01 05:00 - 000081920 _____ (Microsoft Corporation) C:\Windows\SysWOW64\fdWCN.dll
      2018-04-01 12:38 - 2018-01-01 05:00 - 000081408 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rascfg.dll
      2018-04-01 12:38 - 2018-01-01 05:00 - 000061952 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rasdiag.dll
      2018-04-01 12:38 - 2018-01-01 05:00 - 000052224 _____ (Microsoft Corporation) C:\Windows\SysWOW64\nlaapi.dll
      2018-04-01 12:38 - 2018-01-01 05:00 - 000050688 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ndptsp.tsp
      2018-04-01 12:38 - 2018-01-01 05:00 - 000033280 _____ (Microsoft Corporation) C:\Windows\SysWOW64\traffic.dll
      2018-04-01 12:38 - 2018-01-01 05:00 - 000026112 _____ (Microsoft Corporation) C:\Windows\SysWOW64\oleres.dll
      2018-04-01 12:38 - 2018-01-01 05:00 - 000002048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msxml6r.dll
      2018-04-01 12:38 - 2018-01-01 04:59 - 000309760 _____ (Microsoft Corporation) C:\Windows\SysWOW64\actxprxy.dll
      2018-04-01 12:38 - 2018-01-01 04:55 - 000131584 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\pacer.sys
      2018-04-01 12:38 - 2018-01-01 04:55 - 000088576 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\wanarp.sys
      2018-04-01 12:38 - 2018-01-01 04:55 - 000058368 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ndproxy.sys
      2018-04-01 12:38 - 2018-01-01 04:55 - 000045056 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\netbios.sys
      2018-04-01 12:38 - 2018-01-01 04:55 - 000024064 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ndistapi.sys
      2018-04-01 12:38 - 2018-01-01 04:54 - 000077312 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mpsdrv.sys
      2018-04-01 12:38 - 2018-01-01 04:47 - 000244224 _____ (Microsoft Corporation) C:\Windows\system32\vmicsvc.exe
      2018-04-01 12:38 - 2018-01-01 04:46 - 000128512 _____ (Microsoft Corporation) C:\Windows\system32\IcCoinstall.dll
      2018-04-01 12:38 - 2018-01-01 04:46 - 000051712 _____ (Microsoft Corporation) C:\Windows\system32\vmictimeprovider.dll
      2018-04-01 12:38 - 2018-01-01 04:43 - 000086528 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WcnApi.dll
      2018-04-01 12:38 - 2018-01-01 04:43 - 000038912 _____ (Microsoft Corporation) C:\Windows\SysWOW64\kmddsp.tsp
      2018-04-01 12:38 - 2018-01-01 04:43 - 000033280 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rasmxs.dll
      2018-04-01 12:38 - 2018-01-01 04:43 - 000022528 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rasser.dll
      2018-04-01 12:38 - 2018-01-01 04:43 - 000020480 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WcnEapPeerProxy.dll
      2018-04-01 12:38 - 2018-01-01 04:43 - 000019968 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WcnEapAuthProxy.dll
      2018-04-01 12:38 - 2018-01-01 04:43 - 000018944 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wfapigp.dll
      2018-04-01 12:38 - 2018-01-01 04:43 - 000013824 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wshqos.dll
      2018-04-01 12:38 - 2018-01-01 04:42 - 000168448 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\srvnet.sys
      2018-04-01 12:38 - 2018-01-01 04:41 - 000106496 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\dfsc.sys
      2018-04-01 12:38 - 2018-01-01 04:41 - 000007168 _____ (Microsoft Corporation) C:\Windows\SysWOW64\comcat.dll
      2018-04-01 12:38 - 2017-12-05 20:36 - 000625664 _____ (Microsoft Corporation) C:\Windows\system32\mscms.dll
      2018-04-01 12:38 - 2017-12-05 20:36 - 000250880 _____ (Microsoft Corporation) C:\Windows\system32\icm32.dll
      2018-04-01 12:38 - 2017-12-05 20:36 - 000229376 _____ (Microsoft Corporation) C:\Windows\system32\wintrust.dll
      2018-04-01 12:38 - 2017-12-05 20:36 - 000190976 _____ (Microsoft Corporation) C:\Windows\system32\cryptsvc.dll
      2018-04-01 12:38 - 2017-12-05 20:36 - 000141824 _____ (Microsoft Corporation) C:\Windows\system32\cryptnet.dll
      2018-04-01 12:38 - 2017-12-05 20:36 - 000092160 _____ (Microsoft Corporation) C:\Windows\system32\TabSvc.dll
      2018-04-01 12:38 - 2017-12-05 20:36 - 000040960 _____ (Microsoft Corporation) C:\Windows\system32\WcsPlugInService.dll
      2018-04-01 12:38 - 2017-12-05 20:08 - 000481792 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mscms.dll
      2018-04-01 12:38 - 2017-12-05 20:08 - 000215040 _____ (Microsoft Corporation) C:\Windows\SysWOW64\icm32.dll
      2018-04-01 12:38 - 2017-12-05 20:08 - 000179200 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wintrust.dll
      2018-04-01 12:38 - 2017-12-05 20:08 - 000145920 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cryptsvc.dll
      2018-04-01 12:38 - 2017-12-05 20:08 - 000135168 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WinSCard.dll
      2018-04-01 12:38 - 2017-12-05 20:08 - 000106496 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cryptnet.dll
      2018-04-01 12:38 - 2017-12-05 18:49 - 000032768 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WcsPlugInService.dll
      2018-04-01 12:30 - 2018-04-01 12:30 - 000000000 ____D C:\Users\Denis\AppData\Roaming\AVAST Software
      2018-04-01 12:28 - 2018-04-01 12:28 - 000001922 _____ C:\Users\Public\Desktop\Avast Free Antivirus.lnk
      2018-04-01 12:28 - 2018-04-01 12:28 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\AVAST Software
      2018-04-01 12:26 - 2018-04-13 07:28 - 000003910 _____ C:\Windows\System32\Tasks\Avast Emergency Update
      2018-04-01 12:25 - 2018-04-13 07:28 - 000147224 _____ (AVAST Software) C:\Windows\system32\Drivers\aswMonFlt.sys
      2018-04-01 12:25 - 2018-04-13 07:26 - 001026696 _____ (AVAST Software) C:\Windows\system32\Drivers\aswSnx.sys
      2018-04-01 12:25 - 2018-04-13 07:26 - 000460520 _____ (AVAST Software) C:\Windows\system32\Drivers\aswSP.sys
      2018-04-01 12:25 - 2018-04-13 07:26 - 000380528 _____ (AVAST Software) C:\Windows\system32\Drivers\aswVmm.sys
      2018-04-01 12:25 - 2018-04-13 07:26 - 000227784 _____ (AVAST Software) C:\Windows\system32\Drivers\aswHdsKe.sys
      2018-04-01 12:25 - 2018-04-13 07:26 - 000205976 _____ (AVAST Software) C:\Windows\system32\Drivers\aswStm.sys
      2018-04-01 12:25 - 2018-04-13 07:26 - 000196640 _____ (AVAST Software) C:\Windows\system32\Drivers\aswArPot.sys
      2018-04-01 12:25 - 2018-04-13 07:26 - 000111352 _____ (AVAST Software) C:\Windows\system32\Drivers\aswRdr2.sys
      2018-04-01 12:25 - 2018-04-13 07:26 - 000084368 _____ (AVAST Software) C:\Windows\system32\Drivers\aswRvrt.sys
      2018-04-01 12:25 - 2018-04-13 07:26 - 000046968 _____ (AVAST Software) C:\Windows\system32\Drivers\aswHwid.sys
      2018-04-01 12:25 - 2018-04-01 12:21 - 000343752 _____ (AVAST Software) C:\Windows\system32\Drivers\aswbloga.sys
      2018-04-01 12:25 - 2018-04-01 12:21 - 000227504 _____ (AVAST Software) C:\Windows\system32\Drivers\aswbidsdrivera.sys
      2018-04-01 12:25 - 2018-04-01 12:21 - 000199440 _____ (AVAST Software) C:\Windows\system32\Drivers\aswbidsha.sys
      2018-04-01 12:25 - 2018-04-01 12:21 - 000057680 _____ (AVAST Software) C:\Windows\system32\Drivers\aswbuniva.sys
      2018-04-01 12:23 - 2018-04-01 12:23 - 000000000 ____D C:\Program Files\Common Files\AVAST Software
      2018-04-01 11:45 - 2018-04-13 03:45 - 000000510 _____ C:\Windows\Tasks\SUPERAntiSpyware Scheduled Task 91abd3e0-5990-4aa4-ba5f-3e0e60b47fa2.job
      2018-04-01 11:45 - 2018-04-13 02:00 - 000000510 _____ C:\Windows\Tasks\SUPERAntiSpyware Scheduled Task 2636bd95-9cca-4d29-aa0d-132b9a2981d6.job
      2018-04-01 11:45 - 2018-04-01 11:45 - 000003584 _____ C:\Windows\System32\Tasks\SUPERAntiSpyware Scheduled Task 2636bd95-9cca-4d29-aa0d-132b9a2981d6
      2018-04-01 11:45 - 2018-04-01 11:45 - 000003510 _____ C:\Windows\System32\Tasks\SUPERAntiSpyware Scheduled Task 91abd3e0-5990-4aa4-ba5f-3e0e60b47fa2
      2018-04-01 11:45 - 2018-04-01 11:45 - 000001808 _____ C:\Users\Public\Desktop\SUPERAntiSpyware Professional.lnk
      2018-04-01 11:45 - 2018-04-01 11:45 - 000000000 ____D C:\Users\Denis\AppData\Roaming\SUPERAntiSpyware.com
      2018-04-01 11:45 - 2018-04-01 11:45 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\SUPERAntiSpyware
      2018-04-01 11:44 - 2018-04-06 16:04 - 000000000 ____D C:\Program Files\SUPERAntiSpyware
      2018-04-01 11:44 - 2018-04-01 11:44 - 000000000 ____D C:\ProgramData\SUPERAntiSpyware.com
      2018-04-01 11:42 - 2018-04-01 11:44 - 032580552 _____ (SUPERAntiSpyware) C:\Users\Denis\Desktop\SUPERAntiSpywarePro.exe
      2018-04-01 11:38 - 2018-04-01 11:38 - 000000000 ____D C:\Windows\system32\appmgmt
      2018-04-01 11:31 - 2018-04-01 11:31 - 000000000 ____D C:\Users\Denis\AppData\Local\Chromium
      2018-04-01 11:03 - 2018-04-01 11:03 - 000253664 _____ (Malwarebytes) C:\Windows\system32\Drivers\mbamswissarmy.sys
      2018-04-01 11:03 - 2018-04-01 11:03 - 000001867 _____ C:\Users\Public\Desktop\Malwarebytes.lnk
      2018-04-01 11:03 - 2018-04-01 11:03 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Malwarebytes
      2018-04-01 11:02 - 2018-03-19 12:57 - 000076192 _____ C:\Windows\system32\Drivers\mbae64.sys
      2018-04-01 11:00 - 2018-04-01 11:00 - 000000000 ____D C:\ProgramData\Malwarebytes
      2018-04-01 11:00 - 2018-04-01 11:00 - 000000000 ____D C:\Program Files\Malwarebytes
      2018-04-01 10:58 - 2018-04-01 10:58 - 000000000 ____D C:\Program Files\5TK02URXOS
      2018-04-01 10:56 - 2018-04-01 11:34 - 000000000 ____D C:\Users\Denis\AppData\Roaming\w1ue4fa2w2e
      2018-04-01 10:55 - 2018-04-01 11:34 - 000000000 ____D C:\Users\Denis\AppData\Roaming\udvovefa0ze
      2018-04-01 10:55 - 2018-04-01 11:34 - 000000000 ____D C:\Users\Denis\AppData\Roaming\h2g3qje1ew5
      2018-04-01 10:55 - 2018-04-01 10:57 - 000000000 ____D C:\Program Files\VS2P538RN4
      2018-04-01 10:51 - 2018-04-01 10:51 - 000000290 __RSH C:\Users\Denis\ntuser.pol
      2018-04-01 10:48 - 2018-04-07 14:06 - 000000000 ____D C:\ProgramData\10b45edb-3473-4b10-b57e-0ad402f4c858
      2018-04-01 10:46 - 2018-04-01 11:34 - 000000000 ____D C:\Users\Denis\AppData\Roaming\yoasfgt1ylr
      2018-04-01 10:46 - 2018-04-01 10:46 - 000000000 ____D C:\Program Files\JC60L5XO5O
      2018-04-01 10:46 - 2018-04-01 10:46 - 000000000 ____D C:\Program Files\7JP1TF3RPR
      2018-04-01 10:45 - 2018-04-01 11:34 - 000000000 ____D C:\Users\Denis\AppData\Roaming\qzoaexvthyw
      2018-04-01 10:45 - 2018-04-01 11:34 - 000000000 ____D C:\Users\Denis\AppData\Roaming\l4vhnklvv4b
      2018-04-01 10:42 - 2018-04-01 10:42 - 000000000 ____D C:\Users\Denis\AppData\Roaming\4fypyupwbhn
      2018-04-01 10:41 - 2018-04-07 14:05 - 000000000 ____D C:\Browse
      2018-04-01 10:41 - 2018-04-01 11:33 - 000000000 ____D C:\Applications
      2018-04-01 10:41 - 2018-04-01 10:41 - 000000000 ____D C:\Winsys
      2018-04-01 10:40 - 2018-04-01 11:10 - 000000000 ____D C:\Program Files (x86)\Sikimi
      2018-04-01 10:40 - 2018-04-01 10:40 - 000000000 ____D C:\Program Files\My Program
      2018-04-01 10:38 - 2018-04-01 11:10 - 000000000 ____D C:\Users\Denis\AppData\Local\GenericTools
      2018-04-01 10:38 - 2018-04-01 10:38 - 001986226 _____ C:\Users\Denis\AppData\Local\Inis.tst
      2018-04-01 10:37 - 2018-04-01 11:04 - 000929792 _____ C:\Users\Denis\AppData\Local\sham.db
      2018-04-01 10:37 - 2018-04-01 10:37 - 000140800 _____ C:\Users\Denis\AppData\Local\installer.dat
      2018-04-01 10:36 - 2018-04-01 15:43 - 000000000 ____D C:\ProgramData\AVAST Software
      2018-04-01 10:36 - 2018-04-01 10:36 - 000000000 ____D C:\Program Files\AVAST Software
      2018-03-31 17:51 - 2018-04-11 07:29 - 000000000 ____D C:\Users\Denis\Downloads\BangBros18 - Emma Hix - Blonde Makes Juan Fuck Her Hard
      2018-03-31 17:51 - 2018-03-31 17:51 - 000000000 ____D C:\Users\Denis\Downloads\VW Golf 4 (1997+)
      2018-03-25 20:22 - 2018-03-25 20:24 - 000000000 ____D C:\Users\Denis\Desktop\gh
      2018-03-24 00:04 - 2018-03-24 00:04 - 000043872 _____ (Connectify) C:\Windows\system32\Drivers\cnnctfy3.sys
      2018-03-24 00:04 - 2018-03-24 00:04 - 000036736 _____ (Connectify) C:\Windows\system32\Drivers\cfywlan1.sys
      2018-03-24 00:01 - 2018-03-24 00:02 - 016026232 _____ (Connectify) C:\Users\Denis\Desktop\Connectify2018Installer.exe
      2018-03-21 11:38 - 2018-03-21 11:38 - 000192408 _____ C:\Windows\system32\Drivers\butldsk.sys
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-04-15 13:26 - 2018-01-12 17:39 - 000000000 ____D C:\Users\Denis\AppData\Roaming\AIMP
      2018-04-15 10:43 - 2009-07-14 07:45 - 000021280 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-1.C7483456-A289-439d-8115-601632D005A0
      2018-04-15 10:43 - 2009-07-14 07:45 - 000021280 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-0.C7483456-A289-439d-8115-601632D005A0
      2018-04-15 10:35 - 2017-12-06 14:35 - 000000000 __SHD C:\Users\Denis\IntelGraphicsProfiles
      2018-04-15 10:35 - 2009-07-14 08:08 - 000000006 ____H C:\Windows\Tasks\SA.DAT
      2018-04-14 21:31 - 2017-12-02 22:27 - 000003834 _____ C:\Windows\System32\Tasks\Opera scheduled Autoupdate 1512242838
      2018-04-14 21:31 - 2017-12-02 22:24 - 000000000 ____D C:\Program Files\Opera
      2018-04-14 21:25 - 2017-12-02 23:41 - 000004738 __RSH C:\ProgramData\ntuser.pol
      2018-04-14 21:07 - 2009-07-14 08:13 - 000781790 _____ C:\Windows\system32\PerfStringBackup.INI
      2018-04-14 21:07 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\inf
      2018-04-13 03:22 - 2017-12-07 12:43 - 000000000 ____D C:\Windows\system32\appraiser
      2018-04-13 03:06 - 2017-12-07 15:19 - 000000000 ____D C:\Windows\system32\MRT
      2018-04-13 03:01 - 2017-12-07 15:19 - 136971704 ____C (Microsoft Corporation) C:\Windows\system32\MRT-KB890830.exe
      2018-04-13 03:01 - 2017-12-02 20:46 - 136971704 ____C (Microsoft Corporation) C:\Windows\system32\MRT.exe
      2018-04-11 10:53 - 2017-12-11 23:51 - 000000000 ____D C:\Users\Denis\Downloads\new
      2018-04-10 18:05 - 2018-01-21 13:58 - 000804864 _____ (Adobe Systems Incorporated) C:\Windows\SysWOW64\FlashPlayerApp.exe
      2018-04-10 18:05 - 2018-01-21 13:58 - 000144896 _____ (Adobe Systems Incorporated) C:\Windows\SysWOW64\FlashPlayerCPLApp.cpl
      2018-04-10 18:05 - 2018-01-21 13:58 - 000004474 _____ C:\Windows\System32\Tasks\Adobe Flash Player PPAPI Notifier
      2018-04-10 18:05 - 2018-01-21 13:58 - 000004324 _____ C:\Windows\System32\Tasks\Adobe Flash Player Updater
      2018-04-10 18:05 - 2018-01-21 13:58 - 000000000 ____D C:\Windows\SysWOW64\Macromed
      2018-04-10 18:05 - 2018-01-21 13:58 - 000000000 ____D C:\Windows\system32\Macromed
      2018-04-10 18:01 - 2018-03-01 14:27 - 000000000 ___HD C:\Users\Denis\Desktop\.picasaoriginals
      2018-04-07 15:10 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\rescache
      2018-04-07 10:30 - 2017-12-28 15:27 - 000000000 ____D C:\Users\Denis\AppData\Roaming\EurekaLog
      2018-04-06 23:02 - 2017-12-02 22:26 - 000000000 ____D C:\Users\Denis\AppData\Roaming\uTorrent
      2018-04-06 18:40 - 2017-12-25 17:35 - 000000000 ____D C:\Users\Denis\AppData\LocalLow\Mozilla
      2018-04-06 18:32 - 2017-12-25 17:34 - 000000000 ____D C:\Program Files\Mozilla Firefox
      2018-04-02 16:28 - 2009-07-14 07:45 - 000268392 _____ C:\Windows\system32\FNTCACHE.DAT
      2018-04-01 16:05 - 2017-12-07 11:14 - 000774404 _____ C:\Windows\SysWOW64\PerfStringBackup.INI
      2018-04-01 11:32 - 2017-12-02 20:48 - 000001393 _____ C:\Users\Denis\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Internet Explorer.lnk
      2018-04-01 11:23 - 2017-12-28 15:53 - 000000000 ____D C:\ProgramData\Ashampoo
      2018-04-01 10:51 - 2017-12-02 20:47 - 000000000 ____D C:\Users\Denis
      2018-04-01 10:46 - 2009-07-14 06:20 - 000000000 ___HD C:\Windows\system32\GroupPolicy
      2018-04-01 10:39 - 2009-07-14 08:32 - 000000000 ____D C:\Program Files\Windows Photo Viewer
      2018-04-01 10:38 - 2017-12-27 16:26 - 000000000 ____D C:\Program Files (x86)\Google
      ==================== Files in the root of some directories =======
      2018-04-01 10:38 - 2018-04-01 10:38 - 001986226 _____ () C:\Users\Denis\AppData\Local\Inis.tst
      2018-04-01 10:37 - 2018-04-01 10:37 - 000140800 _____ () C:\Users\Denis\AppData\Local\installer.dat
      2018-04-01 10:37 - 2018-04-01 11:04 - 000929792 _____ () C:\Users\Denis\AppData\Local\sham.db
      Some files in TEMP:
      2017-10-24 03:51 - 2017-10-24 03:51 - 000164424 _____ (Microsoft Corporation) C:\Users\Denis\AppData\Local\Temp\atl110.dll
      2015-09-22 20:06 - 2015-09-22 20:06 - 002382216 _____ (Mooii) C:\Users\Denis\AppData\Local\Temp\GoogleSetup.exe
      2017-10-24 03:51 - 2017-10-24 03:51 - 000069632 _____ () C:\Users\Denis\AppData\Local\Temp\HwInfo.dll
      2016-10-07 06:26 - 2016-10-07 06:26 - 000270336 _____ () C:\Users\Denis\AppData\Local\Temp\NSISPromotionEx.dll
      2018-04-01 10:41 - 2018-04-01 10:52 - 048475773 _____ (My Company, Inc.                                            ) C:\Users\Denis\AppData\Local\Temp\setupsb.exe
      2017-12-03 00:07 - 2017-08-29 03:30 - 000070656 _____ () C:\Users\Denis\AppData\Local\Temp\ShellHook.dll
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\Windows\system32\winlogon.exe => File is digitally signed
      C:\Windows\system32\wininit.exe => File is digitally signed
      C:\Windows\SysWOW64\wininit.exe => File is digitally signed
      C:\Windows\explorer.exe => File is digitally signed
      C:\Windows\SysWOW64\explorer.exe => File is digitally signed
      C:\Windows\system32\svchost.exe => File is digitally signed
      C:\Windows\SysWOW64\svchost.exe => File is digitally signed
      C:\Windows\system32\services.exe => File is digitally signed
      C:\Windows\system32\User32.dll => File is digitally signed
      C:\Windows\SysWOW64\User32.dll => File is digitally signed
      C:\Windows\system32\userinit.exe => File is digitally signed
      C:\Windows\SysWOW64\userinit.exe => File is digitally signed
      C:\Windows\system32\rpcss.dll => File is digitally signed
      C:\Windows\system32\dnsapi.dll => File is digitally signed
      C:\Windows\SysWOW64\dnsapi.dll => File is digitally signed
      C:\Windows\system32\Drivers\volsnap.sys => File is digitally signed
      LastRegBack: 2018-04-15 11:30
      ==================== End of FRST.txt ============================

    • от pyrpyl
      Здравейте, от няколко дни антивирусната при стартиране ми изкарва следното съобщение(прилагам снимка).
      След премахването на файла, при стартирането следващият път ми изкарва същото съобщение и така...... Не виждам видима промяна в работата на машината. Прилагам логовете от сканирането
      :Scan result of Farbar Recovery Scan Tool (FRST) (x64) Version: 14.03.2018
      Ran by Pyrpyl_HP (administrator) on PYRPYL_HP-PC (11-04-2018 18:30:44)
      Running from C:\Download
      Loaded Profiles: Pyrpyl_HP (Available Profiles: Pyrpyl_HP)
      Platform: Windows 7 Ultimate Service Pack 1 (X64) Language: English (United States)
      Internet Explorer Version 11 (Default browser: Chrome)
      Boot Mode: Normal
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      (Enigma Software Group USA, LLC.) C:\Program Files (x86)\Enigma Software Group\SpyHunter\SH4Service.exe
      (AMD) C:\Windows\System32\atiesrxx.exe
      (IDT, Inc.) C:\Program Files\IDT\WDM\stacsv64.exe
      (Intel Corporation) C:\Windows\System32\igfxCUIService.exe
      (Hewlett-Packard Company) C:\Windows\System32\hpservice.exe
      (AMD) C:\Windows\System32\atieclxx.exe
      (Avira Operations GmbH & Co. KG) C:\Program Files (x86)\Avira\AntiVir Desktop\sched.exe
      (Avira Operations GmbH & Co. KG) C:\Program Files (x86)\Avira\AntiVir Desktop\avfwsvc.exe
      (Avira Operations GmbH & Co. KG) C:\Program Files (x86)\Avira\AntiVir Desktop\avguard.exe
      (IVT Corporation) C:\Program Files (x86)\Ralink Corporation\Ralink Bluetooth Stack\BlueSoleilCS.exe
      (Hewlett-Packard Company) C:\Program Files (x86)\Hewlett-Packard\Shared\HPDrvMntSvc.exe
      (Hewlett-Packard Company) C:\Program Files (x86)\Hewlett-Packard\HP Hotkey Support\HPHotkeyMonitor.exe
      (Intel(R) Corporation) C:\Program Files\Intel\iCLS Client\HeciServer.exe
      (Symantec Corporation) C:\Program Files (x86)\Norton Ghost\Agent\VProSvc.exe
      (Microsoft Corporation) C:\Program Files\Common Files\Microsoft Shared\OfficeSoftwareProtectionPlatform\OSPPSVC.EXE
      () C:\Program Files (x86)\HTC\Internet Pass-Through\PassThruSvr.exe
      (PDF Complete Inc) C:\Program Files (x86)\PDF Complete\pdfsvc.exe
      (Synaptics Incorporated) C:\Program Files\Synaptics\SynTP\SynTPEnhService.exe
      (Validity Sensors, Inc.) C:\Windows\System32\vcsFPService.exe
      (Microsoft Corp.) C:\Program Files\Common Files\Microsoft Shared\Windows Live\WLIDSVC.EXE
      (Microsoft Corp.) C:\Program Files\Common Files\Microsoft Shared\Windows Live\WLIDSVCM.EXE
      (Sony) C:\Program Files\Sony\Xperia Companion\Service\XperiaCompanionService.exe
      (Synaptics Incorporated) C:\Program Files\Synaptics\SynTP\SynTPEnh.exe
      (Avira Operations GmbH & Co. KG) C:\Program Files (x86)\Avira\AntiVir Desktop\avshadow.exe
      (Avira Operations GmbH & Co. KG) C:\Program Files (x86)\Avira\AntiVir Desktop\avmailc7.exe
      (Avira Operations GmbH & Co. KG) C:\Program Files (x86)\Avira\AntiVir Desktop\avwebg7.exe
      (Hewlett-Packard Company) C:\Program Files (x86)\Hewlett-Packard\Shared\hpqWmiEx.exe
      (Microsoft Corporation) C:\Windows\System32\rundll32.exe
      (Symantec) C:\Program Files (x86)\Norton Ghost\Shared\Drivers\SymSnapServicex64.exe
      (Synaptics Incorporated) C:\Program Files\Synaptics\SynTP\SynTPHelper.exe
      (IVT Corporation) C:\Program Files (x86)\Ralink Corporation\Ralink Bluetooth Stack\BsHelpCS.exe
      (Microsoft Corporation) C:\Windows\Microsoft.NET\Framework64\v3.0\WPF\PresentationFontCache.exe
      (Intel Corporation) C:\Windows\System32\igfxEM.exe
      (Intel Corporation) C:\Windows\System32\igfxHK.exe
      (IDT, Inc.) C:\Program Files\IDT\WDM\sttray64.exe
      (IrisTech) C:\Users\Pyrpyl_HP\AppData\Local\Iris\Iris.exe
      (Sony) C:\Program Files (x86)\Sony\Xperia Companion\XperiaCompanionAgent.exe
      (AMD) C:\Program Files (x86)\ATI Technologies\HydraVision\HydraDM.exe
      (AMD) C:\Program Files (x86)\ATI Technologies\HydraVision\HydraDM64.exe
      (Hewlett-Packard Company) C:\Program Files (x86)\Hewlett-Packard\HP 3D DriveGuard\AccelerometerSt.exe
      (IVT Corporation) C:\Program Files (x86)\Ralink Corporation\Ralink Bluetooth Stack\BtTray.exe
      (Hewlett-Packard Company) C:\Program Files (x86)\Hewlett-Packard\HP Hotkey Support\QLBController.exe
      (Intel Corporation) C:\Program Files (x86)\Intel\Intel(R) USB 3.0 eXtensible Host Controller Driver\Application\iusb3mon.exe
      () C:\Windows\SysWOW64\x86.exe
      (Avira Operations GmbH & Co. KG) C:\Program Files (x86)\Avira\AntiVir Desktop\avgnt.exe
      (Intel Corporation) C:\Program Files\Intel\Intel(R) Rapid Storage Technology\IAStorIcon.exe
      (Intel Corporation) C:\Program Files\Intel\Intel(R) Rapid Storage Technology\IAStorDataMgrSvc.exe
      (Intel Corporation) C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\FWService\IntelMeFWService.exe
      (Intel Corporation) C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\DAL\jhi_service.exe
      (Intel Corporation) C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\LMS\LMS.exe
      (Samsung Electronics Co., Ltd.) C:\Program Files (x86)\Samsung\AllShare\AllShareDMS\AllShareDMS.exe
      (Intel Corporation) C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\IMSS\PrivacyIconClient.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Avira Operations GmbH & Co. KG) C:\Program Files (x86)\Avira\AntiVir Desktop\usrreq.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [IAStorIcon] => C:\Program Files\Intel\Intel(R) Rapid Storage Technology\IAStorIcon.exe [286056 2013-07-30] (Intel Corporation)
      HKLM\...\Run: [SysTrayApp] => C:\Program Files\IDT\WDM\sttray64.exe [1703424 2013-11-07] (IDT, Inc.)
      HKLM\...\Run: [Keyboard Suite Daemon] => C:\Windows\system32\xManager\PELKBD.EXE
      HKLM\...\Run: [TPMXKST KB Suite Daemon] => C:\Windows\system32\xManager\PKSKBD.EXE
      HKLM-x32\...\Run: [] => [X]
      HKLM-x32\...\Run: [AccelerometerSysTrayApplet] => C:\Program Files (x86)\Hewlett-Packard\HP 3D DriveGuard\AccelerometerST.exe [77088 2013-10-16] (Hewlett-Packard Company)
      HKLM-x32\...\Run: [BtTray] => C:\Program Files (x86)\Ralink Corporation\Ralink Bluetooth Stack\BtTray.exe [388344 2013-12-25] (IVT Corporation)
      HKLM-x32\...\Run: [IMSS] => C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\IMSS\PIconStartup.exe [134616 2013-12-10] (Intel Corporation)
      HKLM-x32\...\Run: [QLBController] => C:\Program Files (x86)\Hewlett-Packard\HP Hotkey Support\QLBController.exe [336672 2014-05-16] (Hewlett-Packard Company)
      HKLM-x32\...\Run: [USB3MON] => C:\Program Files (x86)\Intel\Intel(R) USB 3.0 eXtensible Host Controller Driver\Application\iusb3mon.exe [292848 2013-12-20] (Intel Corporation)
      HKLM-x32\...\Run: [x86] => C:\Windows\SysWOW64\x86.exe [26624 2013-08-09] ()
      HKLM-x32\...\Run: [HP HD Webcam Driver_Monitor] => C:\Program Files (x86)\HP HD Webcam Driver\monitor.exe
      HKLM-x32\...\Run: [avgnt] => C:\Program Files (x86)\Avira\AntiVir Desktop\avgnt.exe [777392 2016-12-15] (Avira Operations GmbH & Co. KG)
      HKLM-x32\...\Run: [PDF Complete] => C:\Program Files (x86)\PDF Complete\pdfsty.exe [1194048 2018-02-01] (PDF Complete Inc)
      HKLM\...\RunOnce: [Uninstall] => C:\Windows\system32\pmuninst.exe /DeleteSelf********䄐z**້䈁**匙﷡߾*************Ȃ***້䈁**********䢖睄********Ȃ***ĵ***********້䈁**ᕰv߾*p*********************************』***墑睃**້䈁**ᕰv߾*ꑀ***�睅******ゔv߾* (the data entry has 311 more characters).
      Winlogon\Notify\igfxcui: igfxdev.dll [X]
      HKU\S-1-5-21-993510031-3225739286-1372905849-1000\...\Run: [Iris] => C:\Users\Pyrpyl_HP\AppData\Local\Iris\Iris.exe [7589376 2017-01-01] (IrisTech)
      HKU\S-1-5-21-993510031-3225739286-1372905849-1000\...\Run: [XperiaCompanionAgent] => C:\Program Files (x86)\Sony\Xperia Companion\XperiaCompanionAgent.exe [2102112 2017-11-09] (Sony)
      HKU\S-1-5-21-993510031-3225739286-1372905849-1000\...\Run: [HydraVisionDesktopManager] => C:\Program Files (x86)\ATI Technologies\HydraVision\HydraDM.exe [1967616 2014-04-17] (AMD)
      HKU\S-1-5-21-993510031-3225739286-1372905849-1000\...\RunOnce: [FlashPlayerUpdate] => C:\Windows\SysWOW64\Macromed\Flash\FlashUtil32_29_0_0_113_pepper.exe [1362432 2018-03-18] (Adobe Systems Incorporated)
      HKU\S-1-5-21-993510031-3225739286-1372905849-1000\...\MountPoints2: {0561ff80-a839-11e7-9000-a01d48a8ba41} - F:\Password.exe
      HKU\S-1-5-21-993510031-3225739286-1372905849-1000\...\MountPoints2: {13bd9843-7c87-11e6-89f9-fc4dd454ccdd} - F:\LaunchU3.exe -a
      HKU\S-1-5-21-993510031-3225739286-1372905849-1000\...\MountPoints2: {2ddd6712-3309-11e7-a61c-a01d48a8ba41} - F:\Startme.exe
      HKU\S-1-5-21-993510031-3225739286-1372905849-1000\...\MountPoints2: {f2deb810-5a1a-11e5-91fa-a01d48a8ba41} - F:\AutoRun.exe
      HKU\S-1-5-21-993510031-3225739286-1372905849-1000\...\Winlogon: [Shell] C:\Windows\explorer.exe [3229696 2016-08-29] (Microsoft Corporation) <==== ATTENTION
      GroupPolicy: Restriction <==== ATTENTION
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      Tcpip\Parameters: [DhcpNameServer]
      Tcpip\..\Interfaces\{E3DE5057-8568-4811-8439-B2FF78B3C830}: [DhcpNameServer]
      Internet Explorer:
      HKLM\Software\Microsoft\Internet Explorer\Main,Start Page = hxxps://search.avira.net/#web/result?source=art&q=
      HKLM\Software\Wow6432Node\Microsoft\Internet Explorer\Main,Start Page = hxxps://search.avira.net/#web/result?source=art&q=
      HKLM\Software\Microsoft\Internet Explorer\Main,Search Page = hxxps://search.avira.net/#web/result?source=art&q=
      HKLM\Software\Wow6432Node\Microsoft\Internet Explorer\Main,Search Page = hxxps://search.avira.net/#web/result?source=art&q=
      HKLM\Software\Microsoft\Internet Explorer\Main,Default_Page_URL = hxxps://search.avira.net/#web/result?source=art&q=
      HKLM\Software\Wow6432Node\Microsoft\Internet Explorer\Main,Default_Page_URL = hxxps://search.avira.net/#web/result?source=art&q=
      HKLM\Software\Microsoft\Internet Explorer\Main,Default_Search_URL = hxxps://search.avira.net/#web/result?source=art&q=
      HKLM\Software\Wow6432Node\Microsoft\Internet Explorer\Main,Default_Search_URL = hxxps://search.avira.net/#web/result?source=art&q=
      HKU\S-1-5-21-993510031-3225739286-1372905849-1000\Software\Microsoft\Internet Explorer\Main,Start Page = hxxp://ruse-news.com/
      HKU\S-1-5-21-993510031-3225739286-1372905849-1000\Software\Microsoft\Internet Explorer\Main,Default_Page_URL = hxxps://search.avira.net/#web/result?source=art&q=
      HKU\S-1-5-21-993510031-3225739286-1372905849-1000\Software\Microsoft\Internet Explorer\Main,Default_Search_URL = hxxps://search.avira.net/#web/result?source=art&q=
      SearchScopes: HKLM -> DefaultScope {33BB0A4E-99AF-4226-BDF6-49120163DE86} URL = 
      SearchScopes: HKLM -> {0633EE93-D776-472f-A0FF-E1416B8B2E3A} URL = 
      SearchScopes: HKLM-x32 -> DefaultScope {0633EE93-D776-472f-A0FF-E1416B8B2E3A} URL = 
      SearchScopes: HKLM-x32 -> {0633EE93-D776-472f-A0FF-E1416B8B2E3A} URL = 
      BHO: Groove GFS Browser Helper -> {72853161-30C5-4D22-B7F9-0BBC1D38A37E} -> C:\Program Files\Microsoft Office\Office14\GROOVEEX.DLL [2010-01-21] (Microsoft Corporation)
      BHO: Java(tm) Plug-In SSV Helper -> {761497BB-D6F0-462C-B6EB-D4DAF1D92D43} -> C:\Program Files\Java\jre1.8.0_45\bin\ssv.dll [2015-04-16] (Oracle Corporation)
      BHO: Windows Live ID Sign-in Helper -> {9030D464-4C02-4ABF-8ECC-5164760863C6} -> C:\Program Files\Common Files\Microsoft Shared\Windows Live\WindowsLiveLogin.dll [2012-07-17] (Microsoft Corp.)
      BHO: Office Document Cache Handler -> {B4F3A835-0E21-4959-BA22-42B3008E02FF} -> C:\Program Files\Microsoft Office\Office14\URLREDIR.DLL [2010-01-16] (Microsoft Corporation)
      BHO: Java(tm) Plug-In 2 SSV Helper -> {DBC80044-A445-435b-BC74-9C25C1C588A9} -> C:\Program Files\Java\jre1.8.0_45\bin\jp2ssv.dll [2015-04-16] (Oracle Corporation)
      BHO-x32: Groove GFS Browser Helper -> {72853161-30C5-4D22-B7F9-0BBC1D38A37E} -> C:\Program Files (x86)\Microsoft Office\Office14\GROOVEEX.DLL [2010-01-21] (Microsoft Corporation)
      BHO-x32: Windows Live ID Sign-in Helper -> {9030D464-4C02-4ABF-8ECC-5164760863C6} -> C:\Program Files (x86)\Common Files\Microsoft Shared\Windows Live\WindowsLiveLogin.dll [2012-07-17] (Microsoft Corp.)
      BHO-x32: Office Document Cache Handler -> {B4F3A835-0E21-4959-BA22-42B3008E02FF} -> C:\Program Files (x86)\Microsoft Office\Office14\URLREDIR.DLL [2010-01-16] (Microsoft Corporation)
      Handler: gopher - {79eac9e4-baf9-11ce-8c82-00aa004ba90b} -  No File
      Handler-x32: skype4com - {FFC8B962-9B40-4DFF-9458-1830C7DD7F5D} - C:\Program Files (x86)\Common Files\Skype\Skype4COM.dll [2017-07-18] (Skype Technologies)
      FF Plugin: @adobe.com/FlashPlayer -> C:\Windows\system32\Macromed\Flash\NPSWF64_24_0_0_221.dll [2017-02-15] ()
      FF Plugin: @java.com/DTPlugin,version=11.45.2 -> C:\Program Files\Java\jre1.8.0_45\bin\dtplugin\npDeployJava1.dll [2015-04-16] (Oracle Corporation)
      FF Plugin: @java.com/JavaPlugin,version=11.45.2 -> C:\Program Files\Java\jre1.8.0_45\bin\plugin2\npjp2.dll [2015-04-16] (Oracle Corporation)
      FF Plugin: @microsoft.com/GENUINE -> disabled [No File]
      FF Plugin: @Microsoft.com/NpCtrl,version=1.0 -> c:\Program Files\Microsoft Silverlight\5.1.50907.0\npctrl.dll [2017-05-04] ( Microsoft Corporation)
      FF Plugin: @microsoft.com/OfficeAuthz,version=14.0 -> C:\PROGRA~1\MICROS~2\Office14\NPAUTHZ.DLL [2010-01-09] (Microsoft Corporation)
      FF Plugin-x32: @adobe.com/FlashPlayer -> C:\Windows\SysWOW64\Macromed\Flash\NPSWF32_24_0_0_221.dll [2017-02-15] ()
      FF Plugin-x32: @intel-webapi.intel.com/Intel WebAPI ipt;version=4.0.5 -> C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\IPT\npIntelWebAPIIPT.dll [2013-12-10] (Intel Corporation)
      FF Plugin-x32: @intel-webapi.intel.com/Intel WebAPI updater -> C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\IPT\npIntelWebAPIUpdater.dll [2013-12-10] (Intel Corporation)
      FF Plugin-x32: @microsoft.com/GENUINE -> disabled [No File]
      FF Plugin-x32: @Microsoft.com/NpCtrl,version=1.0 -> c:\Program Files (x86)\Microsoft Silverlight\5.1.50907.0\npctrl.dll [2017-05-03] ( Microsoft Corporation)
      FF Plugin-x32: @microsoft.com/OfficeAuthz,version=14.0 -> C:\PROGRA~2\MICROS~2\Office14\NPAUTHZ.DLL [2010-01-09] (Microsoft Corporation)
      FF Plugin-x32: @microsoft.com/SharePoint,version=14.0 -> C:\PROGRA~2\MICROS~2\Office14\NPSPWRAP.DLL [2010-01-10] (Microsoft Corporation)
      FF Plugin-x32: @microsoft.com/WLPG,version=16.4.3528.0331 -> C:\Program Files (x86)\Windows Live\Photo Gallery\NPWLPG.dll [2014-03-31] (Microsoft Corporation)
      FF Plugin-x32: @tools.google.com/Google Update;version=3 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [2017-11-13] (Google Inc.)
      FF Plugin-x32: @tools.google.com/Google Update;version=9 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [2017-11-13] (Google Inc.)
      FF Plugin HKU\S-1-5-21-993510031-3225739286-1372905849-1000: @unity3d.com/UnityPlayer,version=1.0 -> C:\Users\Pyrpyl_HP\AppData\LocalLow\Unity\WebPlayer\loader\npUnity3D32.dll [2015-12-07] (Unity Technologies ApS)
      CHR DefaultProfile: Default
      CHR HomePage: Default -> hxxp://ruse-news.com/
      CHR StartupUrls: Default -> "hxxp://ruse-news.com/"
      CHR Profile: C:\Users\Pyrpyl_HP\AppData\Local\Google\Chrome\User Data\Default [2018-04-11]
      CHR Extension: (Документи) - C:\Users\Pyrpyl_HP\AppData\Local\Google\Chrome\User Data\Default\Extensions\aohghmighlieiainnegkcijnfilokake [2017-10-12]
      CHR Extension: (Google Диск) - C:\Users\Pyrpyl_HP\AppData\Local\Google\Chrome\User Data\Default\Extensions\apdfllckaahabafndbhieahigkjlhalf [2015-11-16]
      CHR Extension: (YouTube) - C:\Users\Pyrpyl_HP\AppData\Local\Google\Chrome\User Data\Default\Extensions\blpcfgokakmgnkcojhhkbfbldkacnbeo [2015-11-16]
      CHR Extension: (Adblock Plus) - C:\Users\Pyrpyl_HP\AppData\Local\Google\Chrome\User Data\Default\Extensions\cfhdojbkjhnklbpkdaibdccddilifddb [2018-01-27]
      CHR Extension: (Google Търсене) - C:\Users\Pyrpyl_HP\AppData\Local\Google\Chrome\User Data\Default\Extensions\coobgpohoikkiipiblmjeljniedjpjpf [2015-11-16]
      CHR Extension: (Tampermonkey) - C:\Users\Pyrpyl_HP\AppData\Local\Google\Chrome\User Data\Default\Extensions\dhdgffkkebhmkfjojejmpbldmpobfkfo [2018-01-09]
      CHR Extension: (Електронни таблици от Google) - C:\Users\Pyrpyl_HP\AppData\Local\Google\Chrome\User Data\Default\Extensions\felcaaldnbdncclmgdcncolpebgiejap [2015-11-16]
      CHR Extension: (Google Документи офлайн) - C:\Users\Pyrpyl_HP\AppData\Local\Google\Chrome\User Data\Default\Extensions\ghbmnnjooekpmoecnnnilnnbdlolhkhi [2016-03-15]
      CHR Extension: (Плащания в уеб магазина на Chrome) - C:\Users\Pyrpyl_HP\AppData\Local\Google\Chrome\User Data\Default\Extensions\nmmhkkegccagdldgiimedpiccmgmieda [2018-04-07]
      CHR Extension: (Gmail) - C:\Users\Pyrpyl_HP\AppData\Local\Google\Chrome\User Data\Default\Extensions\pjkljhegncpnkpknbcohdijeoejaedia [2015-11-16]
      CHR Extension: (Chrome Media Router) - C:\Users\Pyrpyl_HP\AppData\Local\Google\Chrome\User Data\Default\Extensions\pkedcjkdefgpdelpbcmbmeomcjbeemfm [2018-03-24]
      CHR HKLM-x32\...\Chrome\Extension: [bcppagjoiockigjlojpeiggninmghfim] - C:\Program Files (x86)\Bigasoft\Video Downloader\extensions\\BVDChromeExt.crx [2015-05-02]
      StartMenuInternet: (HKLM) Opera - G:\Programs\Opera 12.17\Opera.exe hxxp://www.oursurfing.com/?type=sc&ts=1430546455&z=b64b22ea9949ec1e8149b57g7z9cfebwfz1qbz0q1e&from=exp&uid=HGSTXHTS541010A9E680_JDA000CCHDDD2SHDDD2SX
      StartMenuInternet: (HKLM) OperaStable - G:\Programs\Opera\Launcher.exe
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R2 AntiVirFirewallService; C:\Program Files (x86)\Avira\AntiVir Desktop\avfwsvc.exe [1053968 2016-12-15] (Avira Operations GmbH & Co. KG)
      R2 AntiVirMailService; C:\Program Files (x86)\Avira\AntiVir Desktop\avmailc7.exe [871584 2016-12-15] (Avira Operations GmbH & Co. KG)
      R2 AntiVirSchedulerService; C:\Program Files (x86)\Avira\AntiVir Desktop\sched.exe [465832 2016-12-15] (Avira Operations GmbH & Co. KG)
      R2 AntiVirService; C:\Program Files (x86)\Avira\AntiVir Desktop\avguard.exe [465832 2016-12-15] (Avira Operations GmbH & Co. KG)
      R2 AntiVirWebService; C:\Program Files (x86)\Avira\AntiVir Desktop\avwebg7.exe [1047744 2016-12-15] (Avira Operations GmbH & Co. KG)
      R2 BlueSoleilCS; C:\Program Files (x86)\Ralink Corporation\Ralink Bluetooth Stack\BlueSoleilCS.exe [1579880 2013-12-27] (IVT Corporation)
      R3 BsHelpCS; C:\Program Files (x86)\Ralink Corporation\Ralink Bluetooth Stack\BsHelpCS.exe [145656 2013-12-16] (IVT Corporation)
      S3 GenericMount Helper Service; C:\Program Files (x86)\Norton Ghost\Shared\Drivers\GenericMountHelperx64.exe [2227216 2010-02-12] (Symantec)
      R2 hpHotkeyMonitor; C:\Program Files (x86)\Hewlett-Packard\HP Hotkey Support\HPHotkeyMonitor.exe [683296 2014-05-16] (Hewlett-Packard Company)
      R3 hpqwmiex; C:\Program Files (x86)\Hewlett-Packard\Shared\hpqWmiEx.exe [1006424 2013-01-23] (Hewlett-Packard Company) [File not signed]
      R2 IAStorDataMgrSvc; C:\Program Files\Intel\Intel(R) Rapid Storage Technology\IAStorDataMgrSvc.exe [14696 2013-07-30] (Intel Corporation)
      R2 igfxCUIService1.0.0.0; C:\Windows\system32\igfxCUIService.exe [362880 2018-01-24] (Intel Corporation)
      R2 Intel(R) Capability Licensing Service Interface; c:\Program Files\Intel\iCLS Client\HeciServer.exe [747520 2013-08-27] (Intel(R) Corporation) [File not signed]
      S3 Intel(R) Capability Licensing Service TCP IP Interface; c:\Program Files\Intel\iCLS Client\SocketHeciServer.exe [828376 2013-08-27] (Intel(R) Corporation)
      R2 Intel(R) ME Service; C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\FWService\IntelMeFWService.exe [131544 2013-12-10] (Intel Corporation)
      R2 jhi_service; C:\Program Files (x86)\Intel\Intel(R) Management Engine Components\DAL\jhi_service.exe [169432 2013-12-10] (Intel Corporation)
      S3 LiveUpdate; C:\Program Files (x86)\Symantec\LiveUpdate\LuComServer_3_2.EXE [2999664 2007-09-12] (Symantec Corporation)
      R2 Norton Ghost; C:\Program Files (x86)\Norton Ghost\Agent\VProSvc.exe [4590432 2010-03-03] (Symantec Corporation)
      R2 PassThru Service; C:\Program Files (x86)\HTC\Internet Pass-Through\PassThruSvr.exe [166912 2013-10-17] () [File not signed]
      R2 pdfcDispatcher; C:\Program Files (x86)\PDF Complete\pdfsvc.exe [1795136 2018-02-01] (PDF Complete Inc)
      R2 SpyHunter 4 Service; C:\Program Files (x86)\Enigma Software Group\SpyHunter\SH4Service.exe [770432 2014-01-09] (Enigma Software Group USA, LLC.)
      R2 STacSV; C:\Program Files\IDT\WDM\STacSV64.exe [340480 2013-11-07] (IDT, Inc.) [File not signed]
      R3 SymSnapService; C:\Program Files (x86)\Norton Ghost\Shared\Drivers\SymSnapServicex64.exe [2963960 2009-09-21] (Symantec)
      R2 SynTPEnhService; C:\Program Files\Synaptics\SynTP\SynTPEnhService.exe [255584 2017-08-19] (Synaptics Incorporated)
      S3 WinDefend; C:\Program Files\Windows Defender\mpsvc.dll [1011712 2013-05-27] (Microsoft Corporation)
      R2 XperiaCompanionService; C:\Program Files\Sony\Xperia Companion\Service\XperiaCompanionService.exe [2201440 2017-11-09] (Sony)
      S3 Symantec SymSnap VSS Provider; C:\Windows\system32\dllhost.exe /Processid:{7C6B734B-F40D-4C7E-9C4C-95715C0D84F9}
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R0 amdkmpfd; C:\Windows\System32\DRIVERS\amdkmpfd.sys [36608 2013-12-13] (Advanced Micro Devices, Inc.)
      R3 avfwim; C:\Windows\System32\DRIVERS\avfwim.sys [114608 2014-11-24] (Avira GmbH)
      R1 avfwot; C:\Windows\System32\DRIVERS\avfwot.sys [141376 2014-11-24] (Avira GmbH)
      R2 avgntflt; C:\Windows\System32\DRIVERS\avgntflt.sys [167704 2016-12-15] (Avira Operations GmbH & Co. KG)
      R1 avipbb; C:\Windows\System32\DRIVERS\avipbb.sys [139272 2016-12-15] (Avira Operations GmbH & Co. KG)
      R1 avkmgr; C:\Windows\System32\DRIVERS\avkmgr.sys [28600 2014-11-24] (Avira Operations GmbH & Co. KG)
      R2 avnetflt; C:\Windows\System32\DRIVERS\avnetflt.sys [44088 2015-07-27] (Avira Operations GmbH & Co. KG)
      S3 BstkDrv; C:\Program Files (x86)\BlueStacks\BstkDrv.sys [269408 2018-02-21] (Bluestack System Inc. )
      S3 BthL2caScoIfSrv; C:\Windows\System32\Drivers\BtL2caScoIf.sys [54064 2013-04-26] (Ralink Corporation)
      S3 btUrbFilterDrv; C:\Windows\System32\Drivers\IvtUrbBtFlt.sys [50272 2013-12-16] (Ralink Corporation)
      R1 CLVirtualDrive; C:\Windows\System32\DRIVERS\CLVirtualDrive.sys [90608 2011-12-26] (CyberLink)
      S3 esgiguard; C:\Program Files (x86)\Enigma Software Group\SpyHunter\esgiguard.sys [14872 2014-01-07] ()
      S3 EsgScanner; C:\Windows\SysWOW64\DRIVERS\EsgScanner.sys [19984 2012-06-22] ()
      S3 FileDisk; C:\Users\Pyrpyl_HP\AppData\Local\Temp\filedisk.sys [9216 2004-08-09] (Bo Brantén) [File not signed] <==== ATTENTION
      R3 GenericMount; C:\Windows\System32\DRIVERS\GenericMount.sys [66608 2010-02-12] (Symantec Corporation)
      S3 HtcVCom32; C:\Windows\System32\DRIVERS\HtcVComV64.sys [121800 2010-03-08] (QUALCOMM Incorporated)
      R0 iaStorF; C:\Windows\System32\DRIVERS\iaStorF.sys [28008 2013-07-30] (Intel Corporation)
      R3 m76usb; C:\Windows\System32\DRIVERS\m76usb.sys [539848 2014-02-12] (Ralink Technology Corp.)
      R3 MEIx64; C:\Windows\System32\DRIVERS\TeeDriverx64.sys [100312 2013-12-10] (Intel Corporation)
      R3 netr28x; C:\Windows\System32\DRIVERS\netr28x.sys [2473616 2014-12-10] (MediaTek Inc.)
      R2 NPF; C:\Windows\SysWOW64\Drivers\npf64.sys [36600 2016-08-17] (Riverbed Technology, Inc.)
      S3 pwdrvio; C:\Windows\system32\pwdrvio.sys [19912 2009-12-21] ()
      S3 pwdspio; C:\Windows\system32\pwdspio.sys [13264 2009-12-21] ()
      S3 RTSPER; C:\Windows\System32\DRIVERS\RtsPer.sys [476888 2014-03-21] (Realsil Semiconductor Corporation)
      S3 SmbDrvI; C:\Windows\System32\DRIVERS\Smb_driver_Intel.sys [34544 2013-10-25] (Synaptics Incorporated)
      R3 SPUVCbv; C:\Windows\System32\Drivers\SPUVCbv_x64.sys [700128 2015-06-16] (Sunplus)
      R0 symsnap; C:\Windows\System32\DRIVERS\symsnap.sys [170032 2009-09-21] (StorageCraft)
      S3 VProEventMonitor; C:\Windows\System32\DRIVERS\vproeventmonitor.sys [20528 2009-09-21] (Symantec Corporation)
      S3 massfilter; system32\drivers\massfilter.sys [X]
      S3 SliceDisk5; \??\C:\Users\Pyrpyl_HP\AppData\Local\Temp\FindAndMount\slicedisk-x64.sys [X] <==== ATTENTION
      S3 Synth3dVsc; System32\drivers\synth3dvsc.sys [X]
      S3 tsusbhub; system32\drivers\tsusbhub.sys [X]
      U2 V2iMount; no ImagePath
      S3 VGPU; System32\drivers\rdvgkmd.sys [X]
      S3 ZTEusbmdm6k; system32\DRIVERS\ZTEusbmdm6k.sys [X]
      S3 ZTEusbnmea; system32\DRIVERS\ZTEusbnmea.sys [X]
      S3 ZTEusbser6k; system32\DRIVERS\ZTEusbser6k.sys [X]
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-04-11 18:30 - 2018-04-11 18:30 - 000000000 ____D C:\FRST
      2018-04-09 08:57 - 2018-04-09 08:57 - 000000000 ____D C:\iVMS-4200
      2018-04-07 16:43 - 2018-04-07 16:43 - 000000000 ____D C:\Users\Pyrpyl_HP\AppData\Local\cache
      2018-04-07 09:19 - 2018-04-07 09:19 - 000937343 _____ C:\Users\Pyrpyl_HP\Desktop\zzp_jan_2017.pdf
      2018-03-24 19:28 - 2018-03-24 19:28 - 000776380 _____ C:\Users\Pyrpyl_HP\Desktop\rez_240318.pdf
      2018-03-23 07:26 - 2018-04-11 18:05 - 000000000 __SHD C:\Users\Pyrpyl_HP\IntelGraphicsProfiles
      2018-03-23 00:45 - 2018-04-11 18:03 - 000065536 _____ C:\Windows\system32\spu_storage.bin
      2018-03-23 00:11 - 2018-03-23 00:11 - 130364688 ____C (Microsoft Corporation) C:\Windows\system32\MRT-KB890830.exe
      2018-03-23 00:03 - 2017-04-28 01:50 - 003550208 _____ (Microsoft Corporation) C:\Windows\SysWOW64\D3DCompiler_47.dll
      2018-03-23 00:03 - 2017-04-12 16:05 - 004296704 _____ (Microsoft Corporation) C:\Windows\system32\D3DCompiler_47.dll
      2018-03-23 00:00 - 2018-02-14 04:48 - 025739264 _____ (Microsoft Corporation) C:\Windows\system32\mshtml.dll
      2018-03-23 00:00 - 2018-02-14 04:34 - 000004096 _____ (Microsoft Corporation) C:\Windows\system32\ieetwcollectorres.dll
      2018-03-23 00:00 - 2018-02-14 04:21 - 000417280 _____ (Microsoft Corporation) C:\Windows\system32\html.iec
      2018-03-23 00:00 - 2018-02-14 04:21 - 000088064 _____ (Microsoft Corporation) C:\Windows\system32\MshtmlDac.dll
      2018-03-23 00:00 - 2018-02-14 04:21 - 000048640 _____ (Microsoft Corporation) C:\Windows\system32\ieetwproxystub.dll
      2018-03-23 00:00 - 2018-02-14 04:15 - 000054784 _____ (Microsoft Corporation) C:\Windows\system32\jsproxy.dll
      2018-03-23 00:00 - 2018-02-14 04:12 - 000615936 _____ (Microsoft Corporation) C:\Windows\system32\ieui.dll
      2018-03-23 00:00 - 2018-02-14 04:11 - 005780992 _____ (Microsoft Corporation) C:\Windows\system32\jscript9.dll
      2018-03-23 00:00 - 2018-02-14 04:11 - 000116224 _____ (Microsoft Corporation) C:\Windows\system32\ieetwcollector.exe
      2018-03-23 00:00 - 2018-02-14 04:10 - 000814080 _____ (Microsoft Corporation) C:\Windows\system32\jscript9diag.dll
      2018-03-23 00:00 - 2018-02-14 04:05 - 000969216 _____ (Microsoft Corporation) C:\Windows\system32\MsSpellCheckingFacility.exe
      2018-03-23 00:00 - 2018-02-14 03:56 - 000077824 _____ (Microsoft Corporation) C:\Windows\system32\JavaScriptCollectionAgent.dll
      2018-03-23 00:00 - 2018-02-14 03:52 - 000092160 _____ (Microsoft Corporation) C:\Windows\system32\mshtmled.dll
      2018-03-23 00:00 - 2018-02-14 03:38 - 000807936 _____ (Microsoft Corporation) C:\Windows\system32\msfeeds.dll
      2018-03-23 00:00 - 2018-02-14 03:36 - 002134528 _____ (Microsoft Corporation) C:\Windows\system32\inetcpl.cpl
      2018-03-23 00:00 - 2018-02-14 03:36 - 001359360 _____ (Microsoft Corporation) C:\Windows\system32\mshtmlmedia.dll
      2018-03-23 00:00 - 2018-02-14 03:35 - 015283712 _____ (Microsoft Corporation) C:\Windows\system32\ieframe.dll
      2018-03-23 00:00 - 2018-02-14 03:29 - 003241472 _____ (Microsoft Corporation) C:\Windows\system32\wininet.dll
      2018-03-23 00:00 - 2018-02-14 03:26 - 020274176 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mshtml.dll
      2018-03-23 00:00 - 2018-02-14 03:06 - 000499712 _____ (Microsoft Corporation) C:\Windows\SysWOW64\vbscript.dll
      2018-03-23 00:00 - 2018-02-14 03:05 - 000800768 _____ (Microsoft Corporation) C:\Windows\system32\ieapfltr.dll
      2018-03-23 00:00 - 2018-02-14 03:05 - 000341504 _____ (Microsoft Corporation) C:\Windows\SysWOW64\html.iec
      2018-03-23 00:00 - 2018-02-14 03:04 - 000064000 _____ (Microsoft Corporation) C:\Windows\SysWOW64\MshtmlDac.dll
      2018-03-23 00:00 - 2018-02-14 03:00 - 000047104 _____ (Microsoft Corporation) C:\Windows\SysWOW64\jsproxy.dll
      2018-03-23 00:00 - 2018-02-14 02:58 - 000476160 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieui.dll
      2018-03-23 00:00 - 2018-02-14 02:57 - 000662528 _____ (Microsoft Corporation) C:\Windows\SysWOW64\jscript.dll
      2018-03-23 00:00 - 2018-02-14 02:57 - 000620032 _____ (Microsoft Corporation) C:\Windows\SysWOW64\jscript9diag.dll
      2018-03-23 00:00 - 2018-02-14 02:43 - 000076288 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mshtmled.dll
      2018-03-23 00:00 - 2018-02-14 02:42 - 004498944 _____ (Microsoft Corporation) C:\Windows\SysWOW64\jscript9.dll
      2018-03-23 00:00 - 2018-02-14 02:39 - 013680640 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieframe.dll
      2018-03-23 00:00 - 2018-02-14 02:35 - 002058752 _____ (Microsoft Corporation) C:\Windows\SysWOW64\inetcpl.cpl
      2018-03-23 00:00 - 2018-02-14 02:35 - 000694784 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msfeeds.dll
      2018-03-23 00:00 - 2018-02-14 02:34 - 001155072 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mshtmlmedia.dll
      2018-03-23 00:00 - 2018-02-14 02:22 - 002767872 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wininet.dll
      2018-03-23 00:00 - 2018-02-14 02:16 - 000710144 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieapfltr.dll
      2018-03-23 00:00 - 2017-10-12 03:55 - 014635008 _____ (Microsoft Corporation) C:\Windows\system32\wmp.dll
      2018-03-23 00:00 - 2017-10-12 03:37 - 011410944 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wmp.dll
      2018-03-23 00:00 - 2017-05-10 18:29 - 000192512 _____ (Microsoft Corporation) C:\Windows\system32\wuwebv.dll
      2018-03-23 00:00 - 2017-05-10 18:29 - 000098816 _____ (Microsoft Corporation) C:\Windows\system32\wudriver.dll
      2018-03-23 00:00 - 2017-05-10 18:14 - 002651136 _____ (Microsoft Corporation) C:\Windows\system32\wuaueng.dll
      2018-03-23 00:00 - 2017-05-10 18:12 - 000174080 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wuwebv.dll
      2018-03-23 00:00 - 2017-05-10 18:00 - 000093696 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wudriver.dll
      2018-03-23 00:00 - 2017-05-10 18:00 - 000035328 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wuapp.exe
      2018-03-22 23:59 - 2018-02-14 22:48 - 000395928 _____ (Microsoft Corporation) C:\Windows\system32\iedkcs32.dll
      2018-03-22 23:59 - 2018-02-14 21:57 - 000347288 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iedkcs32.dll
      2018-03-22 23:59 - 2018-02-14 04:34 - 002724864 _____ (Microsoft Corporation) C:\Windows\system32\mshtml.tlb
      2018-03-22 23:59 - 2018-02-14 04:23 - 002900480 _____ (Microsoft Corporation) C:\Windows\system32\iertutil.dll
      2018-03-22 23:59 - 2018-02-14 04:22 - 000066560 _____ (Microsoft Corporation) C:\Windows\system32\iesetup.dll
      2018-03-22 23:59 - 2018-02-14 04:21 - 000577536 _____ (Microsoft Corporation) C:\Windows\system32\vbscript.dll
      2018-03-22 23:59 - 2018-02-14 04:14 - 000034304 _____ (Microsoft Corporation) C:\Windows\system32\iernonce.dll
      2018-03-22 23:59 - 2018-02-14 04:11 - 000144384 _____ (Microsoft Corporation) C:\Windows\system32\ieUnatt.exe
      2018-03-22 23:59 - 2018-02-14 04:10 - 000816640 _____ (Microsoft Corporation) C:\Windows\system32\jscript.dll
      2018-03-22 23:59 - 2018-02-14 04:02 - 000489984 _____ (Microsoft Corporation) C:\Windows\system32\dxtmsft.dll
      2018-03-22 23:59 - 2018-02-14 03:56 - 000087552 _____ (Microsoft Corporation) C:\Windows\system32\tdc.ocx
      2018-03-22 23:59 - 2018-02-14 03:55 - 000107520 _____ (Microsoft Corporation) C:\Windows\system32\inseng.dll
      2018-03-22 23:59 - 2018-02-14 03:53 - 000199680 _____ (Microsoft Corporation) C:\Windows\system32\msrating.dll
      2018-03-22 23:59 - 2018-02-14 03:50 - 000315392 _____ (Microsoft Corporation) C:\Windows\system32\dxtrans.dll
      2018-03-22 23:59 - 2018-02-14 03:49 - 000152064 _____ (Microsoft Corporation) C:\Windows\system32\occache.dll
      2018-03-22 23:59 - 2018-02-14 03:40 - 000262144 _____ (Microsoft Corporation) C:\Windows\system32\webcheck.dll
      2018-03-22 23:59 - 2018-02-14 03:38 - 000726528 _____ (Microsoft Corporation) C:\Windows\system32\ie4uinit.exe
      2018-03-22 23:59 - 2018-02-14 03:17 - 001546240 _____ (Microsoft Corporation) C:\Windows\system32\urlmon.dll
      2018-03-22 23:59 - 2018-02-14 03:16 - 002724864 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mshtml.tlb
      2018-03-22 23:59 - 2018-02-14 03:05 - 000062464 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iesetup.dll
      2018-03-22 23:59 - 2018-02-14 03:05 - 000047616 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieetwproxystub.dll
      2018-03-22 23:59 - 2018-02-14 03:02 - 002294272 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iertutil.dll
      2018-03-22 23:59 - 2018-02-14 03:00 - 000030720 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iernonce.dll
      2018-03-22 23:59 - 2018-02-14 02:57 - 000115712 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieUnatt.exe
      2018-03-22 23:59 - 2018-02-14 02:50 - 000416256 _____ (Microsoft Corporation) C:\Windows\SysWOW64\dxtmsft.dll
      2018-03-22 23:59 - 2018-02-14 02:47 - 000060416 _____ (Microsoft Corporation) C:\Windows\SysWOW64\JavaScriptCollectionAgent.dll
      2018-03-22 23:59 - 2018-02-14 02:46 - 000091136 _____ (Microsoft Corporation) C:\Windows\SysWOW64\inseng.dll
      2018-03-22 23:59 - 2018-02-14 02:46 - 000073216 _____ (Microsoft Corporation) C:\Windows\SysWOW64\tdc.ocx
      2018-03-22 23:59 - 2018-02-14 02:44 - 000168960 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msrating.dll
      2018-03-22 23:59 - 2018-02-14 02:43 - 000279040 _____ (Microsoft Corporation) C:\Windows\SysWOW64\dxtrans.dll
      2018-03-22 23:59 - 2018-02-14 02:42 - 000130048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\occache.dll
      2018-03-22 23:59 - 2018-02-14 02:37 - 000230400 _____ (Microsoft Corporation) C:\Windows\SysWOW64\webcheck.dll
      2018-03-22 23:59 - 2018-02-14 02:18 - 001314304 _____ (Microsoft Corporation) C:\Windows\SysWOW64\urlmon.dll
      2018-03-22 23:59 - 2018-01-15 22:59 - 000002048 _____ (Microsoft Corporation) C:\Windows\system32\tzres.dll
      2018-03-22 23:59 - 2018-01-15 22:40 - 000002048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\tzres.dll
      2018-03-22 23:59 - 2018-01-12 19:46 - 000631680 _____ (Microsoft Corporation) C:\Windows\system32\winresume.efi
      2018-03-22 23:59 - 2018-01-12 19:44 - 005581544 _____ (Microsoft Corporation) C:\Windows\system32\ntoskrnl.exe
      2018-03-22 23:59 - 2018-01-12 19:44 - 001894120 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\tcpip.sys
      2018-03-22 23:59 - 2018-01-12 19:44 - 000708328 _____ (Microsoft Corporation) C:\Windows\system32\winload.efi
      2018-03-22 23:59 - 2018-01-12 19:44 - 000377064 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\netio.sys
      2018-03-22 23:59 - 2018-01-12 19:44 - 000371432 _____ (Microsoft Corporation) C:\Windows\system32\clfs.sys
      2018-03-22 23:59 - 2018-01-12 19:44 - 000287976 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\FWPKCLNT.SYS
      2018-03-22 23:59 - 2018-01-12 19:44 - 000262376 _____ (Microsoft Corporation) C:\Windows\system32\hal.dll
      2018-03-22 23:59 - 2018-01-12 19:44 - 000154856 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ksecpkg.sys
      2018-03-22 23:59 - 2018-01-12 19:44 - 000095464 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ksecdd.sys
      2018-03-22 23:59 - 2018-01-12 19:40 - 001460736 _____ (Microsoft Corporation) C:\Windows\system32\lsasrv.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 001212928 _____ (Microsoft Corporation) C:\Windows\system32\rpcrt4.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 001163264 _____ (Microsoft Corporation) C:\Windows\system32\kernel32.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000880640 _____ (Microsoft Corporation) C:\Windows\system32\advapi32.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000731648 _____ (Microsoft Corporation) C:\Windows\system32\kerberos.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000690688 _____ (Microsoft Corporation) C:\Windows\system32\adtschema.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000503808 _____ (Microsoft Corporation) C:\Windows\system32\srcore.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000484864 _____ (Microsoft Corporation) C:\Windows\system32\StructuredQuery.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000463872 _____ (Microsoft Corporation) C:\Windows\system32\certcli.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000419840 _____ (Microsoft Corporation) C:\Windows\system32\KernelBase.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000407040 _____ (Microsoft Corporation) C:\Windows\system32\scesrv.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000361984 _____ (Microsoft Corporation) C:\Windows\system32\wow64win.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000345600 _____ (Microsoft Corporation) C:\Windows\system32\schannel.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000316928 _____ (Microsoft Corporation) C:\Windows\system32\msv1_0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000312320 _____ (Microsoft Corporation) C:\Windows\system32\ncrypt.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000243712 _____ (Microsoft Corporation) C:\Windows\system32\wow64.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000215552 _____ (Microsoft Corporation) C:\Windows\system32\winsrv.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000210432 _____ (Microsoft Corporation) C:\Windows\system32\wdigest.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000190464 _____ (Microsoft Corporation) C:\Windows\system32\rpchttp.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000146432 _____ (Microsoft Corporation) C:\Windows\system32\msaudite.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000135680 _____ (Microsoft Corporation) C:\Windows\system32\sspicli.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000123904 _____ (Microsoft Corporation) C:\Windows\system32\bcrypt.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000086528 _____ (Microsoft Corporation) C:\Windows\system32\TSpkg.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000063488 _____ (Microsoft Corporation) C:\Windows\system32\setbcdlocale.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000060416 _____ (Microsoft Corporation) C:\Windows\system32\msobjs.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000059904 _____ (Microsoft Corporation) C:\Windows\system32\appidapi.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000050176 _____ (Microsoft Corporation) C:\Windows\system32\srclient.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000044032 _____ (Microsoft Corporation) C:\Windows\system32\csrsrv.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000043520 _____ (Microsoft Corporation) C:\Windows\system32\cryptbase.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000034816 _____ (Microsoft Corporation) C:\Windows\system32\appidsvc.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000028672 _____ (Microsoft Corporation) C:\Windows\system32\sspisrv.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000028160 _____ (Microsoft Corporation) C:\Windows\system32\secur32.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000022016 _____ (Microsoft Corporation) C:\Windows\system32\credssp.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000016384 _____ (Microsoft Corporation) C:\Windows\system32\ntvdm64.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000013312 _____ (Microsoft Corporation) C:\Windows\system32\wow64cpu.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000006656 _____ (Microsoft Corporation) C:\Windows\system32\apisetschema.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000006144 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-security-base-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000005120 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-file-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000004608 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-threadpool-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000004608 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-processthreads-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-sysinfo-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-synch-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-localregistry-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-localization-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-rtlsupport-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-processenvironment-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-namedpipe-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-misc-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-memory-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-libraryloader-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-heap-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-xstate-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-util-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-string-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-profile-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-io-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-interlocked-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-handle-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-fibers-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-errorhandling-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-delayload-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-debug-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-datetime-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-console-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:33 - 001665384 _____ (Microsoft Corporation) C:\Windows\system32\ntdll.dll
      2018-03-22 23:59 - 2018-01-12 19:29 - 004014312 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntkrnlpa.exe
      2018-03-22 23:59 - 2018-01-12 19:29 - 003959016 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntoskrnl.exe
      2018-03-22 23:59 - 2018-01-12 19:27 - 004834816 _____ (Microsoft Corporation) C:\Windows\system32\xpsrchvw.exe
      2018-03-22 23:59 - 2018-01-12 19:27 - 001314112 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntdll.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 001114112 _____ (Microsoft Corporation) C:\Windows\SysWOW64\kernel32.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000690688 _____ (Microsoft Corporation) C:\Windows\SysWOW64\adtschema.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000666112 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rpcrt4.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000644096 _____ (Microsoft Corporation) C:\Windows\SysWOW64\advapi32.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000554496 _____ (Microsoft Corporation) C:\Windows\SysWOW64\kerberos.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000363520 _____ (Microsoft Corporation) C:\Windows\SysWOW64\StructuredQuery.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000342528 _____ (Microsoft Corporation) C:\Windows\SysWOW64\certcli.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000308224 _____ (Microsoft Corporation) C:\Windows\SysWOW64\scesrv.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000275456 _____ (Microsoft Corporation) C:\Windows\SysWOW64\KernelBase.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000261120 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msv1_0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000254464 _____ (Microsoft Corporation) C:\Windows\SysWOW64\schannel.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000223232 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ncrypt.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000172032 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wdigest.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000146432 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msaudite.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000141312 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rpchttp.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000096768 _____ (Microsoft Corporation) C:\Windows\SysWOW64\sspicli.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000082944 _____ (Microsoft Corporation) C:\Windows\SysWOW64\bcrypt.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000065536 _____ (Microsoft Corporation) C:\Windows\SysWOW64\TSpkg.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000060416 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msobjs.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000050688 _____ (Microsoft Corporation) C:\Windows\SysWOW64\appidapi.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000043008 _____ (Microsoft Corporation) C:\Windows\SysWOW64\srclient.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000022016 _____ (Microsoft Corporation) C:\Windows\SysWOW64\secur32.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000017408 _____ (Microsoft Corporation) C:\Windows\SysWOW64\credssp.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000006656 _____ (Microsoft Corporation) C:\Windows\SysWOW64\apisetschema.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000005120 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-file-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000005120 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wow32.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000004608 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-processthreads-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-sysinfo-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-synch-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-misc-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-localregistry-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-localization-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-processenvironment-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-namedpipe-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-memory-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-libraryloader-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-interlocked-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-heap-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-string-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-rtlsupport-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-profile-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-io-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-handle-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-fibers-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-errorhandling-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-delayload-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-debug-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-datetime-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:26 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-console-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 19:16 - 003405824 _____ (Microsoft Corporation) C:\Windows\SysWOW64\xpsrchvw.exe
      2018-03-22 23:59 - 2018-01-12 19:16 - 000076288 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\hidclass.sys
      2018-03-22 23:59 - 2018-01-12 19:16 - 000030208 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\hidusb.sys
      2018-03-22 23:59 - 2018-01-12 19:15 - 000032896 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\hidparse.sys
      2018-03-22 23:59 - 2018-01-12 19:11 - 000148480 _____ (Microsoft Corporation) C:\Windows\system32\appidpolicyconverter.exe
      2018-03-22 23:59 - 2018-01-12 19:11 - 000062464 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\appid.sys
      2018-03-22 23:59 - 2018-01-12 19:11 - 000017920 _____ (Microsoft Corporation) C:\Windows\system32\appidcertstorecheck.exe
      2018-03-22 23:59 - 2018-01-12 19:10 - 000064000 _____ (Microsoft Corporation) C:\Windows\system32\auditpol.exe
      2018-03-22 23:59 - 2018-01-12 19:07 - 000338432 _____ (Microsoft Corporation) C:\Windows\system32\conhost.exe
      2018-03-22 23:59 - 2018-01-12 19:06 - 000296960 _____ (Microsoft Corporation) C:\Windows\system32\rstrui.exe
      2018-03-22 23:59 - 2018-01-12 19:03 - 000159744 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mrxsmb.sys
      2018-03-22 23:59 - 2018-01-12 19:02 - 000291328 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mrxsmb10.sys
      2018-03-22 23:59 - 2018-01-12 19:02 - 000129536 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mrxsmb20.sys
      2018-03-22 23:59 - 2018-01-12 19:02 - 000050176 _____ (Microsoft Corporation) C:\Windows\SysWOW64\auditpol.exe
      2018-03-22 23:59 - 2018-01-12 19:01 - 000112640 _____ (Microsoft Corporation) C:\Windows\system32\smss.exe
      2018-03-22 23:59 - 2018-01-12 19:01 - 000030720 _____ (Microsoft Corporation) C:\Windows\system32\lsass.exe
      2018-03-22 23:59 - 2018-01-12 18:57 - 000036352 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cryptbase.dll
      2018-03-22 23:59 - 2018-01-12 18:57 - 000025600 _____ (Microsoft Corporation) C:\Windows\SysWOW64\setup16.exe
      2018-03-22 23:59 - 2018-01-12 18:57 - 000014336 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntvdm64.dll
      2018-03-22 23:59 - 2018-01-12 18:57 - 000007680 _____ (Microsoft Corporation) C:\Windows\SysWOW64\instnm.exe
      2018-03-22 23:59 - 2018-01-12 18:57 - 000002048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\user.exe
      2018-03-22 23:59 - 2018-01-12 18:56 - 000006144 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-security-base-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 18:56 - 000004608 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-threadpool-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 18:56 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-xstate-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-12 18:56 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-util-l1-1-0.dll
      2018-03-22 23:59 - 2018-01-11 19:41 - 001133568 _____ (Microsoft Corporation) C:\Windows\system32\cdosys.dll
      2018-03-22 23:59 - 2018-01-11 19:22 - 000805376 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cdosys.dll
      2018-03-22 23:59 - 2018-01-11 19:09 - 003224064 _____ (Microsoft Corporation) C:\Windows\system32\win32k.sys
      2018-03-22 23:59 - 2018-01-05 19:31 - 000151552 _____ (Microsoft Corporation) C:\Windows\system32\t2embed.dll
      2018-03-22 23:59 - 2018-01-05 19:31 - 000041472 _____ (Microsoft Corporation) C:\Windows\system32\lpk.dll
      2018-03-22 23:59 - 2018-01-05 19:30 - 000100864 _____ (Microsoft Corporation) C:\Windows\system32\fontsub.dll
      2018-03-22 23:59 - 2018-01-05 19:30 - 000046080 _____ (Adobe Systems) C:\Windows\system32\atmlib.dll
      2018-03-22 23:59 - 2018-01-05 19:30 - 000014336 _____ (Microsoft Corporation) C:\Windows\system32\dciman32.dll
      2018-03-22 23:59 - 2018-01-05 19:25 - 000383720 _____ (Adobe Systems Incorporated) C:\Windows\system32\atmfd.dll
      2018-03-22 23:59 - 2018-01-05 19:14 - 000309480 _____ (Adobe Systems Incorporated) C:\Windows\SysWOW64\atmfd.dll
      2018-03-22 23:59 - 2018-01-05 19:11 - 000111104 _____ (Microsoft Corporation) C:\Windows\SysWOW64\t2embed.dll
      2018-03-22 23:59 - 2018-01-05 19:11 - 000071168 _____ (Microsoft Corporation) C:\Windows\SysWOW64\fontsub.dll
      2018-03-22 23:59 - 2018-01-05 19:11 - 000025600 _____ (Microsoft Corporation) C:\Windows\SysWOW64\lpk.dll
      2018-03-22 23:59 - 2018-01-05 19:11 - 000010240 _____ (Microsoft Corporation) C:\Windows\SysWOW64\dciman32.dll
      2018-03-22 23:59 - 2018-01-05 18:50 - 000034304 _____ (Adobe Systems) C:\Windows\SysWOW64\atmlib.dll
      2018-03-22 23:59 - 2018-01-01 05:21 - 001680616 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ntfs.sys
      2018-03-22 23:59 - 2018-01-01 05:21 - 000948968 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ndis.sys
      2018-03-22 23:59 - 2018-01-01 05:21 - 000288488 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\fltMgr.sys
      2018-03-22 23:59 - 2018-01-01 05:21 - 000213736 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\rdyboost.sys
      2018-03-22 23:59 - 2018-01-01 05:21 - 000114408 _____ (Microsoft Corporation) C:\Windows\system32\consent.exe
      2018-03-22 23:59 - 2018-01-01 05:18 - 014183936 _____ (Microsoft Corporation) C:\Windows\system32\shell32.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 002066432 _____ (Microsoft Corporation) C:\Windows\system32\ole32.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 002004480 _____ (Microsoft Corporation) C:\Windows\system32\msxml6.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 001942016 _____ (Microsoft Corporation) C:\Windows\system32\authui.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 001867776 _____ (Microsoft Corporation) C:\Windows\system32\ExplorerFrame.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 001741312 _____ (Microsoft Corporation) C:\Windows\system32\sysmain.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 001361408 _____ (Microsoft Corporation) C:\Windows\system32\PeerDistSvc.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 001110528 _____ (Microsoft Corporation) C:\Windows\system32\schedsvc.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000977408 _____ (Microsoft Corporation) C:\Windows\system32\inetcomm.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000961024 _____ (Microsoft Corporation) C:\Windows\system32\actxprxy.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000863232 _____ (Microsoft Corporation) C:\Windows\system32\IKEEXT.DLL
      2018-03-22 23:59 - 2018-01-01 05:18 - 000842752 _____ (Microsoft Corporation) C:\Windows\system32\nshwfp.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000828928 _____ (Microsoft Corporation) C:\Windows\system32\MPSSVC.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000749568 _____ (Microsoft Corporation) C:\Windows\system32\FirewallAPI.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000705024 _____ (Microsoft Corporation) C:\Windows\system32\BFE.DLL
      2018-03-22 23:59 - 2018-01-01 05:18 - 000512000 _____ (Microsoft Corporation) C:\Windows\system32\rpcss.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000473600 _____ (Microsoft Corporation) C:\Windows\system32\taskcomp.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000444928 _____ (Microsoft Corporation) C:\Windows\system32\winhttp.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000439296 _____ (Microsoft Corporation) C:\Windows\system32\p2psvc.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000366592 _____ (Microsoft Corporation) C:\Windows\system32\wcncsvc.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000327168 _____ (Microsoft Corporation) C:\Windows\system32\pnrpsvc.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000324096 _____ (Microsoft Corporation) C:\Windows\system32\FWPUCLNT.DLL
      2018-03-22 23:59 - 2018-01-01 05:18 - 000303104 _____ (Microsoft Corporation) C:\Windows\system32\nlasvc.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000264704 _____ (Microsoft Corporation) C:\Windows\system32\P2P.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000223232 _____ (Microsoft Corporation) C:\Windows\system32\ncsi.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000181760 _____ (Microsoft Corporation) C:\Windows\system32\PeerDist.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000131584 _____ (Microsoft Corporation) C:\Windows\system32\PeerDistWSDDiscoProv.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000120320 _____ (Microsoft Corporation) C:\Windows\system32\WcnApi.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000108544 _____ (Microsoft Corporation) C:\Windows\system32\icfupgd.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000101376 _____ (Microsoft Corporation) C:\Windows\system32\fdWCN.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000095744 _____ (Microsoft Corporation) C:\Windows\system32\rascfg.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000084480 _____ (Microsoft Corporation) C:\Windows\system32\INETRES.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000076288 _____ (Microsoft Corporation) C:\Windows\system32\rasdiag.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000070656 _____ (Microsoft Corporation) C:\Windows\system32\nlaapi.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000070144 _____ (Microsoft Corporation) C:\Windows\system32\appinfo.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000060928 _____ (Microsoft Corporation) C:\Windows\system32\ndptsp.tsp
      2018-03-22 23:59 - 2018-01-01 05:18 - 000053760 _____ (Microsoft Corporation) C:\Windows\system32\vmicres.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000051200 _____ (Microsoft Corporation) C:\Windows\system32\PeerDistHttpTrans.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000047104 _____ (Microsoft Corporation) C:\Windows\system32\kmddsp.tsp
      2018-03-22 23:59 - 2018-01-01 05:18 - 000041472 _____ (Microsoft Corporation) C:\Windows\system32\rasmxs.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000039424 _____ (Microsoft Corporation) C:\Windows\system32\traffic.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000029696 _____ (Microsoft Corporation) C:\Windows\system32\rasser.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000026112 _____ (Microsoft Corporation) C:\Windows\system32\oleres.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000024576 _____ (Microsoft Corporation) C:\Windows\system32\WcnEapPeerProxy.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000024064 _____ (Microsoft Corporation) C:\Windows\system32\WcnEapAuthProxy.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000022528 _____ (Microsoft Corporation) C:\Windows\system32\wfapigp.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000016896 _____ (Microsoft Corporation) C:\Windows\system32\wshqos.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000013312 _____ (Microsoft Corporation) C:\Windows\system32\wshnetbs.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000008704 _____ (Microsoft Corporation) C:\Windows\system32\comcat.dll
      2018-03-22 23:59 - 2018-01-01 05:18 - 000002048 _____ (Microsoft Corporation) C:\Windows\system32\msxml6r.dll
      2018-03-22 23:59 - 2018-01-01 05:04 - 000559616 _____ (Microsoft Corporation) C:\Windows\system32\spoolsv.exe
      2018-03-22 23:59 - 2018-01-01 05:00 - 012880384 _____ (Microsoft Corporation) C:\Windows\SysWOW64\shell32.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 001499648 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ExplorerFrame.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 001417728 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ole32.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 001390080 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msxml6.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000741888 _____ (Microsoft Corporation) C:\Windows\SysWOW64\inetcomm.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000666624 _____ (Microsoft Corporation) C:\Windows\SysWOW64\nshwfp.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000463360 _____ (Microsoft Corporation) C:\Windows\SysWOW64\FirewallAPI.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000351744 _____ (Microsoft Corporation) C:\Windows\SysWOW64\winhttp.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000304640 _____ (Microsoft Corporation) C:\Windows\SysWOW64\taskcomp.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000276992 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wcncsvc.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000217600 _____ (Microsoft Corporation) C:\Windows\SysWOW64\P2P.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000216576 _____ (Microsoft Corporation) C:\Windows\SysWOW64\FWPUCLNT.DLL
      2018-03-22 23:59 - 2018-01-01 05:00 - 000162304 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ncsi.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000139776 _____ (Microsoft Corporation) C:\Windows\SysWOW64\PeerDist.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000084480 _____ (Microsoft Corporation) C:\Windows\SysWOW64\INETRES.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000081920 _____ (Microsoft Corporation) C:\Windows\SysWOW64\fdWCN.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000081408 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rascfg.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000061952 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rasdiag.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000052224 _____ (Microsoft Corporation) C:\Windows\SysWOW64\nlaapi.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000050688 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ndptsp.tsp
      2018-03-22 23:59 - 2018-01-01 05:00 - 000033280 _____ (Microsoft Corporation) C:\Windows\SysWOW64\traffic.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000026112 _____ (Microsoft Corporation) C:\Windows\SysWOW64\oleres.dll
      2018-03-22 23:59 - 2018-01-01 05:00 - 000002048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msxml6r.dll
      2018-03-22 23:59 - 2018-01-01 04:59 - 001806848 _____ (Microsoft Corporation) C:\Windows\SysWOW64\authui.dll
      2018-03-22 23:59 - 2018-01-01 04:59 - 000309760 _____ (Microsoft Corporation) C:\Windows\SysWOW64\actxprxy.dll
      2018-03-22 23:59 - 2018-01-01 04:55 - 000131584 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\pacer.sys
      2018-03-22 23:59 - 2018-01-01 04:55 - 000088576 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\wanarp.sys
      2018-03-22 23:59 - 2018-01-01 04:55 - 000058368 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ndproxy.sys
      2018-03-22 23:59 - 2018-01-01 04:55 - 000045056 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\netbios.sys
      2018-03-22 23:59 - 2018-01-01 04:55 - 000024064 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ndistapi.sys
      2018-03-22 23:59 - 2018-01-01 04:54 - 000077312 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mpsdrv.sys
      2018-03-22 23:59 - 2018-01-01 04:50 - 000455680 _____ (Microsoft Corporation) C:\Windows\system32\winlogon.exe
      2018-03-22 23:59 - 2018-01-01 04:47 - 000244224 _____ (Microsoft Corporation) C:\Windows\system32\vmicsvc.exe
      2018-03-22 23:59 - 2018-01-01 04:46 - 000128512 _____ (Microsoft Corporation) C:\Windows\system32\IcCoinstall.dll
      2018-03-22 23:59 - 2018-01-01 04:46 - 000051712 _____ (Microsoft Corporation) C:\Windows\system32\vmictimeprovider.dll
      2018-03-22 23:59 - 2018-01-01 04:43 - 000086528 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WcnApi.dll
      2018-03-22 23:59 - 2018-01-01 04:43 - 000038912 _____ (Microsoft Corporation) C:\Windows\SysWOW64\kmddsp.tsp
      2018-03-22 23:59 - 2018-01-01 04:43 - 000033280 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rasmxs.dll
      2018-03-22 23:59 - 2018-01-01 04:43 - 000022528 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rasser.dll
      2018-03-22 23:59 - 2018-01-01 04:43 - 000020480 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WcnEapPeerProxy.dll
      2018-03-22 23:59 - 2018-01-01 04:43 - 000019968 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WcnEapAuthProxy.dll
      2018-03-22 23:59 - 2018-01-01 04:43 - 000018944 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wfapigp.dll
      2018-03-22 23:59 - 2018-01-01 04:43 - 000013824 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wshqos.dll
      2018-03-22 23:59 - 2018-01-01 04:42 - 000460288 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\srv.sys
      2018-03-22 23:59 - 2018-01-01 04:42 - 000406016 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\srv2.sys
      2018-03-22 23:59 - 2018-01-01 04:42 - 000168448 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\srvnet.sys
      2018-03-22 23:59 - 2018-01-01 04:41 - 000754176 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\http.sys
      2018-03-22 23:59 - 2018-01-01 04:41 - 000106496 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\dfsc.sys
      2018-03-22 23:59 - 2018-01-01 04:41 - 000007168 _____ (Microsoft Corporation) C:\Windows\SysWOW64\comcat.dll
      2018-03-22 23:59 - 2017-12-21 09:27 - 000634312 _____ (Microsoft Corporation) C:\Windows\system32\winload.exe
      2018-03-22 23:59 - 2017-12-05 20:36 - 001484288 _____ (Microsoft Corporation) C:\Windows\system32\crypt32.dll
      2018-03-22 23:59 - 2017-12-05 20:36 - 000625664 _____ (Microsoft Corporation) C:\Windows\system32\mscms.dll
      2018-03-22 23:59 - 2017-12-05 20:36 - 000250880 _____ (Microsoft Corporation) C:\Windows\system32\icm32.dll
      2018-03-22 23:59 - 2017-12-05 20:36 - 000229376 _____ (Microsoft Corporation) C:\Windows\system32\wintrust.dll
      2018-03-22 23:59 - 2017-12-05 20:36 - 000218112 _____ (Microsoft Corporation) C:\Windows\system32\WinSCard.dll
      2018-03-22 23:59 - 2017-12-05 20:36 - 000190976 _____ (Microsoft Corporation) C:\Windows\system32\cryptsvc.dll
      2018-03-22 23:59 - 2017-12-05 20:36 - 000141824 _____ (Microsoft Corporation) C:\Windows\system32\cryptnet.dll
      2018-03-22 23:59 - 2017-12-05 20:36 - 000092160 _____ (Microsoft Corporation) C:\Windows\system32\TabSvc.dll
      2018-03-22 23:59 - 2017-12-05 20:36 - 000040960 _____ (Microsoft Corporation) C:\Windows\system32\WcsPlugInService.dll
      2018-03-22 23:59 - 2017-12-05 20:08 - 001176576 _____ (Microsoft Corporation) C:\Windows\SysWOW64\crypt32.dll
      2018-03-22 23:59 - 2017-12-05 20:08 - 000481792 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mscms.dll
      2018-03-22 23:59 - 2017-12-05 20:08 - 000215040 _____ (Microsoft Corporation) C:\Windows\SysWOW64\icm32.dll
      2018-03-22 23:59 - 2017-12-05 20:08 - 000179200 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wintrust.dll
      2018-03-22 23:59 - 2017-12-05 20:08 - 000145920 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cryptsvc.dll
      2018-03-22 23:59 - 2017-12-05 20:08 - 000135168 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WinSCard.dll
      2018-03-22 23:59 - 2017-12-05 20:08 - 000106496 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cryptnet.dll
      2018-03-22 23:59 - 2017-12-05 19:04 - 000404992 _____ (Microsoft Corporation) C:\Windows\system32\wisptis.exe
      2018-03-22 23:59 - 2017-12-05 18:49 - 000032768 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WcsPlugInService.dll
      2018-03-22 23:59 - 2017-11-04 18:31 - 000194048 _____ (Microsoft Corporation) C:\Windows\system32\itircl.dll
      2018-03-22 23:59 - 2017-11-04 18:31 - 000170496 _____ (Microsoft Corporation) C:\Windows\system32\itss.dll
      2018-03-22 23:59 - 2017-11-04 18:10 - 000158720 _____ (Microsoft Corporation) C:\Windows\SysWOW64\itircl.dll
      2018-03-22 23:59 - 2017-11-04 18:10 - 000142336 _____ (Microsoft Corporation) C:\Windows\SysWOW64\itss.dll
      2018-03-22 23:59 - 2017-11-02 19:55 - 000281600 _____ (Microsoft Corporation) C:\Windows\system32\iprtrmgr.dll
      2018-03-22 23:59 - 2017-11-02 19:55 - 000138240 _____ (Microsoft Corporation) C:\Windows\system32\rtm.dll
      2018-03-22 23:59 - 2017-11-02 19:55 - 000097792 _____ (Microsoft Corporation) C:\Windows\system32\mprdim.dll
      2018-03-22 23:59 - 2017-11-02 19:55 - 000009728 _____ (Microsoft Corporation) C:\Windows\system32\iprtprio.dll
      2018-03-22 23:59 - 2017-11-02 18:11 - 000271360 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iprtrmgr.dll
      2018-03-22 23:59 - 2017-11-02 18:11 - 000115200 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rtm.dll
      2018-03-22 23:59 - 2017-11-02 18:11 - 000075264 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mprdim.dll
      2018-03-22 23:59 - 2017-11-02 17:56 - 000008192 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iprtprio.dll
      2018-03-22 23:59 - 2017-10-18 05:06 - 000344064 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbhub.sys
      2018-03-22 23:59 - 2017-10-18 05:06 - 000327168 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbport.sys
      2018-03-22 23:59 - 2017-10-18 05:06 - 000099840 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbccgp.sys
      2018-03-22 23:59 - 2017-10-18 05:06 - 000056320 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbehci.sys
      2018-03-22 23:59 - 2017-10-18 05:06 - 000030720 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbuhci.sys
      2018-03-22 23:59 - 2017-10-18 05:06 - 000025600 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbohci.sys
      2018-03-22 23:59 - 2017-10-18 05:06 - 000007808 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbd.sys
      2018-03-22 23:59 - 2017-10-17 02:04 - 001001984 _____ (Microsoft Corporation) C:\Windows\system32\gpedit.dll
      2018-03-22 23:59 - 2017-10-17 01:46 - 000953344 _____ (Microsoft Corporation) C:\Windows\SysWOW64\gpedit.dll
      2018-03-22 23:59 - 2017-10-17 00:55 - 000339968 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msexcl40.dll
      2018-03-22 23:59 - 2017-10-12 03:55 - 012574720 _____ (Microsoft Corporation) C:\Windows\system32\wmploc.DLL
      2018-03-22 23:59 - 2017-10-12 03:55 - 002319872 _____ (Microsoft Corporation) C:\Windows\system32\tquery.dll
      2018-03-22 23:59 - 2017-10-12 03:55 - 002222080 _____ (Microsoft Corporation) C:\Windows\system32\mssrch.dll
      2018-03-22 23:59 - 2017-10-12 03:55 - 002058240 _____ (Microsoft Corporation) C:\Windows\system32\Query.dll
      2018-03-22 23:59 - 2017-10-12 03:55 - 000778240 _____ (Microsoft Corporation) C:\Windows\system32\mssvp.dll
      2018-03-22 23:59 - 2017-10-12 03:55 - 000491520 _____ (Microsoft Corporation) C:\Windows\system32\mssph.dll
      2018-03-22 23:59 - 2017-10-12 03:55 - 000288256 _____ (Microsoft Corporation) C:\Windows\system32\mssphtb.dll
      2018-03-22 23:59 - 2017-10-12 03:55 - 000115200 _____ (Microsoft Corporation) C:\Windows\system32\mssitlb.dll
      2018-03-22 23:59 - 2017-10-12 03:55 - 000099840 _____ (Microsoft Corporation) C:\Windows\system32\mssprxy.dll
      2018-03-22 23:59 - 2017-10-12 03:55 - 000075264 _____ (Microsoft Corporation) C:\Windows\system32\msscntrs.dll
      2018-03-22 23:59 - 2017-10-12 03:55 - 000014336 _____ (Microsoft Corporation) C:\Windows\system32\msshooks.dll
      2018-03-22 23:59 - 2017-10-12 03:55 - 000009728 _____ (Microsoft Corporation) C:\Windows\system32\spwmp.dll
      2018-03-22 23:59 - 2017-10-12 03:55 - 000005120 _____ (Microsoft Corporation) C:\Windows\system32\msdxm.ocx
      2018-03-22 23:59 - 2017-10-12 03:55 - 000005120 _____ (Microsoft Corporation) C:\Windows\system32\dxmasf.dll
      2018-03-22 23:59 - 2017-10-12 03:39 - 000591872 _____ (Microsoft Corporation) C:\Windows\system32\SearchIndexer.exe
      2018-03-22 23:59 - 2017-10-12 03:38 - 000249856 _____ (Microsoft Corporation) C:\Windows\system32\SearchProtocolHost.exe
      2018-03-22 23:59 - 2017-10-12 03:38 - 000113664 _____ (Microsoft Corporation) C:\Windows\system32\SearchFilterHost.exe
      2018-03-22 23:59 - 2017-10-12 03:37 - 012574208 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wmploc.DLL
      2018-03-22 23:59 - 2017-10-12 03:37 - 001549824 _____ (Microsoft Corporation) C:\Windows\SysWOW64\tquery.dll
      2018-03-22 23:59 - 2017-10-12 03:37 - 001400320 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mssrch.dll
      2018-03-22 23:59 - 2017-10-12 03:37 - 001363968 _____ (Microsoft Corporation) C:\Windows\SysWOW64\Query.dll
      2018-03-22 23:59 - 2017-10-12 03:37 - 000666624 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mssvp.dll
      2018-03-22 23:59 - 2017-10-12 03:37 - 000337408 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mssph.dll
      2018-03-22 23:59 - 2017-10-12 03:37 - 000197120 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mssphtb.dll
      2018-03-22 23:59 - 2017-10-12 03:37 - 000104448 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mssitlb.dll
      2018-03-22 23:59 - 2017-10-12 03:37 - 000059392 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msscntrs.dll
      2018-03-22 23:59 - 2017-10-12 03:37 - 000034816 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mssprxy.dll
      2018-03-22 23:59 - 2017-10-12 03:26 - 000427520 _____ (Microsoft Corporation) C:\Windows\SysWOW64\SearchIndexer.exe
      2018-03-22 23:59 - 2017-10-12 03:26 - 000164352 _____ (Microsoft Corporation) C:\Windows\SysWOW64\SearchProtocolHost.exe
      2018-03-22 23:59 - 2017-10-12 03:25 - 000086528 _____ (Microsoft Corporation) C:\Windows\SysWOW64\SearchFilterHost.exe
      2018-03-22 23:59 - 2017-10-12 03:25 - 000009728 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msshooks.dll
      2018-03-22 23:59 - 2017-10-12 03:24 - 000008192 _____ (Microsoft Corporation) C:\Windows\SysWOW64\spwmp.dll
      2018-03-22 23:59 - 2017-10-12 03:24 - 000004096 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msdxm.ocx
      2018-03-22 23:59 - 2017-10-12 03:24 - 000004096 _____ (Microsoft Corporation) C:\Windows\SysWOW64\dxmasf.dll
      2018-03-22 23:59 - 2017-10-12 03:20 - 000317440 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\rdbss.sys
      2018-03-22 23:59 - 2017-10-12 03:20 - 000113152 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\luafv.sys
      2018-03-22 23:59 - 2017-09-13 18:28 - 001068544 _____ (Microsoft Corporation) C:\Windows\system32\msctf.dll
      2018-03-22 23:59 - 2017-09-13 18:28 - 000886272 _____ (Microsoft Corporation) C:\Windows\system32\wlansvc.dll
      2018-03-22 23:59 - 2017-09-13 18:28 - 000448512 _____ (Microsoft Corporation) C:\Windows\system32\wlansec.dll
      2018-03-22 23:59 - 2017-09-13 18:28 - 000414208 _____ (Microsoft Corporation) C:\Windows\system32\wlanmsm.dll
      2018-03-22 23:59 - 2017-09-13 18:28 - 000118784 _____ (Microsoft Corporation) C:\Windows\system32\wlanhlp.dll
      2018-03-22 23:59 - 2017-09-13 18:28 - 000113664 _____ (Microsoft Corporation) C:\Windows\system32\wlanapi.dll
      2018-03-22 23:59 - 2017-09-13 18:09 - 000830464 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msctf.dll
      2018-03-22 23:59 - 2017-09-13 18:09 - 000428032 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wlanmsm.dll
      2018-03-22 23:59 - 2017-09-13 18:09 - 000392704 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wlansec.dll
      2018-03-22 23:59 - 2017-09-13 18:09 - 000083968 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wlanhlp.dll
      2018-03-22 23:59 - 2017-09-13 18:09 - 000080896 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wlanapi.dll
      2018-03-22 23:59 - 2017-09-13 18:05 - 000324608 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\nwifi.sys
      2018-03-22 23:59 - 2017-09-08 18:30 - 000405504 _____ (Microsoft Corporation) C:\Windows\system32\gdi32.dll
      2018-03-22 23:59 - 2017-09-08 18:10 - 000312832 _____ (Microsoft Corporation) C:\Windows\SysWOW64\gdi32.dll
      2018-03-22 23:59 - 2017-09-08 17:20 - 000640512 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mswstr10.dll
      2018-03-22 23:59 - 2017-09-08 17:20 - 000008704 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msjint40.dll
      2018-03-22 23:59 - 2017-09-07 18:31 - 002851328 _____ (Microsoft Corporation) C:\Windows\system32\themeui.dll
      2018-03-22 23:59 - 2017-09-07 18:12 - 002755072 _____ (Microsoft Corporation) C:\Windows\SysWOW64\themeui.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000995272 _____ (Microsoft Corporation) C:\Windows\system32\ucrtbase.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000922432 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ucrtbase.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000066400 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-private-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000063840 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-private-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000022368 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-math-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000020832 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-math-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000019808 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-multibyte-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000019808 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-multibyte-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000017760 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-string-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000017760 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-stdio-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000017760 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-string-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000017760 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-stdio-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000016224 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-runtime-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000016224 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-runtime-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000015712 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-convert-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000015712 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-convert-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000014176 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-time-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000014176 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-localization-l1-2-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000014176 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-time-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000014176 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-localization-l1-2-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000013664 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-filesystem-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000013664 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-filesystem-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012640 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-process-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012640 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-heap-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012640 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-conio-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012640 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-process-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012640 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-heap-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012640 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-conio-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012128 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-utility-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012128 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-locale-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012128 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-environment-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012128 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-synch-l1-2-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012128 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-processthreads-l1-1-1.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012128 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-utility-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012128 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-locale-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012128 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-environment-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012128 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-synch-l1-2-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000012128 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-processthreads-l1-1-1.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000011616 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-xstate-l2-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000011616 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-timezone-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000011616 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-file-l2-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000011616 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-file-l1-2-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000011616 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-xstate-l2-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000011616 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-timezone-l1-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000011616 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-file-l2-1-0.dll
      2018-03-22 23:59 - 2017-09-07 16:05 - 000011616 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-file-l1-2-0.dll
      2018-03-22 23:59 - 2017-08-19 18:28 - 004121600 _____ (Microsoft Corporation) C:\Windows\system32\mf.dll
      2018-03-22 23:59 - 2017-08-19 18:28 - 000206848 _____ (Microsoft Corporation) C:\Windows\system32\mfps.dll
      2018-03-22 23:59 - 2017-08-19 18:28 - 000197120 _____ (Microsoft Corporation) C:\Windows\system32\shdocvw.dll
      2018-03-22 23:59 - 2017-08-19 18:28 - 000002048 _____ (Microsoft Corporation) C:\Windows\system32\mferror.dll
      2018-03-22 23:59 - 2017-08-19 18:10 - 003209216 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mf.dll
      2018-03-22 23:59 - 2017-08-19 18:10 - 000180224 _____ (Microsoft Corporation) C:\Windows\SysWOW64\shdocvw.dll
      2018-03-22 23:59 - 2017-08-19 18:10 - 000103424 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mfps.dll
      2018-03-22 23:59 - 2017-08-19 18:10 - 000002048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mferror.dll
      2018-03-22 23:59 - 2017-08-19 18:08 - 000055808 _____ (Microsoft Corporation) C:\Windows\system32\rrinstaller.exe
      2018-03-22 23:59 - 2017-08-19 18:08 - 000024576 _____ (Microsoft Corporation) C:\Windows\system32\mfpmp.exe
      2018-03-22 23:59 - 2017-08-19 17:57 - 000050176 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rrinstaller.exe
      2018-03-22 23:59 - 2017-08-19 17:57 - 000023040 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mfpmp.exe
      2018-03-22 23:59 - 2017-08-16 18:29 - 000806912 _____ (Microsoft Corporation) C:\Windows\system32\usp10.dll
      2018-03-22 23:59 - 2017-08-16 18:10 - 000629760 _____ (Microsoft Corporation) C:\Windows\SysWOW64\usp10.dll
      2018-03-22 23:59 - 2017-08-14 20:35 - 003203584 _____ (Microsoft Corporation) C:\Windows\system32\mmcndmgr.dll
      2018-03-22 23:59 - 2017-08-14 20:35 - 002150912 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mmcndmgr.dll
      2018-03-22 23:59 - 2017-08-14 20:35 - 001032192 _____ (Microsoft Corporation) C:\Windows\system32\rdpcore.dll
      2018-03-22 23:59 - 2017-08-14 20:35 - 000827904 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rdpcore.dll
      2018-03-22 23:59 - 2017-08-14 20:35 - 000355328 _____ (Microsoft Corporation) C:\Windows\system32\mmcbase.dll
      2018-03-22 23:59 - 2017-08-14 20:35 - 000303104 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mmcbase.dll
      2018-03-22 23:59 - 2017-08-14 20:35 - 000172544 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cic.dll
      2018-03-22 23:59 - 2017-08-14 20:35 - 000131072 _____ (Microsoft Corporation) C:\Windows\system32\mmcshext.dll
      2018-03-22 23:59 - 2017-08-14 20:35 - 000128512 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mmcshext.dll
      2018-03-22 23:59 - 2017-08-14 20:35 - 000022528 _____ (Microsoft Corporation) C:\Windows\system32\icaapi.dll
      2018-03-22 23:59 - 2017-08-14 20:34 - 000211968 _____ (Microsoft Corporation) C:\Windows\system32\cic.dll
      2018-03-22 23:59 - 2017-08-14 00:45 - 000040448 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\tssecsrv.sys
      2018-03-22 23:59 - 2017-08-14 00:37 - 002144256 _____ (Microsoft Corporation) C:\Windows\system32\mmc.exe
      2018-03-22 23:59 - 2017-08-14 00:30 - 001401344 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mmc.exe
      2018-03-22 23:59 - 2017-08-11 09:35 - 000757248 _____ (Microsoft Corporation) C:\Windows\system32\win32spl.dll
      2018-03-22 23:59 - 2017-08-11 09:35 - 000346112 _____ (Microsoft Corporation) C:\Windows\system32\ntprint.dll
      2018-03-22 23:59 - 2017-08-11 09:35 - 000313856 _____ (Microsoft Corporation) C:\Windows\system32\Wldap32.dll
      2018-03-22 23:59 - 2017-08-11 09:35 - 000026112 _____ (Microsoft Corporation) C:\Windows\system32\nsisvc.dll
      2018-03-22 23:59 - 2017-08-11 09:35 - 000025600 _____ (Microsoft Corporation) C:\Windows\system32\winnsi.dll
      2018-03-22 23:59 - 2017-08-11 09:35 - 000013312 _____ (Microsoft Corporation) C:\Windows\system32\nsi.dll
      2018-03-22 23:59 - 2017-08-11 09:34 - 000971776 _____ (Microsoft Corporation) C:\Windows\system32\localspl.dll
      2018-03-22 23:59 - 2017-08-11 09:34 - 000166400 _____ (Microsoft Corporation) C:\Windows\system32\inetpp.dll
      2018-03-22 23:59 - 2017-08-11 09:34 - 000022528 _____ (Microsoft Corporation) C:\Windows\system32\inetppui.dll
      2018-03-22 23:59 - 2017-08-11 09:20 - 000071680 _____ C:\Windows\system32\PrintBrmUi.exe
      2018-03-22 23:59 - 2017-08-11 09:20 - 000061952 _____ (Microsoft Corporation) C:\Windows\system32\ntprint.exe
      2018-03-22 23:59 - 2017-08-11 09:20 - 000048640 _____ (Microsoft Corporation) C:\Windows\system32\wpnpinst.exe
      2018-03-22 23:59 - 2017-08-11 09:19 - 000497664 _____ (Microsoft Corporation) C:\Windows\SysWOW64\win32spl.dll
      2018-03-22 23:59 - 2017-08-11 09:19 - 000299008 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntprint.dll
      2018-03-22 23:59 - 2017-08-11 09:19 - 000271360 _____ (Microsoft Corporation) C:\Windows\SysWOW64\Wldap32.dll
      2018-03-22 23:59 - 2017-08-11 09:19 - 000016384 _____ (Microsoft Corporation) C:\Windows\SysWOW64\winnsi.dll
      2018-03-22 23:59 - 2017-08-11 09:19 - 000008704 _____ (Microsoft Corporation) C:\Windows\SysWOW64\nsi.dll
      2018-03-22 23:59 - 2017-08-11 09:12 - 000025088 _____ (Microsoft Corporation) C:\Windows\system32\netbtugc.exe
      2018-03-22 23:59 - 2017-08-11 09:09 - 000061952 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntprint.exe
      2018-03-22 23:59 - 2017-08-11 09:03 - 000026624 _____ (Microsoft Corporation) C:\Windows\SysWOW64\netbtugc.exe
      2018-03-22 23:59 - 2017-08-11 09:00 - 000262656 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\netbt.sys
      2018-03-22 23:59 - 2017-08-11 08:58 - 000026112 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\nsiproxy.sys
      2018-03-22 23:59 - 2017-07-29 17:56 - 000117248 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\tdx.sys
      2018-03-22 23:59 - 2017-07-21 17:26 - 000518144 _____ C:\Windows\SysWOW64\msjetoledb40.dll
      2018-03-22 23:59 - 2017-07-21 17:26 - 000409600 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msexch40.dll
      2018-03-22 23:59 - 2017-07-21 17:26 - 000290816 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msjtes40.dll
      2018-03-22 23:59 - 2017-07-21 17:26 - 000282624 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mstext40.dll
      2018-03-22 23:59 - 2017-07-14 18:29 - 000486400 _____ (Microsoft Corporation) C:\Windows\system32\wer.dll
      2018-03-22 23:59 - 2017-07-14 18:29 - 000034304 _____ (Microsoft Corporation) C:\Windows\system32\werdiagcontroller.dll
      2018-03-22 23:59 - 2017-07-14 18:10 - 000382976 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wer.dll
      2018-03-22 23:59 - 2017-07-14 17:57 - 000050688 _____ (Microsoft Corporation) C:\Windows\system32\wermgr.exe
      2018-03-22 23:59 - 2017-07-14 17:50 - 000054272 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wermgr.exe
      2018-03-22 23:59 - 2017-07-14 17:50 - 000028672 _____ (Microsoft Corporation) C:\Windows\SysWOW64\werdiagcontroller.dll
      2018-03-22 23:59 - 2017-07-07 18:33 - 000363752 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\volmgrx.sys
      2018-03-22 23:59 - 2017-07-07 18:29 - 001143296 _____ (Microsoft Corporation) C:\Windows\system32\DXPTaskRingtone.dll
      2018-03-22 23:59 - 2017-07-07 18:10 - 000973312 _____ (Microsoft Corporation) C:\Windows\SysWOW64\DXPTaskRingtone.dll
      2018-03-22 23:59 - 2017-07-06 07:56 - 000119296 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\bthpan.sys
      2018-03-22 23:59 - 2017-07-01 16:05 - 001311744 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msjet40.dll
      2018-03-22 23:59 - 2017-07-01 16:05 - 000866816 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mswdat10.dll
      2018-03-22 23:59 - 2017-07-01 16:05 - 000616448 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msrepl40.dll
      2018-03-22 23:59 - 2017-07-01 16:05 - 000475648 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msxbde40.dll
      2018-03-22 23:59 - 2017-07-01 16:05 - 000375808 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mspbde40.dll
      2018-03-22 23:59 - 2017-07-01 16:05 - 000343552 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msrd3x40.dll
      2018-03-22 23:59 - 2017-07-01 16:05 - 000310272 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msrd2x40.dll
      2018-03-22 23:59 - 2017-07-01 16:05 - 000240640 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msltus40.dll
      2018-03-22 23:59 - 2017-07-01 16:05 - 000083968 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msjter40.dll
      2018-03-22 23:59 - 2017-06-13 01:49 - 001363456 _____ (Microsoft Corporation) C:\Windows\system32\wdc.dll
      2018-03-22 23:59 - 2017-06-13 01:49 - 000594432 _____ (Microsoft Corporation) C:\Windows\system32\wvc.dll
      2018-03-22 23:59 - 2017-06-13 01:49 - 000475136 _____ (Microsoft Corporation) C:\Windows\system32\sysmon.ocx
      2018-03-22 23:59 - 2017-06-13 01:49 - 000058880 _____ (Microsoft Corporation) C:\Windows\system32\pdhui.dll
      2018-03-22 23:59 - 2017-06-13 01:29 - 001227264 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wdc.dll
      2018-03-22 23:59 - 2017-06-13 01:29 - 000444928 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wvc.dll
      2018-03-22 23:59 - 2017-06-13 01:29 - 000390144 _____ (Microsoft Corporation) C:\Windows\SysWOW64\sysmon.ocx
      2018-03-22 23:59 - 2017-06-13 01:28 - 000047104 _____ (Microsoft Corporation) C:\Windows\SysWOW64\pdhui.dll
      2018-03-22 23:59 - 2017-06-13 01:14 - 000379392 _____ (Microsoft Corporation) C:\Windows\system32\msinfo32.exe
      2018-03-22 23:59 - 2017-06-13 01:14 - 000172544 _____ (Microsoft Corporation) C:\Windows\system32\perfmon.exe
      2018-03-22 23:59 - 2017-06-13 01:14 - 000103936 _____ (Microsoft Corporation) C:\Windows\system32\resmon.exe
      2018-03-22 23:59 - 2017-06-13 01:06 - 000303616 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msinfo32.exe
      2018-03-22 23:59 - 2017-06-13 01:06 - 000157184 _____ (Microsoft Corporation) C:\Windows\SysWOW64\perfmon.exe
      2018-03-22 23:59 - 2017-06-13 01:06 - 000103424 _____ (Microsoft Corporation) C:\Windows\SysWOW64\resmon.exe
      2018-03-22 23:59 - 2017-06-02 11:10 - 000733696 _____ (Microsoft Corporation) C:\Windows\HelpPane.exe
      2018-03-22 23:59 - 2017-05-16 18:35 - 000986856 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\dxgkrnl.sys
      2018-03-22 23:59 - 2017-05-16 18:35 - 000265448 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\dxgmms1.sys
      2018-03-22 23:59 - 2017-05-16 18:30 - 000144384 _____ (Microsoft Corporation) C:\Windows\system32\cdd.dll
      2018-03-22 23:59 - 2017-05-12 19:25 - 001251328 _____ (Microsoft Corporation) C:\Windows\SysWOW64\DWrite.dll
      2018-03-22 23:59 - 2017-05-12 18:58 - 001648128 _____ (Microsoft Corporation) C:\Windows\system32\DWrite.dll
      2018-03-22 23:59 - 2017-05-12 18:58 - 001180160 _____ (Microsoft Corporation) C:\Windows\system32\FntCache.dll
      2018-03-22 23:59 - 2017-05-10 18:33 - 000091368 _____ (Microsoft Corporation) C:\Windows\system32\MigAutoPlay.exe
      2018-03-22 23:59 - 2017-05-10 18:29 - 003165184 _____ (Microsoft Corporation) C:\Windows\system32\wucltux.dll
      2018-03-22 23:59 - 2017-05-10 18:28 - 000091136 _____ (Microsoft Corporation) C:\Windows\system32\WinSetupUI.dll
      2018-03-22 23:59 - 2017-05-10 18:16 - 000091368 _____ (Microsoft Corporation) C:\Windows\SysWOW64\MigAutoPlay.exe
      2018-03-22 23:59 - 2017-05-10 18:13 - 000709120 _____ (Microsoft Corporation) C:\Windows\system32\wuapi.dll
      2018-03-22 23:59 - 2017-05-10 18:13 - 000140288 _____ (Microsoft Corporation) C:\Windows\system32\wuauclt.exe
      2018-03-22 23:59 - 2017-05-10 18:13 - 000037888 _____ (Microsoft Corporation) C:\Windows\system32\wups2.dll
      2018-03-22 23:59 - 2017-05-10 18:13 - 000037888 _____ (Microsoft Corporation) C:\Windows\system32\wuapp.exe
      2018-03-22 23:59 - 2017-05-10 18:13 - 000036864 _____ (Microsoft Corporation) C:\Windows\system32\wups.dll
      2018-03-22 23:59 - 2017-05-10 18:13 - 000012288 _____ (Microsoft Corporation) C:\Windows\system32\wu.upgrade.ps.dll
      2018-03-22 23:59 - 2017-05-10 18:00 - 000573440 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wuapi.dll
      2018-03-22 23:59 - 2017-05-10 18:00 - 000030208 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wups.dll
      2018-03-22 23:59 - 2017-05-07 18:33 - 000094440 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mountmgr.sys
      2018-03-22 23:59 - 2017-05-07 18:29 - 000011264 _____ (Microsoft Corporation) C:\Windows\system32\msmmsp.dll
      2018-03-22 23:59 - 2017-03-30 18:03 - 000046080 _____ (Microsoft Corporation) C:\Windows\system32\rundll32.exe
      2018-03-22 23:59 - 2017-03-30 17:58 - 000045056 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rundll32.exe
      2018-03-22 23:56 - 2015-12-16 21:53 - 000007168 _____ (Microsoft Corporation) C:\Windows\system32\kbdgeoqw.dll
      2018-03-22 23:56 - 2015-12-16 21:53 - 000007168 _____ (Microsoft Corporation) C:\Windows\system32\KBDAZEL.DLL
      2018-03-22 23:56 - 2015-12-16 21:53 - 000007168 _____ (Microsoft Corporation) C:\Windows\system32\KBDAZE.DLL
      2018-03-22 23:56 - 2015-12-16 21:48 - 000007168 _____ (Microsoft Corporation) C:\Windows\SysWOW64\KBDAZE.DLL
      2018-03-22 23:56 - 2015-12-16 21:48 - 000006656 _____ (Microsoft Corporation) C:\Windows\SysWOW64\kbdgeoqw.dll
      2018-03-22 23:56 - 2015-12-16 21:48 - 000006656 _____ (Microsoft Corporation) C:\Windows\SysWOW64\KBDAZEL.DLL
      2018-03-22 23:55 - 2016-08-29 18:04 - 003229696 _____ (Microsoft Corporation) C:\Windows\explorer.exe
      2018-03-22 23:55 - 2016-08-29 17:55 - 002972672 _____ (Microsoft Corporation) C:\Windows\SysWOW64\explorer.exe
      2018-03-22 23:47 - 2018-02-13 21:17 - 000136384 _____ (Microsoft Corporation) C:\Windows\system32\CompatTelRunner.exe
      2018-03-22 23:47 - 2018-02-13 21:10 - 000655872 _____ (Microsoft Corporation) C:\Windows\system32\aeinv.dll
      2018-03-22 23:47 - 2018-02-13 17:05 - 001994752 _____ (Microsoft Corporation) C:\Windows\system32\aitstatic.exe
      2018-03-22 23:47 - 2018-02-13 17:05 - 001560064 _____ (Microsoft Corporation) C:\Windows\system32\appraiser.dll
      2018-03-22 23:47 - 2018-02-13 17:05 - 000740864 _____ (Microsoft Corporation) C:\Windows\system32\generaltel.dll
      2018-03-22 23:47 - 2018-02-13 17:05 - 000600576 _____ (Microsoft Corporation) C:\Windows\system32\devinv.dll
      2018-03-22 23:47 - 2018-02-13 17:05 - 000451072 _____ (Microsoft Corporation) C:\Windows\system32\centel.dll
      2018-03-22 23:47 - 2018-02-13 17:05 - 000380928 _____ (Microsoft Corporation) C:\Windows\system32\invagent.dll
      2018-03-22 23:47 - 2018-02-13 17:05 - 000262144 _____ (Microsoft Corporation) C:\Windows\system32\acmigration.dll
      2018-03-22 23:47 - 2018-02-13 17:05 - 000237568 _____ (Microsoft Corporation) C:\Windows\system32\aepic.dll
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-04-11 18:30 - 2015-12-28 23:01 - 000000000 ____D C:\Download
      2018-04-11 18:27 - 2018-01-09 09:39 - 000367616 ___SH C:\Users\Pyrpyl_HP\Desktop\Thumbs.db
      2018-04-11 18:12 - 2009-07-14 07:45 - 000021024 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-1.C7483456-A289-439d-8115-601632D005A0
      2018-04-11 18:12 - 2009-07-14 07:45 - 000021024 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-0.C7483456-A289-439d-8115-601632D005A0
      2018-04-11 18:09 - 2009-07-14 08:13 - 000784286 _____ C:\Windows\system32\PerfStringBackup.INI
      2018-04-11 18:09 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\inf
      2018-04-11 18:05 - 2014-09-21 10:54 - 000000000 ____D C:\ProgramData\PDFC
      2018-04-11 18:04 - 2018-03-04 13:25 - 000000000 ____D C:\Users\Pyrpyl_HP\AppData\Local\Viber
      2018-04-11 18:04 - 2015-12-19 13:15 - 000000482 _____ C:\Windows\Tasks\Wise Memory Optimizer Task.job
      2018-04-11 18:04 - 2015-09-13 18:26 - 000065536 _____ C:\Windows\system32\Ikeext.etl
      2018-04-11 18:04 - 2014-09-20 18:12 - 000000000 ____D C:\Users\Pyrpyl_HP
      2018-04-11 18:04 - 2014-09-20 16:41 - 000000208 _____ C:\Windows\Tasks\AutoKMS.job
      2018-04-11 18:04 - 2013-12-27 18:06 - 000001077 _____ C:\Windows\SysWOW64\bscs.ini
      2018-04-11 18:04 - 2009-07-14 08:08 - 000000006 ____H C:\Windows\Tasks\SA.DAT
      2018-04-11 18:03 - 2017-11-01 07:32 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\iVMS-4200 Station
      2018-04-11 18:03 - 2014-08-20 13:33 - 000000000 ____D C:\Users\Pyrpyl_HP\AppData\Local\bluesoleil
      2018-04-11 18:03 - 2009-07-14 08:09 - 000000000 ____D C:\Windows\System32\Tasks\WPD
      2018-04-11 18:02 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\registration
      2018-04-09 05:49 - 2017-10-29 11:48 - 000000000 ____D C:\Program Files\iVMS-4200 Station
      2018-03-23 20:20 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\rescache
      2018-03-23 07:36 - 2014-12-14 11:55 - 000002222 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Google Chrome.lnk
      2018-03-23 07:26 - 2016-07-09 09:45 - 000000401 _____ C:\Windows\system32\{F33C3B9B-72AF-418A-B3FD-560646F7CDA2}.bat
      2018-03-23 07:26 - 2014-09-20 08:47 - 000000000 ____D C:\Intel
      2018-03-23 07:24 - 2009-07-14 07:45 - 000442096 _____ C:\Windows\system32\FNTCACHE.DAT
      2018-03-23 07:21 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\SysWOW64\Setup
      2018-03-23 07:21 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\SysWOW64\migwiz
      2018-03-23 07:20 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\system32\Setup
      2018-03-23 07:20 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\system32\migwiz
      2018-03-23 07:19 - 2014-12-10 16:38 - 000000000 ____D C:\Windows\system32\appraiser
      2018-03-23 00:46 - 2014-09-20 19:04 - 000768596 _____ C:\Windows\SysWOW64\PerfStringBackup.INI
      2018-03-23 00:38 - 2014-09-20 22:32 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Microsoft Silverlight
      2018-03-23 00:37 - 2014-09-20 22:31 - 000000000 ____D C:\Program Files\Microsoft Silverlight
      2018-03-23 00:37 - 2014-09-20 22:31 - 000000000 ____D C:\Program Files (x86)\Microsoft Silverlight
      2018-03-23 00:37 - 2014-09-20 18:09 - 000000000 ____D C:\Program Files\Intel
      2018-03-23 00:27 - 2014-09-20 19:14 - 000000000 ____D C:\Windows\system32\MRT
      2018-03-23 00:11 - 2014-09-20 19:14 - 130364688 ____C (Microsoft Corporation) C:\Windows\system32\MRT.exe
      2018-03-18 18:21 - 2014-08-20 13:55 - 000000000 ____D C:\Users\Pyrpyl_HP\AppData\Local\Adobe
      2018-03-18 18:20 - 2017-03-17 22:56 - 000004490 _____ C:\Windows\System32\Tasks\Adobe Flash Player PPAPI Notifier
      2018-03-18 18:20 - 2014-08-20 13:55 - 000804352 _____ (Adobe Systems Incorporated) C:\Windows\SysWOW64\FlashPlayerApp.exe
      2018-03-18 18:20 - 2014-08-20 13:55 - 000144896 _____ (Adobe Systems Incorporated) C:\Windows\SysWOW64\FlashPlayerCPLApp.cpl
      2018-03-18 18:20 - 2014-08-20 13:55 - 000000000 ____D C:\Windows\SysWOW64\Macromed
      2018-03-18 18:20 - 2014-08-20 13:55 - 000000000 ____D C:\Windows\system32\Macromed
      2018-03-17 10:01 - 2016-05-07 09:41 - 000000000 ____D C:\Users\Pyrpyl_HP\AppData\Roaming\ViberPC
      ==================== Files in the root of some directories =======
      2017-01-04 22:48 - 2017-01-10 08:07 - 000000146 _____ () C:\Users\Pyrpyl_HP\AppData\Roaming\gamma_ramp.reg
      2014-09-01 11:18 - 2014-09-01 11:18 - 000001248 _____ () C:\Users\Pyrpyl_HP\AppData\Roaming\OZWDNTC
      2014-09-01 11:18 - 2014-09-01 11:18 - 000001248 _____ () C:\Users\Pyrpyl_HP\AppData\Roaming\ZRZYR
      2015-01-18 00:28 - 2015-01-18 00:28 - 000003584 _____ () C:\Users\Pyrpyl_HP\AppData\Local\DCBC2A71-70D8-4DAN-EHR8-E0D61DEA3FDF.ini
      2014-10-17 22:18 - 2014-10-17 22:18 - 001065984 _____ () C:\Users\Pyrpyl_HP\AppData\Local\file__0.localstorage
      2014-12-11 14:08 - 2017-12-15 23:25 - 000007601 _____ () C:\Users\Pyrpyl_HP\AppData\Local\Resmon.ResmonCfg
      2017-03-17 18:54 - 2017-03-26 11:30 - 000000552 _____ () C:\Users\Pyrpyl_HP\AppData\Local\TroubleshooterConfig.json
      2017-01-04 22:48 - 2017-01-04 22:48 - 000017408 _____ () C:\Users\Pyrpyl_HP\AppData\Local\WebpageIcons.db
      2016-06-10 07:30 - 2016-06-10 07:30 - 000000000 _____ () C:\Users\Pyrpyl_HP\AppData\Local\{C101F823-7CF0-464A-9871-F23C7FFC200B}
      Some files in TEMP:
      2017-07-16 17:47 - 2017-07-16 17:47 - 000000000 ____D () C:\Users\Pyrpyl_HP\AppData\Local\Temp\avgnt.exe
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\Windows\system32\winlogon.exe => File is digitally signed
      C:\Windows\system32\wininit.exe => File is digitally signed
      C:\Windows\SysWOW64\wininit.exe => File is digitally signed
      C:\Windows\explorer.exe => File is digitally signed
      C:\Windows\SysWOW64\explorer.exe => File is digitally signed
      C:\Windows\system32\svchost.exe => File is digitally signed
      C:\Windows\SysWOW64\svchost.exe => File is digitally signed
      C:\Windows\system32\services.exe => File is digitally signed
      C:\Windows\system32\User32.dll => File is digitally signed
      C:\Windows\SysWOW64\User32.dll => File is digitally signed
      C:\Windows\system32\userinit.exe => File is digitally signed
      C:\Windows\SysWOW64\userinit.exe => File is digitally signed
      C:\Windows\system32\rpcss.dll => File is digitally signed
      C:\Windows\system32\dnsapi.dll => File is digitally signed
      C:\Windows\SysWOW64\dnsapi.dll => File is digitally signed
      C:\Windows\system32\Drivers\volsnap.sys => File is digitally signed
      LastRegBack: 2018-04-08 00:07
      ==================== End of FRST.txt ============================
    • от мирослав24
      Здравейте,всеки път като стартирам компютъра ми се появява инсталатор и ми пише че ми липсва BPD Software и се налага много пъти да отказвам всеки прозорец който се появи.На това отгоре и принтера ми не печата като му дам задачата,но пък пусна ли му тест страница я печата.На прозореца със задачи на принтера стои надписа-Offline.Деинсталирах софтуера му,инсталирах наново ,но по някаква причина не довърши нацяла инсталацията.Опитах да деинсталирам пак-този път и деиснталатора му не можа да се включи.Третото което забелязах браузъра стана бавен и като има оворени 5-6 страници му трябва около минута на превлюча от едната на другата .Прилагам резултатите от сканиране с FRST:
      Scan result of Farbar Recovery Scan Tool (FRST) (x86) Version: 14.03.2018
      Ran by User1 (administrator) on PC1 (26-03-2018 11:32:15)
      Running from C:\Documents and Settings\User1\Desktop
      Loaded Profiles: User1 (Available Profiles: User1 & User2 & Administrator)
      Platform: Microsoft Windows XP Professional Service Pack 3 (X86) Language: English (United States)
      Internet Explorer Version 8 (Default browser: IE)
      Boot Mode: Normal
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      () C:\WINDOWS\tsnpstd3.exe
      () C:\WINDOWS\vsnpstd3.exe
      () C:\Program Files\Lavasoft\Ad-Aware Antivirus\Ad-Aware Antivirus\11.12.945.9202\AdAwareTray.exe
      (Hewlett-Packard Co.) C:\Program Files\HP\HP Software Update\hpwuSchd2.exe
      (Sun Microsystems, Inc.) C:\Program Files\Common Files\Java\Java Update\jusched.exe
      (Piriform Ltd) C:\Program Files\CCleaner\CCleaner.exe
      (MyCity) C:\Program Files\MCShield\MCShieldRTM.exe
      (Hewlett-Packard Co.) C:\Program Files\HP\Digital Imaging\bin\hpqtra08.exe
      (Cisco Systems, Inc.) C:\Program Files\Cisco Systems\VPN Client\cvpnd.exe
      (Comodo) C:\Program Files\Comodo\Dragon\dragon_updater.exe
      () C:\Program Files\Lavasoft\Ad-Aware Antivirus\Ad-Aware Antivirus\11.12.945.9202\AdAwareService.exe
      (Microsoft Corporation) C:\WINDOWS\system32\wuauclt.exe
      (Hewlett-Packard Co.) C:\Program Files\HP\Digital Imaging\bin\hpqste08.exe
      (Comodo) C:\Program Files\Comodo\Dragon\dragon.exe
      (Comodo) C:\Program Files\Comodo\Dragon\dragon.exe
      (Comodo) C:\Program Files\Comodo\Dragon\dragon.exe
      (Comodo) C:\Program Files\Comodo\Dragon\dragon.exe
      (Comodo) C:\Program Files\Comodo\Dragon\dragon.exe
      (Comodo) C:\Program Files\Comodo\Dragon\dragon.exe
      (Comodo) C:\Program Files\Comodo\Dragon\dragon.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [tsnpstd3] => C:\WINDOWS\tsnpstd3.exe [262144 2006-06-19] ()
      HKLM\...\Run: [snpstd3] => C:\WINDOWS\vsnpstd3.exe [827392 2006-09-19] ()
      HKLM\...\Run: [AdAwareTray] => C:\Program Files\Lavasoft\Ad-Aware Antivirus\Ad-Aware Antivirus\11.12.945.9202\AdAwareTray.exe [8063200 2016-07-18] ()
      HKLM\...\Run: [HP Software Update] => C:\Program Files\HP\HP Software Update\HPWuSchd2.exe [49152 2007-03-11] (Hewlett-Packard Co.)
      HKLM\...\Run: [SunJavaUpdateSched] => C:\Program Files\Common Files\Java\Java Update\jusched.exe [252848 2012-07-03] (Sun Microsystems, Inc.)
      HKU\S-1-5-21-220523388-412668190-1417001333-1003\...\Run: [Messenger (Yahoo!)] => "F:\SKYPE_~1\yahoo\Messenger\YahooMessenger.exe" -quiet
      HKU\S-1-5-21-220523388-412668190-1417001333-1003\...\Run: [uTorrent] => C:\Program Files\uTorrent\uTorrent.exe [395640 2011-05-02] (BitTorrent, Inc.)
      HKU\S-1-5-21-220523388-412668190-1417001333-1003\...\Run: [CCleaner Monitoring] => C:\Program Files\CCleaner\CCleaner.exe [6490904 2015-08-20] (Piriform Ltd)
      HKU\S-1-5-21-220523388-412668190-1417001333-1003\...\Run: [Google Update] => C:\Documents and Settings\User1\Local Settings\Application Data\Google\Update\\GoogleUpdateCore.exe [601680 2017-12-02] (Google Inc.)
      HKU\S-1-5-21-220523388-412668190-1417001333-1003\...\Run: [MCShield Monitor] => C:\Program Files\MCShield\mcshieldrtm.exe [650816 2014-04-11] (MyCity)
      HKU\S-1-5-18\...\RunOnce: [RunNarrator] => C:\WINDOWS\system32\Narrator.exe [53760 2008-04-14] (Microsoft Corporation)
      HKU\S-1-5-18\...\RunOnce: [FlashPlayerUpdate] => C:\WINDOWS\system32\Macromed\Flash\FlashUtil32_27_0_0_187_pepper.exe [1319936 2017-12-08] (Adobe Systems Incorporated)
      Startup: C:\Documents and Settings\All Users\Start Menu\Programs\Startup\HP Digital Imaging Monitor.lnk [2017-09-02]
      ShortcutTarget: HP Digital Imaging Monitor.lnk -> C:\Program Files\HP\Digital Imaging\bin\hpqtra08.exe (Hewlett-Packard Co.)
      Startup: C:\Documents and Settings\All Users\Start Menu\Programs\Startup\VPN Client.lnk [2018-03-26]
      ShortcutTarget: VPN Client.lnk -> C:\WINDOWS\Installer\{B0BF7057-6869-4E4B-920C-EA2A58DA07F0}\Icon3E5562ED7.ico ()
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      Tcpip\Parameters: [DhcpNameServer]
      Tcpip\..\Interfaces\{0227FD86-8C54-4C88-8029-3F44137A8ADF}: [DhcpNameServer]
      Internet Explorer:
      HKU\.DEFAULT\Software\Microsoft\Internet Explorer\Main,Start Page = about:blank
      HKU\S-1-5-21-220523388-412668190-1417001333-1003\Software\Microsoft\Internet Explorer\Main,Start Page = about:blank
      BHO: Java(tm) Plug-In SSV Helper -> {761497BB-D6F0-462C-B6EB-D4DAF1D92D43} -> C:\Program Files\Java\jre1.8.0_152\bin\ssv.dll [2017-12-08] (Oracle Corporation)
      BHO: Java(tm) Plug-In 2 SSV Helper -> {DBC80044-A445-435b-BC74-9C25C1C588A9} -> C:\Program Files\Java\jre1.8.0_152\bin\jp2ssv.dll [2017-12-08] (Oracle Corporation)
      DPF: {8AD9C840-044E-11D1-B3E9-00805F499D93} hxxp://java.sun.com/update/1.7.0/jinstall-1_7_0_09-windows-i586.cab
      FF Plugin: @adobe.com/FlashPlayer -> C:\WINDOWS\system32\Macromed\Flash\NPSWF32_27_0_0_187.dll [2017-12-08] ()
      FF Plugin: @java.com/DTPlugin,version=11.152.2 -> C:\Program Files\Java\jre1.8.0_152\bin\dtplugin\npDeployJava1.dll [2017-12-08] (Oracle Corporation)
      FF Plugin: @java.com/JavaPlugin,version=11.152.2 -> C:\Program Files\Java\jre1.8.0_152\bin\plugin2\npjp2.dll [2017-12-08] (Oracle Corporation)
      FF Plugin: @microsoft.com/WPF,version=3.5 -> C:\WINDOWS\Microsoft.NET\Framework\v3.5\Windows Presentation Foundation\NPWPF.dll [2008-07-29] (Microsoft Corporation)
      FF Plugin: Adobe Reader -> C:\Program Files\Adobe\Reader 11.0\Reader\AIR\nppdf32.dll [2014-08-05] (Adobe Systems Inc.)
      FF Plugin HKU\S-1-5-21-220523388-412668190-1417001333-1003: @talk.google.com/GoogleTalkPlugin -> C:\Documents and Settings\User1\Application Data\Mozilla\plugins\npgoogletalk.dll [2015-12-08] (Google)
      FF Plugin HKU\S-1-5-21-220523388-412668190-1417001333-1003: @talk.google.com/O1DPlugin -> C:\Documents and Settings\User1\Application Data\Mozilla\plugins\npo1d.dll [2015-12-08] (Google)
      FF Plugin HKU\S-1-5-21-220523388-412668190-1417001333-1003: @tools.google.com/Google Update;version=3 -> C:\Documents and Settings\User1\Local Settings\Application Data\Google\Update\\npGoogleUpdate3.dll [2017-12-02] (Google Inc.)
      FF Plugin HKU\S-1-5-21-220523388-412668190-1417001333-1003: @tools.google.com/Google Update;version=9 -> C:\Documents and Settings\User1\Local Settings\Application Data\Google\Update\\npGoogleUpdate3.dll [2017-12-02] (Google Inc.)
      FF Plugin ProgramFiles/Appdata: C:\Documents and Settings\User1\Application Data\mozilla\plugins\npgoogletalk.dll [2015-12-08] (Google)
      FF Plugin ProgramFiles/Appdata: C:\Documents and Settings\User1\Application Data\mozilla\plugins\npo1d.dll [2015-12-08] (Google)
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      S3 AdobeFlashPlayerUpdateSvc; C:\WINDOWS\system32\Macromed\Flash\FlashPlayerUpdateService.exe [272384 2017-12-08] (Adobe Systems Incorporated) [File not signed]
      S2 Browser; C:\WINDOWS\System32\browser.dll [78336 2012-07-06] (Microsoft Corporation) [File not signed]
      R2 CVPND; C:\Program Files\Cisco Systems\VPN Client\cvpnd.exe [1528616 2010-03-23] (Cisco Systems, Inc.)
      R2 DcomLaunch; C:\WINDOWS\system32\rpcss.dll [401408 2009-02-09] (Microsoft Corporation) [File not signed]
      R2 Dnscache; C:\WINDOWS\System32\dnsrslvr.dll [45568 2009-04-20] (Microsoft Corporation) [File not signed]
      R2 DragonUpdater; C:\Program Files\Comodo\Dragon\dragon_updater.exe [2060848 2016-02-05] (Comodo)
      R2 Eventlog; C:\WINDOWS\system32\services.exe [110592 2009-02-06] (Microsoft Corporation) [File not signed]
      R3 EventSystem; C:\WINDOWS\system32\es.dll [253952 2008-07-07] (Microsoft Corporation) [File not signed]
      S3 FastUserSwitchingCompatibility; C:\WINDOWS\System32\shsvcs.dll [135168 2009-07-28] (Microsoft Corporation) [File not signed]
      R3 hpqcxs08; C:\Program Files\HP\Digital Imaging\bin\hpqcxs08.dll [217088 2007-06-04] (Hewlett-Packard Co.) [File not signed]
      R2 hpqddsvc; C:\Program Files\HP\Digital Imaging\bin\hpqddsvc.dll [131072 2007-06-04] (Hewlett-Packard Co.) [File not signed]
      S4 JavaQuickStarterService; C:\Program Files\Java\jre7\bin\jqs.exe [170912 2013-01-12] (Oracle Corporation)
      R2 LanmanServer; C:\WINDOWS\System32\srvsvc.dll [99840 2010-08-27] (Microsoft Corporation) [File not signed]
      R2 lanmanworkstation; C:\WINDOWS\System32\wkssvc.dll [132096 2009-06-10] (Microsoft Corporation) [File not signed]
      R2 LavasoftAdAwareService11; C:\Program Files\Lavasoft\Ad-Aware Antivirus\Ad-Aware Antivirus\11.12.945.9202\AdAwareService.exe [664040 2016-07-18] ()
      S3 MSIServer; C:\WINDOWS\System32\msiexec.exe [95744 2008-05-19] (Microsoft Corporation) [File not signed]
      S3 Net Driver HPZ12; C:\WINDOWS\system32\HPZinw12.dll [43520 2006-11-08] (Hewlett-Packard) [File not signed]
      R3 Nla; C:\WINDOWS\System32\mswsock.dll [245248 2008-06-20] (Microsoft Corporation) [File not signed]
      R2 PlugPlay; C:\WINDOWS\system32\services.exe [110592 2009-02-06] (Microsoft Corporation) [File not signed]
      R3 Pml Driver HPZ12; C:\WINDOWS\system32\HPZipm12.dll [53248 2006-11-08] (Hewlett-Packard) [File not signed]
      R2 RpcSs; C:\WINDOWS\System32\rpcss.dll [401408 2009-02-09] (Microsoft Corporation) [File not signed]
      R2 ShellHWDetection; C:\WINDOWS\System32\shsvcs.dll [135168 2009-07-28] (Microsoft Corporation) [File not signed]
      S2 SkypeUpdate; C:\Program Files\Skype\Updater\Updater.exe [317400 2017-04-05] (Skype Technologies) [File not signed]
      R2 Spooler; C:\WINDOWS\system32\spoolsv.exe [58880 2010-08-17] (Microsoft Corporation) [File not signed]
      R2 Themes; C:\WINDOWS\System32\shsvcs.dll [135168 2009-07-28] (Microsoft Corporation) [File not signed]
      S3 Wmi; C:\WINDOWS\System32\advapi32.dll [617472 2009-02-09] (Microsoft Corporation) [File not signed]
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R1 AFD; C:\WINDOWS\System32\drivers\afd.sys [138496 2011-08-17] (Microsoft Corporation) [File not signed]
      R1 AmdK8; C:\WINDOWS\System32\DRIVERS\AmdK8.sys [36864 2006-06-18] (Advanced Micro Devices)
      S3 CCDECODE; C:\WINDOWS\System32\DRIVERS\CCDECODE.sys [17024 2008-04-14] (Microsoft Corporation)
      S3 CVirtA; C:\WINDOWS\System32\DRIVERS\CVirtA.sys [5275 2007-01-18] (Cisco Systems, Inc.)
      R2 CVPNDRVA; C:\WINDOWS\system32\Drivers\CVPNDRVA.sys [308859 2010-03-23] (Cisco Systems, Inc.) [File not signed]
      R3 DNE; C:\WINDOWS\System32\DRIVERS\dne2000.sys [131984 2008-11-16] (Deterministic Networks, Inc.)
      R3 gzflt; C:\Program Files\Lavasoft\Ad-Aware Antivirus\Antimalware Engine\\gzflt.sys [175008 2016-04-28] (BitDefender LLC)
      R3 HPZid412; C:\WINDOWS\System32\DRIVERS\HPZid412.sys [49920 2007-01-19] (HP)
      R3 HPZipr12; C:\WINDOWS\System32\DRIVERS\HPZipr12.sys [16496 2007-01-19] (HP)
      R3 HPZius12; C:\WINDOWS\System32\DRIVERS\HPZius12.sys [21568 2007-01-19] (HP)
      R3 HTTP; C:\WINDOWS\System32\Drivers\HTTP.sys [265728 2009-10-20] (Microsoft Corporation) [File not signed]
      R3 IntcAzAudAddService; C:\WINDOWS\System32\drivers\RtkHDAud.sys [4368896 2006-08-15] (Realtek Semiconductor Corp.) [File not signed]
      R3 irsir; C:\WINDOWS\System32\DRIVERS\irsir.sys [18688 2001-08-17] (Microsoft Corporation)
      R0 KSecDD; C:\WINDOWS\system32\Drivers\KSecDD.sys [92928 2009-06-24] (Microsoft Corporation) [File not signed]
      R1 MRxSmb; C:\WINDOWS\System32\DRIVERS\mrxsmb.sys [456320 2011-07-15] (Microsoft Corporation) [File not signed]
      R0 Mup; C:\WINDOWS\system32\Drivers\Mup.sys [105472 2011-04-21] (Microsoft Corporation) [File not signed]
      S3 NdisIP; C:\WINDOWS\System32\DRIVERS\NdisIP.sys [10880 2008-04-14] (Microsoft Corporation)
      R3 NdisTapi; C:\WINDOWS\System32\DRIVERS\ndistapi.sys [10496 2011-07-08] (Microsoft Corporation) [File not signed]
      R3 NDProxy; C:\WINDOWS\system32\Drivers\NDProxy.sys [40960 2013-11-27] (Microsoft Corporation) [File not signed]
      R3 NVENETFD; C:\WINDOWS\System32\DRIVERS\NVENETFD.sys [57856 2006-07-11] (NVIDIA Corporation)
      R3 nvnetbus; C:\WINDOWS\System32\DRIVERS\nvnetbus.sys [20480 2006-07-11] (NVIDIA Corporation)
      R3 Rasirda; C:\WINDOWS\System32\DRIVERS\rasirda.sys [19584 2001-08-17] (Microsoft Corporation)
      S3 SNPSTD3; C:\WINDOWS\System32\DRIVERS\snpstd3.sys [10252544 2007-03-27] (Sonix Co. Ltd.)
      R3 Srv; C:\WINDOWS\System32\DRIVERS\srv.sys [357888 2011-02-17] (Microsoft Corporation) [File not signed]
      R1 Tcpip; C:\WINDOWS\System32\DRIVERS\tcpip.sys [361600 2008-06-20] (Microsoft Corporation) [File not signed]
      S3 Trufos; C:\WINDOWS\System32\DRIVERS\Trufos.sys [428832 2016-04-28] (BitDefender S.R.L.)
      S3 usbaudio; C:\WINDOWS\System32\drivers\usbaudio.sys [60160 2013-07-17] (Microsoft Corporation) [File not signed]
      R3 usbccgp; C:\WINDOWS\System32\DRIVERS\usbccgp.sys [32384 2013-08-09] (Microsoft Corporation) [File not signed]
      R3 usbehci; C:\WINDOWS\System32\DRIVERS\usbehci.sys [30336 2009-03-18] (Microsoft Corporation) [File not signed]
      S3 usbscan; C:\WINDOWS\System32\DRIVERS\usbscan.sys [14976 2013-07-03] (Microsoft Corporation) [File not signed]
      S3 vsdatant; C:\WINDOWS\system32\vsdatant.sys [394952 2007-11-14] (Zone Labs, LLC)
      S3 catchme; \??\C:\DOCUME~1\User1\LOCALS~1\Temp\catchme.sys [X]
      S4 IntelIde; no ImagePath
      S2 StarOpen; no ImagePath
      S1 ZAM; \??\C:\WINDOWS\System32\drivers\zam32.sys [X]
      S1 ZAM_Guard; \??\C:\WINDOWS\System32\drivers\zamguard32.sys [X]
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-03-26 11:32 - 2018-03-26 11:32 - 000014199 _____ C:\Documents and Settings\User1\Desktop\FRST.txt
      2018-03-26 11:31 - 2018-03-26 11:32 - 000000000 ____D C:\FRST
      2018-03-26 11:31 - 2018-03-26 11:31 - 001764352 _____ (Farbar) C:\Documents and Settings\User1\Desktop\FRST.exe
      2018-03-24 12:57 - 2018-03-24 12:57 - 000025128 _____ C:\Documents and Settings\User1\Local Settings\Application Data\GDIPFONTCACHEV1.DAT
      2018-03-24 12:49 - 2018-03-26 11:08 - 000002704 _____ C:\WINDOWS\SchedLgU.Txt
      2018-03-24 12:49 - 2018-03-24 12:49 - 000146016 _____ C:\WINDOWS\system32\FNTCACHE.DAT
      2018-03-24 12:46 - 2018-03-24 12:46 - 000000000 ____D C:\SecurityCheck
      2018-03-24 12:46 - 2018-03-24 12:46 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\HP
      2018-03-24 12:46 - 2018-03-24 12:46 - 000000000 ____D C:\Documents and Settings\All Users\Application Data\HP Product Assistant
      2018-03-23 14:34 - 2018-03-23 14:42 - 000155923 _____ C:\WINDOWS\hpwins12.dat
      2018-03-15 13:23 - 2018-03-15 13:23 - 000420352 _____ C:\Documents and Settings\User2\Desktop\ценова листа-март 2018.xls
      2018-03-14 12:57 - 2018-03-16 15:10 - 000059904 _____ C:\Documents and Settings\User2\Desktop\Животни родени 2017 Valta.xls
      2018-03-08 12:19 - 2018-03-08 12:19 - 000163394 _____ C:\Documents and Settings\User2\Desktop\Крушаре милк.htm
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-03-26 11:32 - 2015-07-18 13:46 - 000000000 ____D C:\Documents and Settings\User1\Local Settings\temp
      2018-03-26 11:17 - 2016-02-20 13:25 - 000000000 ____D C:\Documents and Settings\All Users\Application Data\MCShield
      2018-03-26 11:17 - 2015-06-22 14:14 - 000000222 _____ C:\WINDOWS\Tasks\Microsoft Windows XP End of Service Notification Logon.job
      2018-03-26 11:17 - 2014-01-31 13:39 - 000002051 _____ C:\Documents and Settings\All Users\Desktop\Ad-Aware Antivirus.lnk
      2018-03-26 11:17 - 2011-05-02 12:46 - 000000000 ____D C:\Documents and Settings\User1\Application Data\uTorrent
      2018-03-26 11:17 - 2011-05-02 10:20 - 000000006 ____H C:\WINDOWS\Tasks\SA.DAT
      2018-03-26 10:55 - 2013-03-08 15:11 - 000001078 _____ C:\WINDOWS\Tasks\GoogleUpdateTaskUserS-1-5-21-220523388-412668190-1417001333-1003UA.job
      2018-03-26 10:21 - 2015-04-26 09:48 - 000000000 ____D C:\Documents and Settings\User2\Application Data\Skype
      2018-03-26 09:01 - 2011-05-02 13:28 - 000000000 ____D C:\Documents and Settings\User2\Local Settings\Temp
      2018-03-26 08:09 - 2011-05-02 13:03 - 000509828 _____ C:\WINDOWS\system32\PerfStringBackup.INI
      2018-03-26 08:07 - 2001-08-23 12:00 - 000002206 _____ C:\WINDOWS\system32\wpa.dbl
      2018-03-24 13:18 - 2011-05-02 12:10 - 000000178 ___SH C:\Documents and Settings\User1\ntuser.ini
      2018-03-24 12:48 - 2011-09-09 16:58 - 000000000 ____D C:\Documents and Settings\Administrator
      2018-03-24 12:48 - 2011-05-02 13:28 - 000000000 ____D C:\Documents and Settings\User2
      2018-03-24 12:48 - 2011-05-02 12:10 - 000000000 ____D C:\Documents and Settings\User1
      2018-03-24 12:48 - 2011-05-02 10:20 - 000000000 ___SD C:\Documents and Settings\LocalService
      2018-03-24 12:48 - 2011-05-02 10:17 - 000000000 ___SD C:\Documents and Settings\NetworkService
      2018-03-24 12:48 - 2011-05-02 10:09 - 000000000 ____D C:\WINDOWS\Registration
      2018-03-24 12:46 - 2017-09-02 13:00 - 000000000 ____D C:\Documents and Settings\All Users\Application Data\HP
      2018-03-24 12:46 - 2017-09-02 12:58 - 000000000 ____D C:\Program Files\HP
      2018-03-24 12:46 - 2016-02-20 13:29 - 000000000 ____D C:\Documents and Settings\All Users\Start Menu\Programs\Unchecky
      2018-03-24 12:46 - 2011-05-02 12:58 - 000000000 ____D C:\WINDOWS\inf
      2018-03-24 11:48 - 2017-01-16 13:16 - 000000892 _____ C:\WINDOWS\Tasks\Adobe Flash Player PPAPI Notifier.job
      2018-03-24 11:48 - 2011-05-02 10:10 - 000000000 ____D C:\WINDOWS\system32\Macromed
      2018-03-23 13:55 - 2013-03-08 15:11 - 000001026 _____ C:\WINDOWS\Tasks\GoogleUpdateTaskUserS-1-5-21-220523388-412668190-1417001333-1003Core.job
      2018-03-22 16:28 - 2015-06-22 14:14 - 000000216 _____ C:\WINDOWS\Tasks\Microsoft Windows XP End of Service Notification Monthly.job
      ==================== Files in the root of some directories =======
      2011-05-02 13:33 - 2014-09-24 16:20 - 000014848 _____ () C:\Documents and Settings\User1\Local Settings\Application Data\DCBC2A71-70D8-4DAN-EHR8-E0D61DEA3FDF.ini
      2014-01-01 13:07 - 2014-01-01 13:07 - 000000036 _____ () C:\Documents and Settings\User1\Local Settings\Application Data\housecall.guid.cache
      2011-05-15 13:35 - 2011-05-15 13:35 - 000000056 _____ () C:\Documents and Settings\All Users\Application Data\ezsidmv.dat
      2017-09-02 12:57 - 2018-03-26 11:15 - 000006476 _____ () C:\Documents and Settings\All Users\Application Data\hpzinstall.log
      Some files in TEMP:
      2018-03-23 13:51 - 2007-05-22 04:45 - 001140312 ____N (Hewlett-Packard) C:\Documents and Settings\User1\Local Settings\temp\hpzmsi01.exe
      2018-03-23 13:51 - 2007-05-22 04:39 - 001099352 ____N (Hewlett-Packard) C:\Documents and Settings\User1\Local Settings\temp\hpzscr01.exe
      2017-12-20 06:57 - 2017-12-20 06:57 - 001864256 _____ (Oracle Corporation) C:\Documents and Settings\User1\Local Settings\temp\jre-8u161-windows-au.exe
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\WINDOWS\explorer.exe => File is digitally signed
      C:\WINDOWS\system32\winlogon.exe => File is digitally signed
      C:\WINDOWS\system32\svchost.exe => File is digitally signed
      C:\WINDOWS\system32\services.exe => MD5 is legit
      C:\WINDOWS\system32\User32.dll => File is digitally signed
      C:\WINDOWS\system32\userinit.exe => File is digitally signed
      C:\WINDOWS\system32\rpcss.dll => MD5 is legit
      C:\WINDOWS\system32\dnsapi.dll => MD5 is legit
      C:\WINDOWS\system32\Drivers\volsnap.sys => File is digitally signed
      ==================== End of FRST.txt ============================
  • Разглеждащи в момента   0 потребители

    Няма регистрирани потребители разглеждащи тази страница.

  • Дарение



Поставихме бисквитки на устройството ви за най-добро потребителско изживяване. Можете да промените настройките си за бисквитки, или в противен случай приемаме, че сте съгласни с нашите условия за ползване.