Премини към съдържанието

Препоръчан отговор

Здравейте на всички :)

Така, от доста време забелязвам, че компютъра се товари доста, бавно зарежда уиндолса, малко фпс в игри ;/

И реших да направим една проверка .. : )





DDS (Ver_2011-09-30.01) - NTFS_x86 Internet Explorer: 9.10.9200.16686  BrowserJavaVersion: 10.25.2 Run by User at 19:14:52 on 2013-10-07 Microsoft Windows 7 Enterprise 6.1.7601.1.1251.359.1026.18.1917.915 [GMT 3:00] . AV: Microsoft Security Essentials *Disabled/Updated* {641105E6-77ED-3F35-A304-765193BCB75F} SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46} SP: Microsoft Security Essentials *Disabled/Updated* {DF70E402-51D7-30BB-99B4-4D23E83BFDE2} . ============== Running Processes ================ . C:Windowssystem32wininit.exe C:Windowssystem32lsm.exe C:Program FilesMicrosoft Security ClientMsMpEng.exe C:WindowsSystem32spoolsv.exe C:Program FilesApplication UpdaterApplicationUpdater.exe C:PROGRA~1MYWEBS~1bar1.binmwssvc.exe C:Windowssystem32taskhost.exe C:Windowssystem32PnkBstrA.exe D:MCRazer Game BoosterRzKLService.exe C:ProgramDataSkypeToolbarsSkype C2C Servicec2c_service.exe C:Windowssystem32Dwm.exe C:WindowsExplorer.EXE C:Program FilesTeamViewerVersion8TeamViewer_Service.exe C:Program FilesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exe C:WindowsZSSnp211.exe C:Program FilesMicrosoft Security Clientmsseces.exe C:Program FilesAVG Secure Searchvprot.exe C:WindowsSystem32hkcmd.exe C:WindowsSystem32igfxpers.exe C:Program FilesCommon FilesJavaJava Updatejusched.exe C:Program FilesCommon FilesSpigotSearch SettingsSearchSettings.exe D:DownloadsmyНова папкаhamachi-2-ui.exe C:Program FilesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12loggingserver.exe C:Windowssystem32conhost.exe C:Windowssystem32driverssfuservice.exe D:DownloadsmyНова папкаLMIGuardianSvc.exe C:Program FilesCommon FilesMicrosoft SharedWindows LiveWLIDSVC.EXE C:Program FilesCommon FilesMicrosoft SharedWindows LiveWLIDSvcM.exe D:DownloadsmyНова папкаhamachi-2.exe D:DownloadsmyНова папкаLMIGuardianSvc.exe C:Program FilesWindows Sidebarsidebar.exe C:Windowssystem32SearchIndexer.exe C:WindowsMicrosoft.NetFrameworkv3.0WPFPresentationFontCache.exe C:UsersUserAppDataLocalAkamainetsession_win.exe C:UsersUserAppDataLocalAkamainetsession_win.exe C:WindowsSystem32WUDFHost.exe C:Program FilesWindows Media Playerwmpnetwk.exe C:Windowssystem32DllHost.exe C:Program FilesMozilla Firefoxfirefox.exe C:Program FilesMozilla Firefoxplugin-container.exe C:Windowssystem32MacromedFlashFlashPlayerPlugin_11_8_800_168.exe C:Windowssystem32MacromedFlashFlashPlayerPlugin_11_8_800_168.exe C:Windowssystem32wbemwmiprvse.exe C:Windowssystem32vssvc.exe C:Windowssystem32SearchProtocolHost.exe C:Windowssystem32SearchFilterHost.exe C:Windowssystem32conhost.exe C:Windowssystem32svchost.exe -k DcomLaunch C:Windowssystem32svchost.exe -k RPCSS C:WindowsSystem32svchost.exe -k LocalServiceNetworkRestricted C:WindowsSystem32svchost.exe -k LocalSystemNetworkRestricted C:Windowssystem32svchost.exe -k LocalService C:Windowssystem32svchost.exe -k netsvcs C:Windowssystem32svchost.exe -k NetworkService C:Windowssystem32svchost.exe -k LocalServiceNoNetwork C:Windowssystem32svchost.exe -k LocalServiceAndNoImpersonation C:Windowssystem32svchost.exe -k imgsvc C:Windowssystem32svchost.exe -k NetworkServiceNetworkRestricted C:WindowsSystem32svchost.exe -k LocalServicePeerNet C:WindowsSystem32svchost.exe -k swprv . ============== Pseudo HJT Report =============== . uProxyOverride = <local> uURLSearchHooks: YTD Toolbar: {F3FEE66E-E034-436a-86E4-9690573BEE8A} - uURLSearchHooks: {00A6FAF6-072E-44cf-8957-5838F569A31D} - <orphaned> BHO: privitize Helper Object: {1ACB5ABE-4890-4747-952C-F13BDB93FB75} - c:program filesindustriyaprivitize1.8.21.6bhprivitize.dll BHO: Groove GFS Browser Helper: {72853161-30C5-4D22-B7F9-0BBC1D38A37E} - c:program filesmicrosoft officeoffice14GROOVEEX.DLL BHO: Java Plug-In SSV Helper: {761497BB-D6F0-462C-B6EB-D4DAF1D92D43} - c:program filesjavajre7binssv.dll BHO: Windows Live ID Sign-in Helper: {9030D464-4C02-4ABF-8ECC-5164760863C6} - c:program filescommon filesmicrosoft sharedwindows liveWindowsLiveLogin.dll BHO: AVG Security Toolbar: {95B7759C-8C7F-4BF1-B163-73684A933233} - c:program filesavg secure search17.0.1.12AVG Secure Search_toolbar.dll BHO: Skype Browser Helper: {AE805869-2E5C-4ED4-8F7B-F1F7851A4497} - c:program filesskypetoolbarsinternet explorerskypeieplugin.dll BHO: Office Document Cache Handler: {B4F3A835-0E21-4959-BA22-42B3008E02FF} - c:program filesmicrosoft officeoffice14URLREDIR.DLL BHO: Java Plug-In 2 SSV Helper: {DBC80044-A445-435b-BC74-9C25C1C588A9} - c:program filesjavajre7binjp2ssv.dll BHO: YTD Toolbar: {F3FEE66E-E034-436a-86E4-9690573BEE8A} - TB: <No Name>: {E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39} - LocalServer32 - <no file> TB: AVG Security Toolbar: {95B7759C-8C7F-4BF1-B163-73684A933233} - c:program filesavg secure search17.0.1.12AVG Secure Search_toolbar.dll TB: privitize Toolbar: {1C46A0DD-D53E-46C4-A435-CA11103E255E} - c:program filesindustriyaprivitize1.8.21.6privitizeTlbr.dll TB: YTD Toolbar: {F3FEE66E-E034-436a-86E4-9690573BEE8A} - uRun: [DAEMON Tools Lite] "c:program filesdaemon tools liteDTLite.exe" -autorun uRun: [sidebar] c:program fileswindows sidebarsidebar.exe /autoRun uRun: [skype] "c:program filesskypephoneSkype.exe" /minimized /regrun uRun: [Clownfish] "c:program filesclownfishClownfish.exe" uRun: [Akamai NetSession Interface] "c:usersuserappdatalocalakamainetsession_win.exe" mRun: [bCSSync] "c:program filesmicrosoft officeoffice14BCSSync.exe" /DelayServices mRun: [ZSSnp211] c:windowsZSSnp211.exe mRun: [Google Desktop Search] "c:program filesgooglegoogle desktop searchGoogleDesktop.exe" /startup mRun: [MSC] "c:program filesmicrosoft security clientmsseces.exe" -hide -runkey mRun: [vProt] "c:program filesavg secure searchvprot.exe" mRun: [Driver Genius] <no file> mPolicies-System: ConsentPromptBehaviorUser = dword:3 mPolicies-System: EnableUIADesktopToggle = dword:0 IE: Download all by FlashGet3 - c:program filesflashget networkflashget 3GetAllUrl.htm IE: Download by FlashGet3 - c:program filesflashget networkflashget 3GetUrl.htm IE: E&xport to Microsoft Excel - c:progra~1micros~2office14EXCEL.EXE/3000 IE: Free YouTube Download - c:usersuserappdataroamingdvdvideosoftiehelpersfreeytvdownloader.htm IE: Free YouTube to MP3 Converter - c:usersuserappdataroamingdvdvideosoftiehelpersfreeyoutubetomp3converter.htm IE: Se&nd to OneNote - c:progra~1micros~2office14ONBttnIE.dll/105 IE: ????3?? - <no file> IE: ????3?????? - <no file> IE: {2670000A-7350-4f3c-8081-5663EE0C6C49} - {48E73304-E1D6-4330-914C-F5F514E3486C} - c:program filesmicrosoft officeoffice14ONBttnIE.dll IE: {789FE86F-6FC4-46A1-9849-EDE0DB0C95CA} - {FFFDC614-B694-4AE6-AB38-5D6374584B52} - c:program filesmicrosoft officeoffice14ONBttnIELinkedNotes.dll IE: {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - c:program filesskypetoolbarsinternet explorerskypeieplugin.dll Trusted Zone: clonewarsadventures.com Trusted Zone: freerealms.com Trusted Zone: soe.com Trusted Zone: sony.com TCP: NameServer = TCP: Interfaces{2C4E44DB-F385-4EEB-A10C-DCAB6B3D8099} : DHCPNameServer = Filter: text/xml - {807573E5-5146-11D5-A672-00B0D022E945} - c:program filescommon filesmicrosoft sharedoffice14MSOXMLMF.DLL Handler: skype-ie-addon-data - {91774881-D725-4E58-B298-07617B9B86A8} - c:program filesskypetoolbarsinternet explorerskypeieplugin.dll Handler: skype4com - {FFC8B962-9B40-4DFF-9458-1830C7DD7F5D} - c:program filescommon filesskypeSkype4COM.dll Handler: viprotocol - {B658800C-F66E-4EF3-AB85-6C0C227862A9} - c:program filescommon filesavg secure searchviprotocolinstaller17.0.12ViProtocol.dll Handler: wlpg - {E43EF6CD-A37A-4A9B-9E6F-83F89B8E6324} - c:program fileswindows livephoto galleryAlbumDownloadProtocolHandler.dll Notify: igfxcui - igfxdev.dll SSODL: WebCheck - <orphaned> SEH: Groove GFS Stub Execution Hook - {B5A7F190-DDA6-4420-B3BA-52453494E6CD} - c:program filesmicrosoft officeoffice14GROOVEEX.DLL LSA: Security Packages =  kerberos msv1_0 schannel wdigest tspkg pku2u livessp mASetup: {8A69D345-D564-463c-AFF1-A69D9E530F96} - "c:program filesgooglechromeapplication30.0.1599.69installerchrmstp.exe" --configure-user-settings --verbose-logging --system-level --multi-install --chrome . ================= FIREFOX =================== . FF - ProfilePath - c:usersuserappdataroamingmozillafirefoxprofilesptoklpuh.default FF - prefs.js: browser.search.defaulturl - FF - prefs.js: browser.search.selectedEngine - Search The Web (privitize) FF - plugin: c:progra~1micros~2office14NPAUTHZ.DLL FF - plugin: c:progra~1micros~2office14NPSPWRAP.DLL FF - plugin: c:program filescommon filesavg secure searchsitesafetyinstaller17.0.12npsitesafety.dll FF - plugin: c:program filesgooglegoogle earthpluginnpgeplugin.dll FF - plugin: c:program filesgoogleupdate1.3.21.153npGoogleUpdate3.dll FF - plugin: c:program filesjavajre7binplugin2npjp2.dll FF - plugin: c:program filesmicrosoft silverlight5.1.20513.0npctrlui.dll FF - plugin: c:program filesmywebsearchbar1.binNPMYWEBS.DLL FF - plugin: c:program filespando networksmedia boosternpPandoWebPlugin.dll FF - plugin: c:program fileswindows livephoto galleryNPWLPG.dll FF - plugin: c:programdatanexoneungmnpNxGameEU.dll FF - plugin: c:usersuserappdatalocalfacebookvideoskypenpFacebookVideoCalling.dll FF - plugin: c:windowssystem32macromedflashNPSWF32_11_8_800_168.dll FF - plugin: c:windowssystem32npDeployJava1.dll FF - plugin: c:windowssystem32npmproxy.dll . ---- FIREFOX POLICIES ---- FF - user.js: extensions.softonic_i.newTab - false FF - user.js: extensions.softonic_i.id - d65288460000000000002c27d72d77db FF - user.js: extensions.softonic_i.instlDay - 15401 FF - user.js: extensions.softonic_i.vrsn - FF - user.js: extensions.softonic_i.vrsni - FF - user.js: extensions.softonic_i.vrsnTs - FF - user.js: extensions.softonic_i.prtnrId - softonic FF - user.js: extensions.softonic_i.prdct - softonic FF - user.js: extensions.softonic_i.aflt - orgnl FF - user.js: extensions.softonic_i.smplGrp - eng7 FF - user.js: extensions.softonic_i.tlbrId - eng7 FF - user.js: extensions.softonic_i.instlRef - MON00001 FF - user.js: extensions.softonic_i.dfltLng - FF - user.js: extensions.softonic_i.excTlbr - false FF - user.js: extensions.privitize.id - d65288460000000000002c27d72d77db FF - user.js: extensions.privitize.appId - {301966DF-A84B-4255-AAB9-574B5CE237E4} FF - user.js: extensions.privitize.instlDay - 15876 FF - user.js: extensions.privitize.vrsn - FF - user.js: extensions.privitize.vrsni - FF - user.js: extensions.privitize.vrsnTs - FF - user.js: extensions.privitize.prtnrId - privitize FF - user.js: extensions.privitize.prdct - privitize FF - user.js: extensions.privitize.aflt - 5 FF - user.js: extensions.privitize.smplGrp - none FF - user.js: extensions.privitize.tlbrId - base FF - user.js: extensions.privitize.instlRef - FF - user.js: extensions.privitize.dfltLng - FF - user.js: extensions.privitize.excTlbr - false FF - user.js: extensions.privitize.ffxUnstlRst - false FF - user.js: extensions.privitize.admin - false FF - user.js: extensions.privitize.autoRvrt - false FF - user.js: extensions.privitize.rvrt - false FF - user.js: extensions.privitize.hmpg - true FF - user.js: extensions.privitize.dfltSrch - true FF - user.js: extensions.privitize.srchPrvdr - Search The Web (privitize) FF - user.js: extensions.privitize.dnsErr - true FF - user.js: extensions.privitize.newTab - true . ============= SERVICES / DRIVERS =============== . R0 MpFilter;Microsoft Malware Protection Driver;c:windowssystem32driversMpFilter.sys [2013-6-18 211560] R1 avgtp;avgtp;c:windowssystem32driversavgtpx86.sys [2012-7-22 37664] R1 dtsoftbus01;DAEMON Tools Virtual Bus Driver;c:windowssystem32driversdtsoftbus01.sys [2011-8-5 232512] R2 Application Updater;Application Updater;c:program filesapplication updaterApplicationUpdater.exe [2013-9-2 807800] R2 Hamachi2Svc;LogMeIn Hamachi Tunneling Engine;d:downloadsmyнова папкаhamachi-2.exe [2013-10-1 1612112] R2 MyWebSearchService;My Web Search Service;c:progra~1mywebs~1bar1.binmwssvc.exe [2011-9-19 34320] R2 RzKLService;RzKLService;d:mcrazer game boosterRzKLService.exe [2013-9-19 106472] R2 Skype C2C Service;Skype C2C Service;c:programdataskypetoolbarsskype c2c servicec2c_service.exe [2013-9-16 3273088] R2 TeamViewer8;TeamViewer 8;c:program filesteamviewerversion8TeamViewer_Service.exe [2013-8-16 4308320] R2 vToolbarUpdater17.0.12;vToolbarUpdater17.0.12;c:program filescommon filesavg secure searchvtoolbarupdater17.0.12ToolbarUpdater.exe [2013-10-2 1734680] R2 WindowsServices;Windows Debug Service;c:windowssystem32driverssfuservice.exe [2011-7-8 785920] R3 RTL8167;Realtek 8167 NT Driver;c:windowssystem32driversRt86win7.sys [2009-3-2 139776] S2 clr_optimization_v4.0.30319_32;Microsoft .NET Framework NGEN v4.0.30319_X86;c:windowsmicrosoft.netframeworkv4.0.30319mscorsvw.exe [2012-7-9 104912] S2 gupdate;Услуга на Google Актуализация (gupdate);c:program filesgoogleupdateGoogleUpdate.exe [2011-8-16 136176] S2 SkypeUpdate;Skype Updater;c:program filesskypeupdaterUpdater.exe [2013-6-21 162408] S3 AdobeFlashPlayerUpdateSvc;Adobe Flash Player Update Service;c:windowssystem32macromedflashFlashPlayerUpdateService.exe [2012-3-30 257416] S3 b57nd60x;Broadcom NetXtreme Gigabit Ethernet - NDIS 6.0;c:windowssystem32driversb57nd60x.sys [2009-7-14 229888] S3 dmvsc;dmvsc;c:windowssystem32driversdmvsc.sys [2010-11-21 62464] S3 GoogleDesktopManager-051210-111108;Диспечер на Google Desktop 5.9.1005.12335;c:program filesgooglegoogle desktop searchGoogleDesktop.exe [2011-9-10 30192] S3 gupdatem;Услуга на Google Актуализация (gupdatem);c:program filesgoogleupdateGoogleUpdate.exe [2011-8-16 136176] S3 Microsoft SharePoint Workspace Audit Service;Microsoft SharePoint Workspace Audit Service;c:program filesmicrosoft officeoffice14GROOVE.EXE [2012-9-20 30785672] S3 MozillaMaintenance;Mozilla Maintenance Service;c:program filesmozilla maintenance servicemaintenanceservice.exe [2012-7-22 118680] S3 NisDrv;Microsoft Network Inspection System;c:windowssystem32driversNisDrvWFP.sys [2011-4-27 107392] S3 NisSrv;Мрежова проверка на Microsoft;c:program filesmicrosoft security clientNisSrv.exe [2013-6-20 295376] S3 osppsvc;Office Software Protection Platform;c:program filescommon filesmicrosoft sharedofficesoftwareprotectionplatformOSPPSVC.EXE [2010-1-9 4640000] S3 RdpVideoMiniport;Remote Desktop Video Miniport Driver;c:windowssystem32driversrdpvideominiport.sys [2010-11-21 15872] S3 StorSvc;Storage Service;c:windowssystem32svchost.exe -k LocalSystemNetworkRestricted [2009-7-14 20992] S3 Synth3dVsc;Synth3dVsc;c:windowssystem32driversSynth3dVsc.sys [2010-11-21 77184] S3 terminpt;Microsoft Remote Desktop Input Driver;c:windowssystem32driversterminpt.sys [2010-11-21 25600] S3 TsUsbFlt;TsUsbFlt;c:windowssystem32driversTsUsbFlt.sys [2010-11-21 52224] S3 TsUsbGD;Remote Desktop Generic USB Device;c:windowssystem32driversTsUsbGD.sys [2010-11-21 27264] S3 tsusbhub;tsusbhub;c:windowssystem32driverstsusbhub.sys [2010-11-21 112640] S3 vvftav211;vvftav211;c:windowssystem32driversvvftav211.sys [2011-8-27 480128] S3 WatAdminSvc;Услуга на технологиите за активиране на Windows;c:windowssystem32watWatAdminSvc.exe [2011-8-5 1343400] S3 ZSMC30x;USB PC Camera Service ZSMC30x;c:windowssystem32driversZS211.sys [2011-8-27 1537024] . =============== Created Last 30 ================ . 2013-10-06 18:30:38  7328304  ----a-w-  c:programdatamicrosoftmicrosoft antimalwaredefinition updates{8127aff6-5691-460e-853c-9df99258f093}mpengine.dll 2013-10-05 17:39:19  --------  d-----w-  c:usersuserappdataroaming.minecraft 2013-10-05 17:28:55  7328304  ----a-w-  c:programdatamicrosoftmicrosoft antimalwaredefinition updatesbackupmpengine.dll 2013-10-03 10:17:21  --------  d-----w-  c:usersuserappdatalocalLogMeIn 2013-10-03 10:17:21  --------  d-----w-  c:programdataLogMeIn 2013-09-30 17:52:09  --------  d-----w-  c:program filesAcclaim Entertainment 2013-09-30 16:10:23  --------  d-----w-  c:program filesSimilarSites 2013-09-30 16:10:19  --------  d-----w-  c:usersuserappdataroamingSimilarSites 2013-09-11 17:49:49  --------  d-----w-  c:programdataNexon 2013-09-11 17:33:20  --------  d-----w-  c:programdataNexonEU 2013-09-11 16:49:56  --------  d-----w-  c:usersuserappdatalocalAkamai 2013-09-09 17:09:22  --------  d--h--w-  c:program filesTemp . ==================== Find3M  ==================== . 2013-10-02 15:06:23  37664  ----a-w-  c:windowssystem32driversavgtpx86.sys 2013-09-21 18:08:08  692616  ----a-w-  c:windowssystem32FlashPlayerApp.exe 2013-09-21 18:08:07  71048  ----a-w-  c:windowssystem32FlashPlayerCPLApp.cpl 2013-08-10 03:59:10  1767936  ----a-w-  c:windowssystem32wininet.dll 2013-08-10 03:58:09  2876928  ----a-w-  c:windowssystem32jscript9.dll 2013-08-10 03:58:06  61440  ----a-w-  c:windowssystem32iesetup.dll 2013-08-10 03:58:06  109056  ----a-w-  c:windowssystem32iesysprep.dll 2013-08-10 03:07:50  2706432  ----a-w-  c:windowssystem32mshtml.tlb 2013-08-10 02:17:19  71680  ----a-w-  c:windowssystem32RegisterIEPKEYs.exe 2013-08-08 01:03:07  2348544  ----a-w-  c:windowssystem32win32k.sys 2013-08-05 01:56:47  133056  ----a-w-  c:windowssystem32driversataport.sys 2013-08-02 01:50:36  169984  ----a-w-  c:windowssystem32winsrv.dll 2013-08-02 01:49:19  293376  ----a-w-  c:windowssystem32KernelBase.dll 2013-08-02 00:52:57  271360  ----a-w-  c:windowssystem32conhost.exe 2013-08-02 00:43:05  6144  ---ha-w-  c:windowssystem32api-ms-win-security-base-l1-1-0.dll 2013-08-02 00:43:05  4608  ---ha-w-  c:windowssystem32api-ms-win-core-threadpool-l1-1-0.dll 2013-08-02 00:43:05  3584  ---ha-w-  c:windowssystem32api-ms-win-core-xstate-l1-1-0.dll 2013-08-02 00:43:05  3072  ---ha-w-  c:windowssystem32api-ms-win-core-util-l1-1-0.dll 2013-07-25 08:57:27  1620992  ----a-w-  c:windowssystem32WMVDECOD.DLL 2013-07-19 01:41:01  2048  ----a-w-  c:windowssystem32tzres.dll . ============= FINISH: 19:15:00,70 ===============  








. UNLESS SPECIFICALLY INSTRUCTED, DO NOT POST THIS LOG. IF REQUESTED, ZIP IT UP & ATTACH IT . DDS (Ver_2011-09-30.01) . Microsoft Windows 7 Enterprise Boot Device: DeviceHarddiskVolume1 Install Date: 5.8.2011 г. 12:40:24 System Uptime: 7.10.2013 г. 18:14:02 (1 hours ago) . Motherboard: FOXCONN |  | 2A8C Processor: Pentium® Dual-Core  CPU   E5800  @ 3.20GHz | CPU 1 | 3203/800mhz . ==== Disk Partitions ========================= . C: is FIXED (NTFS) - 49 GiB total, 18,056 GiB free. D: is FIXED (NTFS) - 249 GiB total, 163,313 GiB free. E: is CDROM (CDFS) F: is CDROM () G: is Removable H: is CDROM () . ==== Disabled Device Manager Items ============= . ==== System Restore Points =================== . RP452: 6.10.2013 г. 21:30:22 - Windows Update . ==== Installed Programs ====================== .  toolbar   Фотогалерия на Windows Live µTorrent Русификатор Rettungswagen Simulator 2012 4x4 Hummer Ace of Spades Adobe AIR Adobe Download Assistant Adobe Flash Player 11 ActiveX Adobe Flash Player 11 Plugin Akamai NetSession Interface Animated Wallpaper - Snowy Desktop 3D Apple Software Update Bandisoft MPEG-1 Decoder BeamNG-Techdemo-0.3 (remove only) Cabela's 4x4 Off-Road Adventure  2 Call of Juarez Camtasia Studio 8 CCleaner ClipGrab Clownfish for Skype Combat Arms EU Counter-Strike 1.6 Counter-Strike 1.6 Escom 3d!7!0n - by AmaRelle v1.0 Counter-Strike 1.6: New Era Counter-Strike Mega Edition v2.0 Counter-Strike Source, версия 1765266 Craften Terminal 3.3.4897.28268 CSS_Update_from_v1765266_to_v1765266_210513 1.00 D3DX10 DAEMON Tools Lite Dead Space™ Decal Converter Deer Hunter 2004 - Legendary Hunting Definition Update for Microsoft Office 2010 (KB982726) 32-Bit Edition DJ Studio Pro Driver Genius Professional Edition Driver Sweeper version 3.2.0 Dxtory License Cracked Dxtory version 2.0.112 Euro Truck Simulator 2 Facebook Video Calling FIFA 11 FormatFactory 3.0.1 Fraps (remove only) Free Studio version GamersFirst LIVE! German Truck Simulator Google Земя Google Chrome Google Desktop Google Update Helper Grand Theft Auto Vice City GTA San Andreas Hero_Online Iminent IMinent Toolbar Intel Drivers Update Utility Intel® Graphics Media Accelerator Driver ItaEst - Taka e! Java 7 Update 25 Java Auto Updater Java 6 Update 31 JavaFX 2.1.1 K-Lite Codec Pack 7.5.0 (Standard) League of Legends LogMeIn Hamachi Magic The Gathering Tactics MagniPic Malwarebytes Anti-Malware, версия Medal of Honor Microsoft .NET Framework 1.1 Microsoft .NET Framework 4.5 Microsoft Antimalware Service BG-BG Language Pack Microsoft Application Error Reporting Microsoft Games for Windows - LIVE Microsoft Games for Windows - LIVE Redistributable Microsoft Office 2010 Service Pack 1 (SP1) Microsoft Office Access MUI (English) 2010 Microsoft Office Access Setup Metadata MUI (English) 2010 Microsoft Office Excel MUI (English) 2010 Microsoft Office Groove MUI (English) 2010 Microsoft Office InfoPath MUI (English) 2010 Microsoft Office OneNote MUI (English) 2010 Microsoft Office Outlook MUI (English) 2010 Microsoft Office PowerPoint MUI (English) 2010 Microsoft Office Professional Plus 2010 Microsoft Office Proof (English) 2010 Microsoft Office Proof (French) 2010 Microsoft Office Proof (Spanish) 2010 Microsoft Office Proofing (English) 2010 Microsoft Office Publisher MUI (English) 2010 Microsoft Office Shared MUI (English) 2010 Microsoft Office Shared Setup Metadata MUI (English) 2010 Microsoft Office Word MUI (English) 2010 Microsoft Security Client Microsoft Security Client BG-BG Language Pack Microsoft Security Essentials Microsoft Silverlight Microsoft SQL Server 2005 Compact Edition [ENU] Microsoft Visual C++ 2005 Redistributable Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.17 Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.6161 Microsoft XNA Framework Redistributable 4.0 Minecraft Minecraft 1.6.2 Minecraft1.6.2 Mozilla Firefox 24.0 (x86 bg) Mozilla Maintenance Service MSVCRT MSVCRT Redists MSXML 4.0 SP2 (KB954430) MSXML 4.0 SP2 (KB973688) MTA:SA v1.3.1 My Web Search (MyWebFace) Need For Speed™ World Nokia Connectivity Cable Driver NVIDIA PhysX OMSI - Der Omnibussimulator OpenAL Opera 12.14 Pando Media Booster PunkBuster Services Race Driver: GRID Razer Game Booster Realtek High Definition Audio Driver Recuva Revolt Safari Security Update for CAPICOM (KB931906) Security Update for Microsoft .NET Framework 4.5 (KB2737083) Security Update for Microsoft .NET Framework 4.5 (KB2742613) Security Update for Microsoft .NET Framework 4.5 (KB2789648) Security Update for Microsoft .NET Framework 4.5 (KB2804582) Security Update for Microsoft .NET Framework 4.5 (KB2833957) Security Update for Microsoft .NET Framework 4.5 (KB2840642v2) Security Update for Microsoft Excel 2010 (KB2597126) 32-Bit Edition Security Update for Microsoft Filter Pack 2.0 (KB2553501) 32-Bit Edition Security Update for Microsoft InfoPath 2010 (KB2687417) 32-Bit Edition Security Update for Microsoft InfoPath 2010 (KB2687422) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2553091) Security Update for Microsoft Office 2010 (KB2553096) Security Update for Microsoft Office 2010 (KB2553371) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2553447) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2589320) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2598243) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2687501) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2687510) 32-Bit Edition Security Update for Microsoft OneNote 2010 (KB2760600) 32-Bit Edition Security Update for Microsoft Visio 2010 (KB2760762) 32-Bit Edition Security Update for Microsoft Visio Viewer 2010 (KB2687505) 32-Bit Edition Security Update for Microsoft Word 2010 (KB2760410) 32-Bit Edition Skype Click to Call Skype™ 6.6 Speccy Steam System Requirements Lab CYRI System Requirements Lab for Intel TeamViewer 8 TOAoT-315-UTMod-v2 uGet, версия 2.0.6 Update for Microsoft .NET Framework 4.5 (KB2750147) Update for Microsoft .NET Framework 4.5 (KB2805221) Update for Microsoft .NET Framework 4.5 (KB2805226) Update for Microsoft Office 2010 (KB2494150) Update for Microsoft Office 2010 (KB2553065) Update for Microsoft Office 2010 (KB2553092) Update for Microsoft Office 2010 (KB2553181) 32-Bit Edition Update for Microsoft Office 2010 (KB2553267) 32-Bit Edition Update for Microsoft Office 2010 (KB2553310) 32-Bit Edition Update for Microsoft Office 2010 (KB2553378) 32-Bit Edition Update for Microsoft Office 2010 (KB2566458) Update for Microsoft Office 2010 (KB2596964) 32-Bit Edition Update for Microsoft Office 2010 (KB2598242) 32-Bit Edition Update for Microsoft Office 2010 (KB2687503) 32-Bit Edition Update for Microsoft Office 2010 (KB2687509) 32-Bit Edition Update for Microsoft Office 2010 (KB2760631) 32-Bit Edition Update for Microsoft Office 2010 (KB2767886) 32-Bit Edition Update for Microsoft OneNote 2010 (KB2553290) 32-Bit Edition Update for Microsoft Outlook 2010 (KB2597090) 32-Bit Edition Update for Microsoft Outlook 2010 (KB2687623) 32-Bit Edition Update for Microsoft Outlook Social Connector 2010 (KB2553406) 32-Bit Edition Update for Microsoft PowerPoint 2010 (KB2553145) 32-Bit Edition Update for Microsoft PowerPoint 2010 (KB2598240) 32-Bit Edition Update for Microsoft SharePoint Workspace 2010 (KB2589371) 32-Bit Edition Vegas Pro 10.0 Vegas Pro 11.0 VirtualDJ Home FREE Windows Live Communications Platform Windows Live Essentials Windows Live ID Sign-in Assistant Windows Live Installer Windows Live Movie Maker Windows Live Photo Common Windows Live Photo Gallery Windows Live PIMT Platform Windows Live SOXE Windows Live SOXE Definitions Windows Live UX Platform Windows Live UX Platform Language Pack WinRAR 4.01 (32-bit) WolfQuest World of Warcraft Trial YTD Toolbar v7.6 ZSMC USB PC Camera (ZS0211) . ==== Event Viewer Messages From Past Week ======== . 7.10.2013 г. 18:14:19, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 7.10.2013 г. 15:48:24, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 7.10.2013 г. 15:48:24, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 7.10.2013 г. 14:00:17, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 21:19:09, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 17:01:23, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 14:51:05, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 6.10.2013 г. 14:51:05, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 6.10.2013 г. 14:18:05, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 02:02:15, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 6.10.2013 г. 02:02:15, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 5.10.2013 г. 21:55:16, Error: volsnap [36]  - The shadow copies of volume C: were aborted because the shadow copy storage could not grow due to a user imposed limit. 5.10.2013 г. 21:29:31, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 5.10.2013 г. 20:07:11, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 5.10.2013 г. 20:07:11, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 5.10.2013 г. 18:58:06, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 5.10.2013 г. 14:12:14, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 5.10.2013 г. 12:45:09, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 4.10.2013 г. 22:51:38, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 4.10.2013 г. 19:20:14, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 4.10.2013 г. 19:20:14, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 4.10.2013 г. 17:06:51, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 4.10.2013 г. 17:06:51, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 4.10.2013 г. 16:37:10, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 4.10.2013 г. 16:37:09, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 4.10.2013 г. 15:27:47, Error: bowser [8003]  - The master browser has received a server announcement from the computer SKIOOOO-PC that believes that it is the master browser for the domain on transport NetBT_Tcpip_{86D84905-0331-4FB8-A5E0-AAB038C. The master browser is stopping or an election is being forced. 4.10.2013 г. 13:20:44, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 30.9.2013 г. 21:07:08, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 21:07:08, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 20:14:39, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 20:14:39, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 20:11:32, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 30.9.2013 г. 18:28:52, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 18:28:52, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 18:01:50, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 30.9.2013 г. 15:08:31, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 15:08:31, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 14:46:07, Error: bowser [8003]  - The master browser has received a server announcement from the computer SKIOOOO-PC that believes that it is the master browser for the domain on transport NetBT_Tcpip_{86D84905-0331-4FB8-A5E0-AAB038C. The master browser is stopping or an election is being forced. 30.9.2013 г. 14:43:25, Error: volsnap [36]  - The shadow copies of volume C: were aborted because the shadow copy storage could not grow due to a user imposed limit. 30.9.2013 г. 13:51:20, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 3.10.2013 г. 19:57:52, Error: bowser [8003]  - The master browser has received a server announcement from the computer SKIOOOO-PC that believes that it is the master browser for the domain on transport NetBT_Tcpip_{86D84905-0331-4FB8-A5E0-AAB038C. The master browser is stopping or an election is being forced. 3.10.2013 г. 15:14:42, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 3.10.2013 г. 15:14:42, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 3.10.2013 г. 14:56:51, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 3.10.2013 г. 14:56:51, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 3.10.2013 г. 14:18:33, Error: volsnap [36]  - The shadow copies of volume C: were aborted because the shadow copy storage could not grow due to a user imposed limit. 3.10.2013 г. 13:16:54, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 2.10.2013 г. 19:41:38, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 2.10.2013 г. 19:41:38, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 2.10.2013 г. 18:07:00, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга LogMeIn Hamachi Tunneling Engine да се свърже. 2.10.2013 г. 18:07:00, Error: Service Control Manager [7000]  - Услуга LogMeIn Hamachi Tunneling Engine не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 2.10.2013 г. 18:06:36, Error: Service Control Manager [7030]  - Услуга LogMeIn Hamachi Tunneling Engine е маркирана като интерактивна услуга. Обаче системата е конфигурирана да не допуска интерактивни услуги. Тази услуга може да не функционира правилно. 2.10.2013 г. 18:05:49, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 1.10.2013 г. 21:20:10, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 1.10.2013 г. 21:20:10, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 1.10.2013 г. 19:11:04, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 1.10.2013 г. 19:11:04, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 1.10.2013 г. 18:14:14, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 1.10.2013 г. 16:14:45, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 1.10.2013 г. 16:14:45, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 1.10.2013 г. 15:22:26, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. . ==== End Of File ===========================  

Сподели този отговор

Линк към този отговор
Сподели в други сайтове





# AdwCleaner v3.006 - Report created 08/10/2013 at 14:17:20
# Updated 01/10/2013 by Xplode
# Operating System : Windows 7 Enterprise Service Pack 1 (32 bits)
# Username : User - HP
# Running from : C:UsersUserDownloadsadwcleaner.exe
# Option : Clean

***** [ Services ] *****

Service Deleted : Application Updater
Service Deleted : MyWebSearchService

***** [ Files / Folders ] *****

Folder Deleted : C:ProgramDataAVG Secure Search
Folder Deleted : C:ProgramDataBabylon
Folder Deleted : C:ProgramDataclsoft ltd
Folder Deleted : C:ProgramDataIminent
Folder Deleted : C:ProgramDataPremium
Folder Deleted : C:ProgramDataMaginiPPicc
Folder Deleted : C:ProgramDataMicrosoftWindowsStart MenuProgramsTheBflix
Folder Deleted : C:ProgramDataMicrosoftWindowsStart MenuProgramsMaginiPPicc
Folder Deleted : C:Program FilesApplication Updater
Folder Deleted : C:Program FilesAVG Secure Search
Folder Deleted : C:Program FilesIndustriya
Folder Deleted : C:Program FilesMagniPic
Folder Deleted : C:Program FilesMyWebSearch
Folder Deleted : C:Program FilesSimilarSites
Folder Deleted : C:Program FilesCommon FilesAVG Secure Search
Folder Deleted : C:Program FilesCommon Filesspigot
Folder Deleted : C:UsersUserAppDataLocalAVG Secure Search
Folder Deleted : C:UsersUserAppDataLocalBabylon
Folder Deleted : C:UsersUserAppDataLocalLowAVG Secure Search
Folder Deleted : C:UsersUserAppDataLocalLowFunWebProducts
Folder Deleted : C:UsersUserAppDataLocalLowIndustriya
Folder Deleted : C:UsersUserAppDataLocalLowMyWebSearch
Folder Deleted : C:UsersUserAppDataLocalLowSearch Settings
Folder Deleted : C:UsersUserAppDataLocalLowTheBflix
Folder Deleted : C:UsersUserAppDataLocalLowMaginiPPicc
Folder Deleted : C:UsersUserAppDataRoamingdvdvideosoftiehelpers
Folder Deleted : C:UsersUserAppDataRoamingIminent
Folder Deleted : C:UsersUserAppDataRoamingIndustriya
Folder Deleted : C:UsersUserAppDataRoamingSimilarSites
File Deleted : C:END
File Deleted : C:Program FilesMozilla Firefoxsearchpluginsavg-secure-search.xml
File Deleted : C:Program FilesMozilla FirefoxsearchpluginsBabylon.xml
File Deleted : C:UsersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultsearchpluginsSearchTheWeb.xml
File Deleted : C:UsersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultuser.js

***** [ Shortcuts ] *****

***** [ Registry ] *****

Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [{ACAA314B-EEBA-48E4-AD47-84E31C44796C}]
Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [Avg@toolbar]
Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [m3ffxtbr@mywebsearch.com]
Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [webbooster@iminent.com]
Key Deleted : HKLMSOFTWAREGoogleChromeExtensionsigdhbblpcellaljokkpfhcjlagemhgjl
Key Deleted : HKLMSOFTWAREGoogleChromeExtensionsndibdjnfmopecpmkdieinmbadjfpblof
Key Deleted : HKLMSOFTWAREClassesAppIDescort.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDescortApp.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDescortEng.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDescorTlbr.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDesrv.EXE
Key Deleted : HKLMSOFTWAREClassesAppIDIminent.WebBooster.InternetExplorer.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDScriptHelper.EXE
Key Deleted : HKLMSOFTWAREClassesAppIDTbCommonUtils.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDTbHelper.EXE
Key Deleted : HKLMSOFTWAREClassesAppIDViProtocol.DLL
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.BrowserWndAPI
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.BrowserWndAPI.1
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.PugiObj
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.PugiObj.1
Key Deleted : HKLMSOFTWAREClassesbhoclass.bho.bhoclass.bho
Key Deleted : HKLMSOFTWAREClassesescort.escortIEPane
Key Deleted : HKLMSOFTWAREClassesescort.escortIEPane.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.DataControl
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.DataControl.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistoryKillerScheduler
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistoryKillerScheduler.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistorySwatterControlBar
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistorySwatterControlBar.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HTMLMenu
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HTMLMenu.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HTMLMenu.2
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.IECookiesManager
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.IECookiesManager.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.KillerObjManager
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.KillerObjManager.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterBarButton
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterBarButton.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterSettingsControl
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterSettingsControl.1
Key Deleted : HKLMSOFTWAREClassesIminent
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ChatSessionPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ChatSessionPlugin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.HTMLPanel
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.HTMLPanel.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.MultipleButton
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.MultipleButton.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.OutlookAddin
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.OutlookAddin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.PseudoTransparentPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.PseudoTransparentPlugin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ThirdPartyInstaller
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ThirdPartyInstaller.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.UrlAlertButton
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.UrlAlertButton.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.SettingsPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.SettingsPlugin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.ToolbarPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.ToolbarPlugin.1
Key Deleted : HKLMSOFTWAREClassesprivitize.privitizeHlpr
Key Deleted : HKLMSOFTWAREClassesprivitize.privitizeHlpr.1
Key Deleted : HKLMSOFTWAREClassesProd.cap
Key Deleted : HKLMSOFTWAREClassesprotocolshandlerviprotocol
Key Deleted : HKLMSOFTWAREClassesS
Key Deleted : HKLMSOFTWAREClassesScreenSaverControl.ScreenSaverInstaller
Key Deleted : HKLMSOFTWAREClassesScreenSaverControl.ScreenSaverInstaller.1
Key Deleted : HKLMSOFTWAREClassesScriptHelper.ScriptHelperApi
Key Deleted : HKLMSOFTWAREClassesScriptHelper.ScriptHelperApi.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbDownloadManager
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbDownloadManager.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbPropertyManager
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbPropertyManager.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbRequest
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbRequest.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbTask
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbTask.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.ToolbarHelper
Key Deleted : HKLMSOFTWAREClassesTbHelper.ToolbarHelper.1
Key Deleted : HKLMSOFTWAREClassesToolbar3.ContextMenuNotifier
Key Deleted : HKLMSOFTWAREClassesToolbar3.ContextMenuNotifier.1
Key Deleted : HKLMSOFTWAREClassesToolbar3.CustomInternetSecurityImpl
Key Deleted : HKLMSOFTWAREClassesToolbar3.CustomInternetSecurityImpl.1
Key Deleted : HKLMSOFTWAREClassesViProtocol.ViProtocolOLE
Key Deleted : HKLMSOFTWAREClassesViProtocol.ViProtocolOLE.1
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsRunDll32Policyf3ScrCtr.dll
Key Deleted : HKLMSOFTWAREMicrosoftMultimediaWMPlayerSchemesf3pss
Key Deleted : HKLMSOFTWAREMicrosoftOfficeOutlookAddinsMyWebSearch.OutlookAddin
Key Deleted : HKLMSOFTWAREMicrosoftOfficeWordAddinsMyWebSearch.OutlookAddin
Key Deleted : HKLMSOFTWAREMicrosoftShared ToolsMSConfigstartupregIminent
Key Deleted : HKLMSOFTWAREMicrosoftShared ToolsMSConfigstartupregIminentMessenger
Key Deleted : HKLMSOFTWAREMicrosoftTracingAskPIP_FF__RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingAskPIP_FF__RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingIminent_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingIminent_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingsoftonic_ggl_1_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingsoftonic_ggl_1_RASMANCS
Value Deleted : HKLMSOFTWAREMicrosoftWindows MediaWmsdkSources [F3PopularScreenSavers]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionInternet Settings5.0User AgentPost Platform [FunWebProducts]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionInternet SettingsUser Agentpost platform [FunWebProducts]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionRun [searchSettings]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionRun [vProt]
Key Deleted : HKLMSOFTWAREMozillaPlugins@avg.com/AVG SiteSafety plugin,version=,application/x-avg-sitesafety-plugin
Key Deleted : HKLMSOFTWAREMozillaPlugins@mywebsearch.com/Plugin
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstallSP_d8283021
Key Deleted : HKLMSOFTWAREClassesTBSB01620.IEToolbar
Key Deleted : HKLMSOFTWAREClassesTBSB01620.IEToolbar.1
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_brawl-busters_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_brawl-busters_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_c-medieval_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_c-medieval_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_camstudio_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_camstudio_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_everest_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_everest_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_flashget_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_flashget_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_format-factory_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_format-factory_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gravity-defied---trial-racing_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gravity-defied---trial-racing_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas(1)_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas(1)_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hamachi_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hamachi_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_happy-wheels_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_happy-wheels_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hero-online_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hero-online_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_league-of-legends_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_league-of-legends_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_microsoft-flight-simulator_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_microsoft-flight-simulator_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_san-andreas-multiplayer_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_san-andreas-multiplayer_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_second-life_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_second-life_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_sony-vegas-video_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_sony-vegas-video_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_tactical-ops-assault-on-terror_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_tactical-ops-assault-on-terror_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_talking-tom-cat_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_talking-tom-cat_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_virtual-families_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_virtual-families_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_world-of-warcraft_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_world-of-warcraft_RASMANCS
Key Deleted : HKLMSOFTWAREClassesAppID{01994268-3C10-4044-A1EA-7A9C1B739A11}
Key Deleted : HKLMSOFTWAREClassesAppID{09C554C3-109B-483C-A06B-F14172F1A947}
Key Deleted : HKLMSOFTWAREClassesAppID{1FDFF5A2-7BB1-48E1-8081-7236812B12B2}
Key Deleted : HKLMSOFTWAREClassesAppID{4CE516A7-F7AC-4628-B411-8F886DC5733E}
Key Deleted : HKLMSOFTWAREClassesAppID{4E1E9D45-8BF9-4139-915C-9F83CC3D5921}
Key Deleted : HKLMSOFTWAREClassesAppID{628F3201-34D0-49C0-BB9A-82A26AEFB291}
Key Deleted : HKLMSOFTWAREClassesAppID{B12E99ED-69BD-437C-86BE-C862B9E5444D}
Key Deleted : HKLMSOFTWAREClassesAppID{BB711CB0-C70B-482E-9852-EC05EBD71DBB}
Key Deleted : HKLMSOFTWAREClassesAppID{D7EE8177-D51E-4F89-92B6-83EA2EC40800}
Key Deleted : HKLMSOFTWAREClassesCLSID{02054E11-5113-4BE3-8153-AA8DFB5D3761}
Key Deleted : HKLMSOFTWAREClassesCLSID{02C9C7B0-C7C8-4AAC-A9E4-55295BF60F8F}
Key Deleted : HKLMSOFTWAREClassesCLSID{0398B101-6DA7-473F-A290-17D2FBC88CC0}
Key Deleted : HKLMSOFTWAREClassesCLSID{08858AF6-42AD-4914-95D2-AC3AB0DC8E28}
Key Deleted : HKLMSOFTWAREClassesCLSID{0CC36196-8589-4B80-A771-D659411D7F90}
Key Deleted : HKLMSOFTWAREClassesCLSID{0F8ECF4F-3646-4C3A-8881-8E138FFCAF70}
Key Deleted : HKLMSOFTWAREClassesCLSID{143D96F9-EB64-48B3-B192-91C2C41A1F43}
Key Deleted : HKLMSOFTWAREClassesCLSID{147A976F-EEE1-4377-8EA7-4716E4CDD239}
Key Deleted : HKLMSOFTWAREClassesCLSID{14F7D91F-F669-45C9-9F42-BACBFDB86EAD}
Key Deleted : HKLMSOFTWAREClassesCLSID{187A6488-6E71-4A2A-B118-7BEFBFE58257}
Key Deleted : HKLMSOFTWAREClassesCLSID{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKLMSOFTWAREClassesCLSID{25560540-9571-4D7B-9389-0F166788785A}
Key Deleted : HKLMSOFTWAREClassesCLSID{2D065204-A024-4C39-8A38-EE7078EC7ACF}
Key Deleted : HKLMSOFTWAREClassesCLSID{30F5476C-677B-4DB0-B397-51F5BFD86840}
Key Deleted : HKLMSOFTWAREClassesCLSID{3223F2FB-D9B9-45FC-9D66-CD717FFA4EE5}
Key Deleted : HKLMSOFTWAREClassesCLSID{351798B1-C1D2-45AB-92B4-4D6C2D6AB5AF}
Key Deleted : HKLMSOFTWAREClassesCLSID{35B8892D-C3FB-4D88-990D-31DB2EBD72BD}
Key Deleted : HKLMSOFTWAREClassesCLSID{3AEA1BEF-6195-46F4-ACA2-0ED14F7EFA1B}
Key Deleted : HKLMSOFTWAREClassesCLSID{3D7F9AC3-BAC3-4E51-81D7-D121D79E550A}
Key Deleted : HKLMSOFTWAREClassesCLSID{3DC201FB-E9C9-499C-A11F-23C360D7C3F8}
Key Deleted : HKLMSOFTWAREClassesCLSID{3E720452-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesCLSID{4498C5E9-93C6-4142-B6BE-F0C6DC48B77A}
Key Deleted : HKLMSOFTWAREClassesCLSID{479BF2D6-E362-4A99-B1AB-BC764D7B97AE}
Key Deleted : HKLMSOFTWAREClassesCLSID{492A108F-51D0-4BD8-899D-AD4AB2893064}
Key Deleted : HKLMSOFTWAREClassesCLSID{4B6D6E60-FBD2-4E79-BF4B-886BC98F1797}
Key Deleted : HKLMSOFTWAREClassesCLSID{4E92DB5F-AAD9-49D3-8EAB-B40CBE5B1FF7}
Key Deleted : HKLMSOFTWAREClassesCLSID{60893E02-2E5B-43F9-A93A-BAD60C2DF6EF}
Key Deleted : HKLMSOFTWAREClassesCLSID{63D0ED2C-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREClassesCLSID{67FA02C4-AB30-4E77-A640-78EE8EC8673B}
Key Deleted : HKLMSOFTWAREClassesCLSID{6D39931F-451E-4BDD-BAF4-37FB96DBBA5D}
Key Deleted : HKLMSOFTWAREClassesCLSID{7473D292-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{7473D294-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{7473D296-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{76C684D2-C35D-4284-976A-D862F53ADB81}
Key Deleted : HKLMSOFTWAREClassesCLSID{796D822A-C3F9-4A97-BAAB-42FE7628EA63}
Key Deleted : HKLMSOFTWAREClassesCLSID{799391D3-EB86-4BAC-9BD3-CBFEA58A0E15}
Key Deleted : HKLMSOFTWAREClassesCLSID{79EF3691-EC1A-4705-A01A-D2E36EC11758}
Key Deleted : HKLMSOFTWAREClassesCLSID{819FFE22-35C7-4925-8CDA-4E0E2DB94302}
Key Deleted : HKLMSOFTWAREClassesCLSID{82F41418-8E64-47EB-A7F1-4702A974D289}
Key Deleted : HKLMSOFTWAREClassesCLSID{84DA4FDF-A1CF-4195-8688-3E961F505983}
Key Deleted : HKLMSOFTWAREClassesCLSID{85D920CE-63A7-46DC-8992-41D1D2E07FAD}
Key Deleted : HKLMSOFTWAREClassesCLSID{895ED5E8-ABB4-40C3-A0CA-2571964268E2}
Key Deleted : HKLMSOFTWAREClassesCLSID{898EA8C8-E7FF-479B-8935-AEC46303B9E5}
Key Deleted : HKLMSOFTWAREClassesCLSID{8AAC123A-1959-4A45-BFC5-E2D50783098A}
Key Deleted : HKLMSOFTWAREClassesCLSID{8E6F1832-9607-4440-8530-13BE7C4B1D14}
Key Deleted : HKLMSOFTWAREClassesCLSID{933B95E2-E7B7-4AD9-B952-7AC336682AE3}
Key Deleted : HKLMSOFTWAREClassesCLSID{938AA51A-996C-4884-98CE-80DD16A5C9DA}
Key Deleted : HKLMSOFTWAREClassesCLSID{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKLMSOFTWAREClassesCLSID{98D9753D-D73B-42D5-8C85-4469CDA897AB}
Key Deleted : HKLMSOFTWAREClassesCLSID{9AFB8248-617F-460D-9366-D71CDEDA3179}
Key Deleted : HKLMSOFTWAREClassesCLSID{9FF05104-B030-46FC-94B8-81276E4E27DF}
Key Deleted : HKLMSOFTWAREClassesCLSID{A07956CD-81F8-4A03-B524-5D87E690DC83}
Key Deleted : HKLMSOFTWAREClassesCLSID{A4730EBE-43A6-443E-9776-36915D323AD3}
Key Deleted : HKLMSOFTWAREClassesCLSID{A9571378-68A1-443D-B082-284F960C6D17}
Key Deleted : HKLMSOFTWAREClassesCLSID{ADB01E81-3C79-4272-A0F1-7B2BE7A782DC}
Key Deleted : HKLMSOFTWAREClassesCLSID{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKLMSOFTWAREClassesCLSID{B25AEDC4-8086-41E3-8349-328223FA9FCB}
Key Deleted : HKLMSOFTWAREClassesCLSID{B5E3B26B-6E5C-4865-A63D-58D04B10E245}
Key Deleted : HKLMSOFTWAREClassesCLSID{B658800C-F66E-4EF3-AB85-6C0C227862A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{B813095C-81C0-4E40-AA14-67520372B987}
Key Deleted : HKLMSOFTWAREClassesCLSID{B84D2DC5-42B2-4E5E-BF61-7B48152FF8EF}
Key Deleted : HKLMSOFTWAREClassesCLSID{B89D5309-0367-4494-A92F-3D4C94F88307}
Key Deleted : HKLMSOFTWAREClassesCLSID{C014EBF8-8854-448B-B5A4-557C4090EDCE}
Key Deleted : HKLMSOFTWAREClassesCLSID{C31191DB-2F64-464C-B97C-6AC81ACB7AAC}
Key Deleted : HKLMSOFTWAREClassesCLSID{C342C7A7-F622-4EF3-8B7F-ABB9FBE73F14}
Key Deleted : HKLMSOFTWAREClassesCLSID{C4765B07-BC2F-477B-925C-B2BF24887823}
Key Deleted : HKLMSOFTWAREClassesCLSID{C875C0A1-09E3-48D5-9F8E-BD337796FD14}
Key Deleted : HKLMSOFTWAREClassesCLSID{C9D7BE3E-141A-4C85-8CD6-32461F3DF2C7}
Key Deleted : HKLMSOFTWAREClassesCLSID{CD126DA6-FF5B-4181-AC13-54A62240D2FA}
Key Deleted : HKLMSOFTWAREClassesCLSID{CFF4CE82-3AA2-451F-9B77-7165605FB835}
Key Deleted : HKLMSOFTWAREClassesCLSID{D858DAFC-9573-4811-B323-7011A3AA7E61}
Key Deleted : HKLMSOFTWAREClassesCLSID{D9FFFB27-D62A-4D64-8CEC-1FF006528805}
Key Deleted : HKLMSOFTWAREClassesCLSID{DD438708-AAB4-422D-A322-B619589F5680}
Key Deleted : HKLMSOFTWAREClassesCLSID{DE9028D0-5FFA-4E69-94E3-89EE8741F468}
Key Deleted : HKLMSOFTWAREClassesCLSID{E79DFBCA-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesCLSID{E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39}
Key Deleted : HKLMSOFTWAREClassesCLSID{E812AE43-7799-4E67-8CF8-4104297A2D16}
Key Deleted : HKLMSOFTWAREClassesCLSID{F0BAAEC7-9AE0-49FF-9C4B-86E774FF397F}
Key Deleted : HKLMSOFTWAREClassesCLSID{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKLMSOFTWAREClassesCLSID{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKLMSOFTWAREClassesCLSID{F92193FD-2243-4401-9ACC-49FF30885898}
Key Deleted : HKLMSOFTWAREClassesCLSID{FD21B8A2-910B-45AC-9C10-45E6A8B84984}
Key Deleted : HKLMSOFTWAREClassesInterface{01947140-417F-46B6-8751-A3A2B8345E1A}
Key Deleted : HKLMSOFTWAREClassesInterface{021B4049-F57D-4565-A693-FD3B04786BFA}
Key Deleted : HKLMSOFTWAREClassesInterface{0362AA09-808D-48E9-B360-FB51A8CBCE09}
Key Deleted : HKLMSOFTWAREClassesInterface{03E2A1F3-4402-4121-8B35-733216D61217}
Key Deleted : HKLMSOFTWAREClassesInterface{06844020-CD0B-3D3D-A7FE-371153013E49}
Key Deleted : HKLMSOFTWAREClassesInterface{07B18EAC-A523-4961-B6BB-170DE4475CCA}
Key Deleted : HKLMSOFTWAREClassesInterface{0ADC01BB-303B-3F8E-93DA-12C140E85460}
Key Deleted : HKLMSOFTWAREClassesInterface{1093995A-BA37-41D2-836E-091067C4AD17}
Key Deleted : HKLMSOFTWAREClassesInterface{10D3722F-23E6-3901-B6C1-FF6567121920}
Key Deleted : HKLMSOFTWAREClassesInterface{120927BF-1700-43BC-810F-FAB92549B390}
Key Deleted : HKLMSOFTWAREClassesInterface{1675E62B-F911-3B7B-A046-EB57261212F3}
Key Deleted : HKLMSOFTWAREClassesInterface{17DE5E5E-BFE3-4E83-8E1F-8755795359EC}
Key Deleted : HKLMSOFTWAREClassesInterface{192929F2-9273-3894-91B0-F54671C4C861}
Key Deleted : HKLMSOFTWAREClassesInterface{1F52A5FA-A705-4415-B975-88503B291728}
Key Deleted : HKLMSOFTWAREClassesInterface{247A115F-06C2-4FB3-967D-2D62D3CF4F0A}
Key Deleted : HKLMSOFTWAREClassesInterface{2932897E-3036-43D9-8A64-B06447992065}
Key Deleted : HKLMSOFTWAREClassesInterface{2DE92D29-A042-3C37-BFF8-07C7D8893EFA}
Key Deleted : HKLMSOFTWAREClassesInterface{2E3537FC-CF2F-4F56-AF54-5A6A3DD375CC}
Key Deleted : HKLMSOFTWAREClassesInterface{2E9937FC-CF2F-4F56-AF54-5A6A3DD375CC}
Key Deleted : HKLMSOFTWAREClassesInterface{31E3BC75-2A09-4CFF-9C92-8D0ED8D1DC0F}
Key Deleted : HKLMSOFTWAREClassesInterface{32B80AD6-1214-45F4-994E-78A5D482C000}
Key Deleted : HKLMSOFTWAREClassesInterface{3A8E103F-B2B7-3BEF-B3B0-88E29B2420E4}
Key Deleted : HKLMSOFTWAREClassesInterface{3E1656ED-F60E-4597-B6AA-B6A58E171495}
Key Deleted : HKLMSOFTWAREClassesInterface{3E53E2CB-86DB-4A4A-8BD9-FFEB7A64DF82}
Key Deleted : HKLMSOFTWAREClassesInterface{3E720451-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesInterface{3E720453-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesInterface{3F607E46-0D3C-4442-B1DE-DE7FA4768F5C}
Key Deleted : HKLMSOFTWAREClassesInterface{478CE5D3-D38E-3FFE-8DBE-8C4A0F1C4D8D}
Key Deleted : HKLMSOFTWAREClassesInterface{48B7DA4E-69ED-39E3-BAD5-3E3EFF22CFB0}
Key Deleted : HKLMSOFTWAREClassesInterface{4E92DB5F-AAD9-49D3-8EAB-B40CBE5B1FF7}
Key Deleted : HKLMSOFTWAREClassesInterface{5982F405-44E4-3BBB-BAC4-CF8141CBBC5C}
Key Deleted : HKLMSOFTWAREClassesInterface{5D8C3CC3-3C05-38A1-B244-924A23115FE9}
Key Deleted : HKLMSOFTWAREClassesInterface{63D0ED2B-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREClassesInterface{63D0ED2D-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREClassesInterface{641593AF-D9FD-30F7-B783-36E16F7A2E08}
Key Deleted : HKLMSOFTWAREClassesInterface{6E74766C-4D93-4CC0-96D1-47B8E07FF9CA}
Key Deleted : HKLMSOFTWAREClassesInterface{711FC48A-1356-3932-94D8-A8B733DBC7E4}
Key Deleted : HKLMSOFTWAREClassesInterface{72227B7F-1F02-3560-95F5-592E68BACC0C}
Key Deleted : HKLMSOFTWAREClassesInterface{72EE7F04-15BD-4845-A005-D6711144D86A}
Key Deleted : HKLMSOFTWAREClassesInterface{741DE825-A6F0-4497-9AA6-8023CF9B0FFF}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D291-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D293-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D295-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D297-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{79FB5FC8-44B9-4AF5-BADD-CCE547F953E5}
Key Deleted : HKLMSOFTWAREClassesInterface{7B5E8CE3-4722-4C0E-A236-A6FF731BEF37}
Key Deleted : HKLMSOFTWAREClassesInterface{819FFE21-35C7-4925-8CDA-4E0E2DB94302}
Key Deleted : HKLMSOFTWAREClassesInterface{890D4F59-5ED0-3CB4-8E0E-74A5A86E7ED0}
Key Deleted : HKLMSOFTWAREClassesInterface{8C68913C-AC3C-4494-8B9C-984D87C85003}
Key Deleted : HKLMSOFTWAREClassesInterface{8D019513-083F-4AA5-933F-7D43A6DA82C4}
Key Deleted : HKLMSOFTWAREClassesInterface{90449521-D834-4703-BB4E-D3AA44042FF8}
Key Deleted : HKLMSOFTWAREClassesInterface{923F6FB8-A390-370E-A0D2-DD505432481D}
Key Deleted : HKLMSOFTWAREClassesInterface{991AAC62-B100-47CE-8B75-253965244F69}
Key Deleted : HKLMSOFTWAREClassesInterface{9BBB26EF-B178-35D6-9D3D-B485F4279FE5}
Key Deleted : HKLMSOFTWAREClassesInterface{9E3B11F6-4179-4603-A71B-A55F4BCB0BEC}
Key Deleted : HKLMSOFTWAREClassesInterface{A626CDBD-3D13-4F78-B819-440A28D7E8FC}
Key Deleted : HKLMSOFTWAREClassesInterface{A62DDBE0-8D2A-339A-B089-8CBCC5CD322A}
Key Deleted : HKLMSOFTWAREClassesInterface{A82AD04D-0B8E-3A49-947B-6A69A8A9C96D}
Key Deleted : HKLMSOFTWAREClassesInterface{ADEB3CC9-A05D-4FCC-BD09-9025456AA3EA}
Key Deleted : HKLMSOFTWAREClassesInterface{B06D4521-D09C-3F41-8E39-9D784CCA2A75}
Key Deleted : HKLMSOFTWAREClassesInterface{BBABDC90-F3D5-4801-863A-EE6AE529862D}
Key Deleted : HKLMSOFTWAREClassesInterface{BF921DD3-732A-4A11-933B-A5EA49F2FD2C}
Key Deleted : HKLMSOFTWAREClassesInterface{C06DAD42-6F39-4CE1-83CC-9A8B9105E556}
Key Deleted : HKLMSOFTWAREClassesInterface{C2E799D0-43A5-3477-8A98-FC5F3677F35C}
Key Deleted : HKLMSOFTWAREClassesInterface{C401D2CE-DC27-45C7-BC0C-8E6EA7F085D6}
Key Deleted : HKLMSOFTWAREClassesInterface{CF54BE1C-9359-4395-8533-1657CF209CFE}
Key Deleted : HKLMSOFTWAREClassesInterface{D16107CD-2AD5-46A8-BA59-303B7C32C500}
Key Deleted : HKLMSOFTWAREClassesInterface{D25B101F-8188-3B43-9D85-201F372BC205}
Key Deleted : HKLMSOFTWAREClassesInterface{D2BA7595-5E44-3F1E-880F-03B3139FA5ED}
Key Deleted : HKLMSOFTWAREClassesInterface{D35F5C81-17D9-3E1C-A1FC-4472542E1D25}
Key Deleted : HKLMSOFTWAREClassesInterface{D6FF3684-AD3B-48EB-BBB4-B9E6C5A355C1}
Key Deleted : HKLMSOFTWAREClassesInterface{D83B296A-2FA6-425B-8AE8-A1F33D99FBD6}
Key Deleted : HKLMSOFTWAREClassesInterface{D8FA96CA-B250-312C-AF34-4FF1DD72589D}
Key Deleted : HKLMSOFTWAREClassesInterface{DAFC1E63-3359-416D-9BC2-E7DCA6F7B0F3}
Key Deleted : HKLMSOFTWAREClassesInterface{DC5E5C44-80FD-3697-9E65-9F286D92F3E7}
Key Deleted : HKLMSOFTWAREClassesInterface{DE38C398-B328-4F4C-A3AD-1B5E4ED93477}
Key Deleted : HKLMSOFTWAREClassesInterface{E1B4C9DE-D741-385F-981E-6745FACE6F01}
Key Deleted : HKLMSOFTWAREClassesInterface{E342AF55-B78A-4CD0-A2BB-DA7F52D9D25E}
Key Deleted : HKLMSOFTWAREClassesInterface{E342AF55-B78A-4CD0-A2BB-DA7F52D9D25F}
Key Deleted : HKLMSOFTWAREClassesInterface{E79DFBC9-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesInterface{E79DFBCB-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesInterface{E7B623F5-9715-3F9F-A671-D1485A39F8A2}
Key Deleted : HKLMSOFTWAREClassesInterface{EB9E5C1C-B1F9-4C2B-BE8A-27D6446FDAF8}
Key Deleted : HKLMSOFTWAREClassesInterface{ED916A7B-7C68-3198-B87D-2DABC30A5587}
Key Deleted : HKLMSOFTWAREClassesInterface{EFA1BDB2-BB3D-3D9A-8EB5-D0D22E0F64F4}
Key Deleted : HKLMSOFTWAREClassesInterface{F4CBF4DD-F8FE-35BA-BB7E-68304DAAB70B}
Key Deleted : HKLMSOFTWAREClassesInterface{FC32005D-E27C-32E0-ADFA-152F598B75E7}
Key Deleted : HKLMSOFTWAREClassesInterface{FE0273D1-99DF-4AC0-87D5-1371C6271785}
Key Deleted : HKLMSOFTWAREClassesTypeLib{0D26BC71-A633-4E71-AD31-EADC3A1B6A3A}
Key Deleted : HKLMSOFTWAREClassesTypeLib{13ABD093-D46F-40DF-A608-47E162EC799D}
Key Deleted : HKLMSOFTWAREClassesTypeLib{29D67D3C-509A-4544-903F-C8C1B8236554}
Key Deleted : HKLMSOFTWAREClassesTypeLib{2BF2028E-3F3C-4C05-AB45-B2F1DCFE0759}
Key Deleted : HKLMSOFTWAREClassesTypeLib{3E720450-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesTypeLib{4E1E9D45-8BF9-4139-915C-9F83CC3D5921}
Key Deleted : HKLMSOFTWAREClassesTypeLib{7473D290-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesTypeLib{74FB6AFD-DD77-4CEB-83BD-AB2B63E63C93}
Key Deleted : HKLMSOFTWAREClassesTypeLib{819FFE20-35C7-4925-8CDA-4E0E2DB94302}
Key Deleted : HKLMSOFTWAREClassesTypeLib{8CA01F0E-987C-49C3-B852-2F1AC4A7094C}
Key Deleted : HKLMSOFTWAREClassesTypeLib{8E6F1830-9607-4440-8530-13BE7C4B1D14}
Key Deleted : HKLMSOFTWAREClassesTypeLib{8FFDF636-0D87-4B33-B9E9-79A53F6E1DAE}
Key Deleted : HKLMSOFTWAREClassesTypeLib{93E3D79C-0786-48FF-9329-93BC9F6DC2B3}
Key Deleted : HKLMSOFTWAREClassesTypeLib{9C049BA6-EA47-4AC3-AED6-A66D8DC9E1D8}
Key Deleted : HKLMSOFTWAREClassesTypeLib{C2AC8A0E-E48E-484B-A71C-C7A937FAAB94}
Key Deleted : HKLMSOFTWAREClassesTypeLib{C8CECDE3-1AE1-4C4A-AD82-6D5B00212144}
Key Deleted : HKLMSOFTWAREClassesTypeLib{D518921A-4A03-425E-9873-B9A71756821E}
Key Deleted : HKLMSOFTWAREClassesTypeLib{D7EE8177-D51E-4F89-92B6-83EA2EC40800}
Key Deleted : HKLMSOFTWAREClassesTypeLib{DB538320-D3C5-433C-BCA9-C4081A054FCF}
Key Deleted : HKLMSOFTWAREClassesTypeLib{E2343056-CC08-46AC-B898-BFC7ACF4E755}
Key Deleted : HKLMSOFTWAREClassesTypeLib{E47CAEE0-DEEA-464A-9326-3F2801535A4D}
Key Deleted : HKLMSOFTWAREClassesTypeLib{E79DFBC0-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesTypeLib{F42228FB-E84E-479E-B922-FBBD096E792C}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{07B18EAB-A523-4961-B6BB-170DE4475CCA}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{116BA71C-8187-4F15-9A1F-C9D6289155D1}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{2974C985-8151-4DE5-B23C-B875F0A8522F}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{07B18EAB-A523-4961-B6BB-170DE4475CCA}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{08858AF6-42AD-4914-95D2-AC3AB0DC8E28}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{25560540-9571-4D7B-9389-0F166788785A}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{3DC201FB-E9C9-499C-A11F-23C360D7C3F8}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{3E720452-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{63D0ED2C-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{7473D294-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{98D9753D-D73B-42D5-8C85-4469CDA897AB}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{9FF05104-B030-46FC-94B8-81276E4E27DF}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{C6FDD0C3-266A-4DC3-B459-28C697C44CDC}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{E79DFBCA-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerExtensions{898EA8C8-E7FF-479B-8935-AEC46303B9E5}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{59C7FC09-1C83-4648-B3E6-003D2BBC7481}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{628F3201-34D0-49C0-BB9A-82A26AEFB291}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{68AF847F-6E91-45DD-9B68-D6A12C30E5D7}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{9170B96C-28D4-4626-8358-27E6CAEEF907}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{D1A71FA0-FF48-48DD-9B6D-7A13A3E42127}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{DDB1968E-EAD6-40FD-8DAE-FF14757F60C7}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{F138D901-86F0-4383-99B6-9CDD406036DA}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKCUSoftwareMicrosoftInternet ExplorerSearchScopes{0ECDF796-C2DC-4D79-A620-CCE0C0A66CC9}
Key Deleted : HKCUSoftwareMicrosoftInternet ExplorerSearchScopes{70D46D94-BF1E-45ED-B567-48701376298E}
Key Deleted : HKCUSoftwareMicrosoftInternet ExplorerSearchScopes{95B7759C-8C7F-4BF1-B163-73684A933233}
Value Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerToolbar [{07B18EA9-A523-4961-B6BB-170DE4475CCA}]
Value Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerToolbar [{95B7759C-8C7F-4BF1-B163-73684A933233}]
Value Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerToolbar [{F3FEE66E-E034-436A-86E4-9690573BEE8A}]
Value Deleted : HKCUSoftwareMicrosoftInternet ExplorerToolbarWebBrowser [{E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39}]
Value Deleted : HKCUSoftwareMicrosoftInternet ExplorerURLSearchHooks [{00A6FAF6-072E-44CF-8957-5838F569A31D}]
Value Deleted : HKCUSoftwareMicrosoftInternet ExplorerURLSearchHooks [{F3FEE66E-E034-436A-86E4-9690573BEE8A}]
Key Deleted : HKCUSoftwareAPN PIP
Key Deleted : HKCUSoftwareAVG Secure Search
Key Deleted : HKCUSoftwareIGearSettings
Key Deleted : HKCUSoftwareMyWebSearch
Key Deleted : HKCUSoftwarePIP
Key Deleted : HKCUSoftwarePrivitizeVPNInstallDates
Key Deleted : HKCUSoftwareSearch Settings
Key Deleted : HKCUSoftwareSoftonic
Key Deleted : HKCUSoftwareStartSearch
Key Deleted : HKCUSoftwareAppDataLowSoftwareFun Web Products
Key Deleted : HKCUSoftwareAppDataLowSoftwareFunWebProducts
Key Deleted : HKCUSoftwareAppDataLowSoftwareMyWebSearch
Key Deleted : HKCUSoftwareAppDataLowSoftwareSearch Settings
Key Deleted : HKLMSoftwareApplication Updater
Key Deleted : HKLMSoftwareAVG Secure Search
Key Deleted : HKLMSoftwareAVG Security Toolbar
Key Deleted : HKLMSoftwareBabylon
Key Deleted : HKLMSoftwareFocusInteractive
Key Deleted : HKLMSoftwareFun Web Products
Key Deleted : HKLMSoftwareIminent
Key Deleted : HKLMSoftwareMyWebSearch
Key Deleted : HKLMSoftwarePIP
Key Deleted : HKLMSoftwareSearch Settings
Key Deleted : HKLMSoftwareSP Global
Key Deleted : HKLMSoftwareSProtector
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstall{A76AA284-E52D-47E6-9E4F-B85DBF8E35C3}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstall{A92DAB39-4E2C-4304-9AB6-BC44E68B55E2}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstall{F7CF0E9A-D48B-4942-9537-259ED0568DF4}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstallmywebsearch bar uninstall
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstallSearchTheWebARP
Data Deleted : HKLMSOFTWAREMicrosoftWindows NTCurrentVersionWindows [AppInit_DLLs] - c:progra~1magnipicsprote~1.dll
Product Deleted : IMinent Toolbar

***** [ Browsers ] *****

- Internet Explorer v10.0.9200.16686

Setting Restored : HKCUSoftwareMicrosoftInternet ExplorerMain [start Page]

- Mozilla Firefox v24.0 (bg)

[ File : C:UsersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultprefs.js ]

Line Deleted : user_pref("aol_toolbar.default.homepage.check", false);
Line Deleted : user_pref("aol_toolbar.default.search.check", false);
Line Deleted : user_pref("browser.babylon.HPOnNewTab", "search.babylon.com");
Line Deleted : user_pref("browser.search.defaultenginename", "Search The Web (privitize)");
Line Deleted : user_pref("browser.search.order.1", "Search The Web (privitize)");
Line Deleted : user_pref("browser.search.selectedEngine", "Search The Web (privitize)");
Line Deleted : user_pref("dom.ipc.plugins.enabled.npmywebs.dll", false);
Line Deleted : user_pref("extensions.5159a25736caa.scode", "(function(){try{if('aol.com,mail.google.com,premiumreports.info,search.babylon.com,search.gboxapp.com'.indexOf(window.self.location.hostname)>-1) return;}c[...]
Line Deleted : user_pref("extensions.BabylonToolbar.prtkDS", 0);
Line Deleted : user_pref("extensions.BabylonToolbar.prtkHmpg", 0);
Line Deleted : user_pref("extensions.BabylonToolbar_i.newTab", true);

Line Deleted : user_pref("extensions.privitize.srchPrvdr", "Search The Web (privitize)");
Line Deleted : user_pref("extensions.softonic.admin", false);
Line Deleted : user_pref("extensions.softonic.aflt", "orgnl");
Line Deleted : user_pref("extensions.softonic.dfltLng", "");
Line Deleted : user_pref("extensions.softonic.dfltSrch", false);
Line Deleted : user_pref("extensions.softonic.excTlbr", false);
Line Deleted : user_pref("extensions.softonic.hmpg", false);
Line Deleted : user_pref("extensions.softonic.id", "d65288460000000000002c27d72d77db");
Line Deleted : user_pref("extensions.softonic.instlDay", "15401");
Line Deleted : user_pref("extensions.softonic.instlRef", "MON00001");
Line Deleted : user_pref("extensions.softonic.lastVrsnTs", "");
Line Deleted : user_pref("extensions.softonic.newTab", false);
Line Deleted : user_pref("extensions.softonic.noFFXTlbr", false);
Line Deleted : user_pref("extensions.softonic.prdct", "softonic");
Line Deleted : user_pref("extensions.softonic.prtnrId", "softonic");
Line Deleted : user_pref("extensions.softonic.smplGrp", "eng7");
Line Deleted : user_pref("extensions.softonic.tlbrId", "eng7");

Line Deleted : user_pref("extensions.softonic.vrsn", "");
Line Deleted : user_pref("extensions.softonic.vrsnTs", "");
Line Deleted : user_pref("extensions.softonic.vrsni", "");
Line Deleted : user_pref("extensions.softonic_i.aflt", "orgnl");
Line Deleted : user_pref("extensions.softonic_i.dfltLng", "");
Line Deleted : user_pref("extensions.softonic_i.excTlbr", false);
Line Deleted : user_pref("extensions.softonic_i.id", "d65288460000000000002c27d72d77db");
Line Deleted : user_pref("extensions.softonic_i.instlDay", "15401");
Line Deleted : user_pref("extensions.softonic_i.instlRef", "MON00001");
Line Deleted : user_pref("extensions.softonic_i.newTab", false);
Line Deleted : user_pref("extensions.softonic_i.prdct", "softonic");
Line Deleted : user_pref("extensions.softonic_i.prtnrId", "softonic");
Line Deleted : user_pref("extensions.softonic_i.smplGrp", "eng7");
Line Deleted : user_pref("extensions.softonic_i.tlbrId", "eng7");

Line Deleted : user_pref("extensions.softonic_i.vrsn", "");
Line Deleted : user_pref("extensions.softonic_i.vrsnTs", "");
Line Deleted : user_pref("extensions.softonic_i.vrsni", "");
Line Deleted : user_pref("sweetim.toolbar.previous.browser.search.defaultenginename", "");
Line Deleted : user_pref("sweetim.toolbar.previous.browser.search.selectedEngine", "");
Line Deleted : user_pref("sweetim.toolbar.previous.browser.startup.homepage", "");
Line Deleted : user_pref("sweetim.toolbar.previous.keyword.URL", "");
Line Deleted : user_pref("sweetim.toolbar.scripts.1.domain-blacklist", "");
Line Deleted : user_pref("sweetim.toolbar.searchguard.UserRejectedGuard_DS", "");
Line Deleted : user_pref("sweetim.toolbar.searchguard.UserRejectedGuard_HP", "");
Line Deleted : user_pref("sweetim.toolbar.searchguard.enable", "");

- Google Chrome v30.0.1599.69

[ File : C:UsersUserAppDataLocalGoogleChromeUser DataDefaultpreferences ]


AdwCleaner[R0].txt - [42354 octets] - [08/10/2013 14:16:42]
AdwCleaner[s0].txt - [43150 octets] - [08/10/2013 14:17:20]

########## EOF - C:AdwCleanerAdwCleaner[s0].txt - [43211 octets] ##########







Junkware Removal Tool (JRT) by Thisisu
Version: 6.0.4 (10.06.2013:1)
OS: Windows 7 Enterprise x86
Ran by User on ўв 08.10.2013 Ј. at 14:21:51,90

~~~ Services

~~~ Registry Values

Successfully deleted: [Registry Value] HKEY_LOCAL_MACHINESoftwareMicrosoftWindowsCurrentVersionRundriver genius
Successfully deleted: [Registry Value] HKEY_LOCAL_MACHINESoftwareMicrosoftInternet ExplorerToolbar{1C46A0DD-D53E-46C4-A435-CA11103E255E}
Successfully repaired: [Registry Value] HKEY_LOCAL_MACHINESoftwareMicrosoftInternet ExplorerAboutURLsTabs

~~~ Registry Keys

Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_1_rasapi32
Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_1_rasmancs
Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_rasapi32
Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_rasmancs
Successfully deleted: [Registry Key] HKEY_CURRENT_USERSoftwareMicrosoftInternet ExplorerSearchScopes{C0A82207-8344-41F1-A040-BEBAA81FEE54}

~~~ Files

Successfully deleted: [File] C:Windowssystem32RENA6DE.tmp
Successfully deleted: [File] C:Windowssystem32RENA6DF.tmp

~~~ Folders

Successfully deleted: [Folder] "C:UsersUserappdatalocallowytd"
Successfully deleted: [Folder] "C:Windowssystem32ai_recyclebin"
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{1CFCDD62-6187-4378-8E2D-24833D1CCB5B}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{3DB399A4-5370-40A7-83EF-75CA91C3AFCE}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{7D560449-D69C-4CCA-9FFC-D1E3CE3CC7F6}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{A18883CF-114E-49F7-9963-DAE6FDDEFEE9}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{CDCD390C-BDB3-40B6-BF5C-0EE64591247B}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{DBCD12A3-7171-4FA6-AD55-4E2088D6EB5B}

~~~ FireFox

Successfully deleted: [File] C:UsersUserAppDataRoamingmozillafirefoxprofilesptoklpuh.defaultsearchpluginsprivitize.xml
Successfully deleted the following from C:UsersUserAppDataRoamingmozillafirefoxprofilesptoklpuh.defaultprefs.js

user_pref("extensions.privitize.admin", false);
user_pref("extensions.privitize.aflt", "5");
user_pref("extensions.privitize.appId", "{301966DF-A84B-4255-AAB9-574B5CE237E4}");
user_pref("extensions.privitize.autoRvrt", "false");
user_pref("extensions.privitize.dfltLng", "");
user_pref("extensions.privitize.dfltSrch", true);
user_pref("extensions.privitize.dnsErr", true);
user_pref("extensions.privitize.excTlbr", false);
user_pref("extensions.privitize.ffxUnstlRst", false);
user_pref("extensions.privitize.hmpg", true);

user_pref("extensions.privitize.id", "d65288460000000000002c27d72d77db");
user_pref("extensions.privitize.instlDay", "15876");
user_pref("extensions.privitize.instlRef", "");

user_pref("extensions.privitize.newTab", true);

user_pref("extensions.privitize.prdct", "privitize");
user_pref("extensions.privitize.prtnrId", "privitize");
user_pref("extensions.privitize.rvrt", "false");
user_pref("extensions.privitize.smplGrp", "none");
user_pref("extensions.privitize.tlbrId", "base");

user_pref("extensions.privitize.vrsn", "");
user_pref("extensions.privitize.vrsnTs", "");
user_pref("extensions.privitize.vrsni", "");

Emptied folder: C:UsersUserAppDataRoamingmozillafirefoxprofilesptoklpuh.defaultminidumps [1016 files]

~~~ Event Viewer Logs were cleared

Scan was completed on ўв 08.10.2013 Ј. at 14:24:01,13
End of JRT log



Malwarebytes Anti-Malware





Malwarebytes Anti-Malware

Database version: v2013.10.08.04

Windows 7 Service Pack 1 x86 NTFS
Internet Explorer 10.0.9200.16686
User :: HP [administrator]

8.10.2013 г. 14:30:19 ч.
MBAM-log-2013-10-08 (15-53-04).txt

Scan type: Full scan (C:|D:|)
Scan options enabled: Memory | Startup | Registry | File System | Heuristics/Extra | Heuristics/Shuriken | PUP | PUM
Scan options disabled: P2P
Objects scanned: 377679
Time elapsed: 1 hour(s), 20 minute(s), 49 second(s)

Memory Processes Detected: 0
(No malicious items detected)

Memory Modules Detected: 0
(No malicious items detected)

Registry Keys Detected: 0
(No malicious items detected)

Registry Values Detected: 0
(No malicious items detected)

Registry Data Items Detected: 0
(No malicious items detected)

Folders Detected: 0
(No malicious items detected)

Files Detected: 6
C:UsersUserAppDataLocalTempfUgRjIO1.zip.part (Trojan.Agent.HE) -> No action taken.
C:UsersUserDesktopНова папкаCDHackcdhack.dll (Trojan.Agent.H) -> No action taken.
D:DownloadsmarketSoftonicDownloader_for_tactical-ops-assault-on-terror.exe (PUP.Optional.Softonic.A) -> No action taken.
D:DownloadstalismanMedal.of.Honor.2010.Multi3.RU.RepackAutorun.exe (Trojan.Agent) -> No action taken.
D:DownloadstalismanMedal.of.Honor.2010.Multi3.RU.RepackMedal of HonorBinariesloader.dll (Riskware.Tool.CK) -> No action taken.
D:LFSLFSip-patch.exe (Backdoor.Bifrose) -> No action taken.


Редактирано от hippnozis (преглед на промените)

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Сканирайте отново с Malwarebytes Anti-Malware но този път маркирайте всички намерени обекти и натиснете Публикувано изображение .
..след това..:


Публикувано изображение Изтеглете ComboFix Публикувано изображение от тук и го запазете на десктопа си
Изключете вашата антивирусна и антишпионска програма, обикновено това става чрез натискане на десния бутон на мишката върху иконата на програма в системния трей.
Бележка: Ако не можете я спрете или не сте сигурни коя програма да изключите, моля прегледайте информацията от този линк: How to disable your security applications by amateur

Стартирайте Combo-Fix.com Публикувано изображение и следвайте инструкциите.
Бележка: ComboFix ще се стартира без инсталирана Recovery Console.
Като част от неговата работа, ComboFix ще провери дали Microsoft Windows Recovery Console е инсталирана. Предвид бързо развиващия се зловреден софтуер е силно препоръчително да бъде инсталирана преди премахването на зловредния софтуер. Това ще Ви позволи да влезете в специален recovery/repai режим, който ще ни позволи по-лесно да решите проблем, който би могъл да възникне при премахване на зловредния софтуер.

  • [*]Следвайте инструкциите, за да позволите на
ComboFix да изтегли и инсталира Microsoft Windows Recovery Console.В един момент ще бъдете попитани дали сте съгласни с лицензното споразумение. Необходимо е да потвърдите, че сте съгласни, за да инсталирате Microsoft Windows Recovery Console.

** Забележете: Ако Microsoft Windows Recovery Console е вече инсталирана, ComboFix ще продължи към процеса по премахване на зловредния софтуер.
Публикувано изображение
След като Microsoft Windows Recovery Console е инсталирана, използвайки ComboFix, Вие ще видите следното съобщение:
Публикувано изображение


Изберете Yes, за да продължи сканирането за зловреден софтуер.

Когато процесът приключи успешно, инструментът ще създаде лог файл. Моля, включете съдържанието на C:ComboFix.txt в следващия Ви коментар в тази тема.
Публикувано изображение Моля, не прикачвайте лог файла/овете от програмата, а го/ги копирайте и поставете в следващия Ви коментар в тази тема.

  • Харесва ми 2

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Malwarebytes Anti-Malware го оправих но не ми са създаде лог :no-no:

ако може да ми обясните пораженията по системата .. :)

ето лога от  ComboFix


ComboFix 13-10-08.01 - User 10.2013 г.  16:26:31.1.2 - x86
Microsoft Windows 7 Enterprise 6.1.7601.1.1251.359.1026.18.1917.1251 [GMT 3:00]
Running from: c:usersUserDownloadsComboFix.exe
AV: Microsoft Security Essentials *Disabled/Updated* {641105E6-77ED-3F35-A304-765193BCB75F}
SP: Microsoft Security Essentials *Disabled/Updated* {DF70E402-51D7-30BB-99B4-4D23E83BFDE2}
SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
 * Created a new restore point
((((((((((((((((((((((((((((((((((((((( Other Deletions )))))))))))))))))))))))))))))))))))))))))))))))))
c:usersUserAppDataLocalGoogleChromeUser DataDefaultPreferences
((((((((((((((((((((((((((((((((((((((( Drivers/Services )))))))))))))))))))))))))))))))))))))))))))))))))
((((((((((((((((((((((((( Files Created from 2013-09-09 to 2013-10-09  )))))))))))))))))))))))))))))))
2013-10-08 11:29 . 2013-10-08 11:29  --------  d-----w-  c:program filesMalwarebytes' Anti-Malware
2013-10-08 11:29 . 2013-04-04 11:50  22856  ----a-w-  c:windowssystem32driversmbam.sys
2013-10-08 11:21 . 2013-10-08 11:21  --------  d-----w-  c:windowsERUNT
2013-10-08 11:14 . 2013-10-08 11:17  --------  d-----w-  C:AdwCleaner
2013-10-05 17:39 . 2013-10-08 18:07  --------  d-----w-  c:usersUserAppDataRoaming.minecraft
2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:usersUserAppDataLocalLogMeIn
2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:programdataLogMeIn
2013-09-30 17:52 . 2013-09-30 17:52  --------  d-----w-  c:program filesAcclaim Entertainment
2013-09-11 17:49 . 2013-09-11 17:49  --------  d-----w-  c:programdataNexon
2013-09-11 16:49 . 2013-09-11 16:50  --------  d-----w-  c:usersUserAppDataLocalAkamai
2013-09-09 17:09 . 2013-09-09 17:09  --------  d--h--w-  c:program filesTemp
(((((((((((((((((((((((((((((((((((((((( Find3M Report ))))))))))))))))))))))))))))))))))))))))))))))))))))
2013-10-09 13:23 . 2013-10-09 13:23  40392  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{2757D113-8F0B-4D07-B3E8-681947E139C5}MpKsl70dd4d28.sys
2013-10-09 13:08 . 2012-03-30 11:00  692616  ----a-w-  c:windowssystem32FlashPlayerApp.exe
2013-10-09 13:08 . 2011-08-07 14:11  71048  ----a-w-  c:windowssystem32FlashPlayerCPLApp.cpl
2013-10-02 15:06 . 2012-07-21 23:29  37664  ----a-w-  c:windowssystem32driversavgtpx86.sys
2013-09-06 17:07 . 2013-09-06 17:07  718712  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{A791E496-9C9C-4EC1-BCB5-B6B12246FAC6}gapaengine.dll
2013-09-05 05:02 . 2013-10-09 11:31  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{2757D113-8F0B-4D07-B3E8-681947E139C5}mpengine.dll
2013-09-05 05:02 . 2013-10-08 11:31  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesBackupmpengine.dll
2013-08-22 18:02 . 2011-08-11 08:57  697992  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesNISBackupgapaengine.dll
2013-07-25 08:57 . 2013-08-14 11:25  1620992  ----a-w-  c:windowssystem32WMVDECOD.DLL
2013-07-19 01:41 . 2013-08-14 11:25  2048  ----a-w-  c:windowssystem32tzres.dll
2011-09-10 00:24 . 2013-10-01 15:48  119808  ----a-w-  c:program filesmozilla firefoxcomponentsGoogleDesktopMozilla.dll
((((((((((((((((((((((((((((((((((((( Reg Loading Points ))))))))))))))))))))))))))))))))))))))))))))))))))
*Note* empty entries & legit default entries are not shown
"DAEMON Tools Lite"="c:program filesDAEMON Tools LiteDTLite.exe" [2011-08-02 4910912]
"Sidebar"="c:program filesWindows Sidebarsidebar.exe" [2010-11-20 1174016]
"Skype"="c:program filesSkypePhoneSkype.exe" [2013-07-25 20684656]
"Akamai NetSession Interface"="c:usersUserAppDataLocalAkamainetsession_win.exe" [2013-06-04 4489472]
"BCSSync"="c:program filesMicrosoft OfficeOffice14BCSSync.exe" [2010-03-13 91520]
"ZSSnp211"="c:windowsZSSnp211.exe" [2007-04-06 57344]
"Google Desktop Search"="c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe" [2011-09-10 30192]
"MSC"="c:program filesMicrosoft Security Clientmsseces.exe" [2013-06-20 995176]
"IgfxTray"="c:windowssystem32igfxtray.exe" [2012-11-13 138784]
"HotKeysCmds"="c:windowssystem32hkcmd.exe" [2012-11-13 172064]
"Persistence"="c:windowssystem32igfxpers.exe" [2012-11-13 173600]
"SunJavaUpdateSched"="c:program filesCommon FilesJavaJava Updatejusched.exe" [2013-03-12 253816]
"LogMeIn Hamachi Ui"="d:downloadsmyНова папкаhamachi-2-ui.exe" [2013-10-01 2345296]
"ConsentPromptBehaviorUser"= 3 (0x3)
"EnableUIADesktopToggle"= 0 (0x0)
[HKEY_LOCAL_MACHINEsoftwaremicrosoftwindows ntcurrentversionwindows]
[HKLM~startupfolderC:^Users^User^AppData^Roaming^Microsoft^Windows^Start Menu^Programs^Startup^GamersFirst LIVE!.lnk]
path=c:usersUserAppDataRoamingMicrosoftWindowsStart MenuProgramsStartupGamersFirst LIVE!.lnk
backup=c:windowspssGamersFirst LIVE!.lnk.Startup
[HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregDomino]
2006-08-18 13:58  49152  ----a-w-  c:windowsDomino.exe
[HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregFacebook Update]
2012-07-11 20:44  138096  ----atw-  c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe
R2 SkypeUpdate;Skype Updater;c:program filesSkypeUpdaterUpdater.exe [2013-07-25 162672]
R2 vToolbarUpdater17.0.12;vToolbarUpdater17.0.12;c:program filesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exe [x]
R3 dmvsc;dmvsc;c:windowssystem32driversdmvsc.sys [2010-11-20 62464]
R3 EagleXNt;EagleXNt;c:windowssystem32driversEagleXNt.sys [x]
R3 FairplayKD;FairplayKD;c:programdataMTA San Andreas All1.3tempFairplayKD.sys [x]
R3 GoogleDesktopManager-051210-111108;Диспечер на Google Desktop 5.9.1005.12335;c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe [2011-09-10 30192]
R3 NisDrv;Microsoft Network Inspection System;c:windowssystem32DRIVERSNisDrvWFP.sys [2013-06-18 107392]
R3 NisSrv;Мрежова проверка на Microsoft;c:program filesMicrosoft Security ClientNisSrv.exe [2013-06-20 295376]
R3 RdpVideoMiniport;Remote Desktop Video Miniport Driver;c:windowssystem32driversrdpvideominiport.sys [2010-11-20 15872]
R3 Synth3dVsc;Synth3dVsc;c:windowssystem32driverssynth3dvsc.sys [2010-11-20 77184]
R3 terminpt;Microsoft Remote Desktop Input Driver;c:windowssystem32driversterminpt.sys [2010-11-20 25600]
R3 TsUsbFlt;TsUsbFlt;c:windowssystem32driverstsusbflt.sys [2010-11-20 52224]
R3 TsUsbGD;Remote Desktop Generic USB Device;c:windowssystem32driversTsUsbGD.sys [2010-11-20 27264]
R3 tsusbhub;tsusbhub;c:windowssystem32driverstsusbhub.sys [2010-11-20 112640]
R3 VGPU;VGPU;c:windowssystem32driversrdvgkmd.sys [x]
R3 vvftav211;vvftav211;c:windowssystem32driversvvftav211.sys [2007-12-10 480128]
R3 WatAdminSvc;Услуга на технологиите за активиране на Windows;c:windowssystem32WatWatAdminSvc.exe [2011-08-05 1343400]
R3 WinRing0_1_2_0;WinRing0_1_2_0;d:mcRazer Game BoosterDriverWinRing0.sys [x]
R3 XDva394;XDva394;c:windowssystem32XDva394.sys [x]
R3 XDva397;XDva397;c:windowssystem32XDva397.sys [x]
R3 XDva399;XDva399;c:windowssystem32XDva399.sys [x]
R3 XDva401;XDva401;c:windowssystem32XDva401.sys [x]
R3 ZSMC30x;USB PC Camera Service ZSMC30x;c:windowssystem32DriversZS211.sys [2007-12-05 1537024]
S1 avgtp;avgtp;c:windowssystem32driversavgtpx86.sys [2013-10-02 37664]
S1 dtsoftbus01;DAEMON Tools Virtual Bus Driver;c:windowssystem32DRIVERSdtsoftbus01.sys [2011-08-05 232512]
S1 MpKsl70dd4d28;MpKsl70dd4d28;c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{2757D113-8F0B-4D07-B3E8-681947E139C5}MpKsl70dd4d28.sys [2013-10-09 40392]
S2 Hamachi2Svc;LogMeIn Hamachi Tunneling Engine;d:downloadsmyНова папкаhamachi-2.exe [2013-10-01 1612112]
S2 RzKLService;RzKLService;d:mcRazer Game BoosterRzKLService.exe [2013-09-18 106472]
S2 Skype C2C Service;Skype C2C Service;c:programdataSkypeToolbarsSkype C2C Servicec2c_service.exe [2013-09-16 3273088]
S2 TeamViewer8;TeamViewer 8;c:program filesTeamViewerVersion8TeamViewer_Service.exe [2013-08-07 4308320]
S3 RTL8167;Realtek 8167 NT Driver;c:windowssystem32DRIVERSRt86win7.sys [2009-03-01 139776]
--- Other Services/Drivers In Memory ---
*NewlyCreated* - WS2IFSL
[HKEY_LOCAL_MACHINEsoftwaremicrosoftactive setupinstalled components{8A69D345-D564-463c-AFF1-A69D9E530F96}]
2013-10-06 11:22  1185744  ----a-w-  c:program filesGoogleChromeApplication30.0.1599.69Installerchrmstp.exe
Contents of the 'Scheduled Tasks' folder
2013-10-09 c:windowsTasksAdobe Flash Player Updater.job
- c:windowssystem32MacromedFlashFlashPlayerUpdateService.exe [2012-03-30 13:08]
2013-10-05 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000Core.job
- c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44]
2013-10-09 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000UA.job
- c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44]
2013-10-09 c:windowsTasksGoogleUpdateTaskMachineCore.job
- c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14]
2013-10-09 c:windowsTasksGoogleUpdateTaskMachineUA.job
- c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14]
------- Supplementary Scan -------

uInternet Settings,ProxyOverride = <local>
IE: Download all by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm
IE: Download by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm
IE: E&xport to Microsoft Excel - c:progra~1MICROS~2Office14EXCEL.EXE/3000
IE: Free YouTube Download - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeytvdownloader.htm
IE: Free YouTube to MP3 Converter - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeyoutubetomp3converter.htm
IE: Se&nd to OneNote - c:progra~1MICROS~2Office14ONBttnIE.dll/105
IE: ????3?? - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm
IE: ????3?????? - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm
Trusted Zone: clonewarsadventures.com
Trusted Zone: freerealms.com
Trusted Zone: soe.com
Trusted Zone: sony.com
FF - ProfilePath - c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.default
FF - prefs.js: browser.search.defaulturl -

FF - ExtSQL: 2013-09-30 19:10; WebSiteRecommendation@weliketheweb.com; c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultextensionsWebSiteRecommendation@weliketheweb.com
- - - - ORPHANS REMOVED - - - -
HKCU-Run-Clownfish - c:program filesClownfishClownfish.exe
MSConfigStartUp-Clownfish - c:program filesClownfishClownfish.exe
MSConfigStartUp-Steam - c:program filesSteamSteam.exe
AddRemove-Clownfish - c:program filesClownfishuninstall.exe
AddRemove-Driver Genius Professional Edition_is1 - d:downloadskamioniDriverGeniusunins000.exe
AddRemove-Minecraft 1.6.2 - c:usersUserAppDataRoaming.minecraftUninstal.exe
AddRemove-Minecraft1.6.2 - c:usersUserAppDataRoaming.minecraftminecraft launcherUninstall.exe
AddRemove-privitize - c:program filesIndustriyaprivitize1.8.21.6uninstall.exe
AddRemove-BeamNG-Techdemo-0.3 - d:mda eBeamNG-Techdemo-0.3uninst-BeamNG-Techdemo-0.3.exe
AddRemove-Counter-Strike 1.6 Escom 3d!7!0n - by AmaRelle v1.0 - d:downloadsskiiUninstal.exe
AddRemove-GamersFirst LIVE! - c:usersUserAppDataLocalGamersFirstLIVE!uninstall.exe
AddRemove-SOE-Magic The Gathering Tactics - d:downloadsНова папкаUninstaller.exe
AddRemove-World of Warcraft Trial - c:usersPublicDocumentsBlizzard EntertainmentWorld of Warcraft Trial (2)Uninstall.exe
--------------------- LOCKED REGISTRY KEYS ---------------------
[HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}Џ]
@Allowed: (Read) (RestrictedCode)
@="c:Program FilesFlashGet NetworkFlashGet 3GetUrl.htm"
[HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}ЏhQиђю”Ґc]
@Allowed: (Read) (RestrictedCode)
@="c:Program FilesFlashGet NetworkFlashGet 3GetAllUrl.htm"
@Denied: (A) (Users)
@Denied: (A) (Everyone)
@Allowed: (B 1 2 3 4 5) (S-1-5-20)
@Denied: (Full) (Everyone)
------------------------ Other Running Processes ------------------------
c:program filesMicrosoft Security ClientMsMpEng.exe
c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSVC.EXE
c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSvcM.exe
c:program filesWindows Media Playerwmpnetwk.exe
Completion time: 2013-10-09  16:37:58 - machine was rebooted
ComboFix-quarantined-files.txt  2013-10-09 13:37
Pre-Run: 19 964 141 568 bytes free
Post-Run: 19 761 917 952 bytes free
- - End Of File - - B349F3FA563916209B179A5B0B6BCCD9

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Копирайте текста в карето на notepad и го запазвате с име CFScript.txt на десктопа си:

KILLALL::ClearJavaCache::File::c:windowssystem32driversavgtpx86.sysc:program filesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exeFolder::c:usersUserAppDataRoaming.minecraftDriver::vToolbarUpdater17.0.12avgtpDDS::Trusted Zone: clonewarsadventures.comTrusted Zone: freerealms.comTrusted Zone: soe.comTrusted Zone: sony.com

След съхранението преместете  CFScript.txt на иконата на ComboFix.exe

Публикувано изображение

Генерирания рапорт копирайте  и го поставете в следващия си коментар...!

  • Харесва ми 1

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Ето лога






ComboFix 13-10-08.01 - User 10.2013 г.  16:48:42.2.2 - x86 Microsoft Windows 7 Enterprise 6.1.7601.1.1251.359.1026.18.1917.1130 [GMT 3:00] Running from: c:usersUserDownloadsComboFix.exe Command switches used :: c:usersUserDownloadsCFScript.txt.txt AV: Microsoft Security Essentials *Disabled/Updated* {641105E6-77ED-3F35-A304-765193BCB75F} SP: Microsoft Security Essentials *Disabled/Updated* {DF70E402-51D7-30BB-99B4-4D23E83BFDE2} SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}  * Created a new restore point . FILE :: "c:program filesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exe" "c:windowssystem32driversavgtpx86.sys" . . ((((((((((((((((((((((((((((((((((((((( Other Deletions ))))))))))))))))))))))))))))))))))))))))))))))))) . . c:usersUserAppDataLocalGoogleChromeUser DataDefaultPreferences c:usersUserAppDataRoaming.minecraft c:usersUserAppDataRoaming.minecraftassetsiconsicon_16x16.png c:usersUserAppDataRoaming.minecraftassetsiconsicon_32x32.png c:usersUserAppDataRoaming.minecraftassetsiconsminecraft.icns c:usersUserAppDataRoaming.minecraftassetslangaf_ZA.lang c:usersUserAppDataRoaming.minecraftassetslangar_SA.lang c:usersUserAppDataRoaming.minecraftassetslangbg_BG.lang c:usersUserAppDataRoaming.minecraftassetslangca_ES.lang c:usersUserAppDataRoaming.minecraftassetslangcs_CZ.lang c:usersUserAppDataRoaming.minecraftassetslangcy_GB.lang c:usersUserAppDataRoaming.minecraftassetslangda_DK.lang c:usersUserAppDataRoaming.minecraftassetslangde_DE.lang c:usersUserAppDataRoaming.minecraftassetslangel_GR.lang c:usersUserAppDataRoaming.minecraftassetslangen_AU.lang c:usersUserAppDataRoaming.minecraftassetslangen_CA.lang c:usersUserAppDataRoaming.minecraftassetslangen_GB.lang c:usersUserAppDataRoaming.minecraftassetslangen_PT.lang c:usersUserAppDataRoaming.minecraftassetslangeo_UY.lang c:usersUserAppDataRoaming.minecraftassetslanges_AR.lang c:usersUserAppDataRoaming.minecraftassetslanges_ES.lang c:usersUserAppDataRoaming.minecraftassetslanges_MX.lang c:usersUserAppDataRoaming.minecraftassetslanges_UY.lang c:usersUserAppDataRoaming.minecraftassetslanges_VE.lang c:usersUserAppDataRoaming.minecraftassetslanget_EE.lang c:usersUserAppDataRoaming.minecraftassetslangeu_ES.lang c:usersUserAppDataRoaming.minecraftassetslangfi_FI.lang c:usersUserAppDataRoaming.minecraftassetslangfr_CA.lang c:usersUserAppDataRoaming.minecraftassetslangfr_FR.lang c:usersUserAppDataRoaming.minecraftassetslangga_IE.lang c:usersUserAppDataRoaming.minecraftassetslanggl_ES.lang c:usersUserAppDataRoaming.minecraftassetslanghe_IL.lang c:usersUserAppDataRoaming.minecraftassetslanghi_IN.lang c:usersUserAppDataRoaming.minecraftassetslanghr_HR.lang c:usersUserAppDataRoaming.minecraftassetslanghu_HU.lang c:usersUserAppDataRoaming.minecraftassetslanghy_AM.lang c:usersUserAppDataRoaming.minecraftassetslangid_ID.lang c:usersUserAppDataRoaming.minecraftassetslangis_IS.lang c:usersUserAppDataRoaming.minecraftassetslangit_IT.lang c:usersUserAppDataRoaming.minecraftassetslangja_JP.lang c:usersUserAppDataRoaming.minecraftassetslangka_GE.lang c:usersUserAppDataRoaming.minecraftassetslangko_KR.lang c:usersUserAppDataRoaming.minecraftassetslangkw_GB.lang c:usersUserAppDataRoaming.minecraftassetslangky_KG.lang c:usersUserAppDataRoaming.minecraftassetslangla_LA.lang c:usersUserAppDataRoaming.minecraftassetslanglt_LT.lang c:usersUserAppDataRoaming.minecraftassetslanglv_LV.lang c:usersUserAppDataRoaming.minecraftassetslangmi_NZ.lang c:usersUserAppDataRoaming.minecraftassetslangms_MY.lang c:usersUserAppDataRoaming.minecraftassetslangmt_MT.lang c:usersUserAppDataRoaming.minecraftassetslangnb_NO.lang c:usersUserAppDataRoaming.minecraftassetslangnl_NL.lang c:usersUserAppDataRoaming.minecraftassetslangnn_NO.lang c:usersUserAppDataRoaming.minecraftassetslangno_NO.lang c:usersUserAppDataRoaming.minecraftassetslangoc_FR.lang c:usersUserAppDataRoaming.minecraftassetslangpl_PL.lang c:usersUserAppDataRoaming.minecraftassetslangpt_BR.lang c:usersUserAppDataRoaming.minecraftassetslangpt_PT.lang c:usersUserAppDataRoaming.minecraftassetslangqya_AA.lang c:usersUserAppDataRoaming.minecraftassetslangro_RO.lang c:usersUserAppDataRoaming.minecraftassetslangru_RU.lang c:usersUserAppDataRoaming.minecraftassetslangsk_SK.lang c:usersUserAppDataRoaming.minecraftassetslangsl_SI.lang c:usersUserAppDataRoaming.minecraftassetslangsr_SP.lang c:usersUserAppDataRoaming.minecraftassetslangsv_SE.lang c:usersUserAppDataRoaming.minecraftassetslangth_TH.lang c:usersUserAppDataRoaming.minecraftassetslangtlh_AA.lang c:usersUserAppDataRoaming.minecraftassetslangtr_TR.lang c:usersUserAppDataRoaming.minecraftassetslanguk_UA.lang c:usersUserAppDataRoaming.minecraftassetslangvi_VN.lang c:usersUserAppDataRoaming.minecraftassetslangzh_CN.lang c:usersUserAppDataRoaming.minecraftassetslangzh_TW.lang c:usersUserAppDataRoaming.minecraftassetsmusiccalm1.ogg c:usersUserAppDataRoaming.minecraftassetsmusiccalm2.ogg c:usersUserAppDataRoaming.minecraftassetsmusiccalm3.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal1.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal2.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal3.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal4.ogg c:usersUserAppDataRoaming.minecraftassetsmusicnuance1.ogg c:usersUserAppDataRoaming.minecraftassetsmusicnuance2..ogg c:usersUserAppDataRoaming.minecraftassetsmusicnuance2.ogg c:usersUserAppDataRoaming.minecraftassetsmusicpiano1.ogg c:usersUserAppDataRoaming.minecraftassetsmusicpiano2.ogg c:usersUserAppDataRoaming.minecraftassetsmusicpiano3.ogg c:usersUserAppDataRoaming.minecraftassetspack.mcmeta c:usersUserAppDataRoaming.minecraftassetsREAD_ME_I_AM_VERY_IMPORTANT c:usersUserAppDataRoaming.minecraftassetsrecords11.ogg c:usersUserAppDataRoaming.minecraftassetsrecords13.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsblocks.ogg c:usersUserAppDataRoaming.minecraftassetsrecordscat.ogg c:usersUserAppDataRoaming.minecraftassetsrecordschirp.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsfar.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsmall.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsmellohi.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsstal.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsstrad.ogg c:usersUserAppDataRoaming.minecraftassetsrecordswait.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsward.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave1.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave10.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave11.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave12.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave13.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave2.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave3.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave4.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave5.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave6.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave7.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave8.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave9.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain1.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain2.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain3.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain4.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherthunder1.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherthunder2.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherthunder3.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagefallbig.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagefallsmall.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagehit1.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagehit2.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagehit3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth4.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass1.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass2.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass3.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass4.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel1.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel2.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel3.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundfirefire.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireignite.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworksblast_far1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworksblast1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkslargeBlast_far1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkslargeBlast1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkslaunch1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkstwinkle_far1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkstwinkle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidlava.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidlavapop.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidsplash.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidsplash2.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim1.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim2.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim3.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim4.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidwater.ogg c:usersUserAppDataRoaming.minecraftassetssoundminecartbase.ogg c:usersUserAppDataRoaming.minecraftassetssoundminecartinside.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatloop.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbattakeoff.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathiss1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathiss2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathiss3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathitt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathitt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathitt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurr1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurr2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurr3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurreow1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurreow2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenplop.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickensay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickensay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickensay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreeperdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonend.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermendeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenportal.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenportal2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenstare.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastaffectionate_scream.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastcharge.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastfireball4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan7.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseangry1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsearmor.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsebreathe1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsebreathe2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsebreathe3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyangry1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyangry2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeydeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsejump.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseland.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseleather.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletondeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombieidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombieidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombieidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemthrow.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepshear.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishkill.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletondeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimeattack1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimeattack2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhaggle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhaggle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhaggle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageridle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageridle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageridle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerno1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerno2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerno3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageryes1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageryes2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageryes3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwithershoot.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherspawn.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfbark1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfbark2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfbark3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfgrowl1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfgrowl2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfgrowl3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhowl1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhowl2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfpanting.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfshake.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfwhine.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiehurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiehurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombieinfect.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiemetal1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiemetal2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiemetal3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombieremedy.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiesay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiesay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiesay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombieunfect.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewoodbreak.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpighurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpighurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotebass.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotebassattack.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotebd.ogg c:usersUserAppDataRoaming.minecraftassetssoundnoteharp.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotehat.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotepling.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotesnare.ogg c:usersUserAppDataRoaming.minecraftassetssoundportalportal.ogg c:usersUserAppDataRoaming.minecraftassetssoundportaltravel.ogg c:usersUserAppDataRoaming.minecraftassetssoundportaltrigger.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomanvil_break.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomanvil_land.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomanvil_use.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombow.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombreak.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombreath.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomburp.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomchestclosed.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomchestopen.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomclassic_hurt.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomclick.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomdoor_close.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomdoor_open.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomdrink.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomeat1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomeat2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomeat3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode4.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomfizz.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomfuse.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomglass1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomglass2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomglass3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomlevelup.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomorb.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandompop.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomsplash.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomsuccessful_hit.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomwood_click.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass6.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone6.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood6.ogg c:usersUserAppDataRoaming.minecraftassetssoundtilepistonin.ogg c:usersUserAppDataRoaming.minecraftassetssoundtilepistonout.ogg c:usersUserAppDataRoaming.minecraftgamefiles.zip c:usersUserAppDataRoaming.minecrafths_err_pid1008.log c:usersUserAppDataRoaming.minecrafths_err_pid3184.log c:usersUserAppDataRoaming.minecrafths_err_pid4160.log c:usersUserAppDataRoaming.minecraftlauncheroptions.txt c:usersUserAppDataRoaming.minecraftlibrariesargo-2.25_fixed.jar c:usersUserAppDataRoaming.minecraftlibrariesasm-all-4.1.jar c:usersUserAppDataRoaming.minecraftlibrariesbcprov-jdk15on-1.47.jar c:usersUserAppDataRoaming.minecraftlibrariescodecjorbis-20101023.jar c:usersUserAppDataRoaming.minecraftlibrariescodecwav-20101023.jar c:usersUserAppDataRoaming.minecraftlibrariescommons-io-2.4.jar c:usersUserAppDataRoaming.minecraftlibrariescommons-lang3-3.1.jar c:usersUserAppDataRoaming.minecraftlibrariesgson-2.2.2.jar c:usersUserAppDataRoaming.minecraftlibrariesguava-14.0.jar c:usersUserAppDataRoaming.minecraftlibrariesjinput-2.0.5.jar c:usersUserAppDataRoaming.minecraftlibrariesjinput-platform-2.0.5-natives-windows.jar c:usersUserAppDataRoaming.minecraftlibrariesjopt-simple-4.5.jar c:usersUserAppDataRoaming.minecraftlibrariesjutils-1.0.0.jar c:usersUserAppDataRoaming.minecraftlibrarieslibraryjavasound-20101123.jar c:usersUserAppDataRoaming.minecraftlibrarieslibrarylwjglopenal-20100824.jar c:usersUserAppDataRoaming.minecraftlibrarieslwjgl-2.9.0.jar c:usersUserAppDataRoaming.minecraftlibrarieslwjgl-platform-2.9.0-natives-windows.jar c:usersUserAppDataRoaming.minecraftlibrarieslwjgl_util-2.9.0.jar c:usersUserAppDataRoaming.minecraftlibrarieslzma-0.0.1.jar c:usersUserAppDataRoaming.minecraftlibrariessoundsystem-20120107.jar c:usersUserAppDataRoaming.minecraftMinecraft.exe c:usersUserAppDataRoaming.minecraftoptions.txt c:usersUserAppDataRoaming.minecraftoptionsof.txt c:usersUserAppDataRoaming.minecraftoutput-client.log c:usersUserAppDataRoaming.minecraftoutput-client.log.1 c:usersUserAppDataRoaming.minecraftoutput-client.log.2 c:usersUserAppDataRoaming.minecraftoutput-client.log.3 c:usersUserAppDataRoaming.minecraftoutput-server.log c:usersUserAppDataRoaming.minecraftoutput-server.log.1 c:usersUserAppDataRoaming.minecraftoutput-server.log.1.lck c:usersUserAppDataRoaming.minecraftoutput-server.log.2 c:usersUserAppDataRoaming.minecraftresourcepacks1.6_Flows_HD_128x_beta.zip c:usersUserAppDataRoaming.minecraftsavesasddataMineshaft.dat c:usersUserAppDataRoaming.minecraftsavesasddatavillages.dat c:usersUserAppDataRoaming.minecraftsavesasdlevel.dat c:usersUserAppDataRoaming.minecraftsavesasdlevel.dat_mcr c:usersUserAppDataRoaming.minecraftsavesasdlevel.dat_old c:usersUserAppDataRoaming.minecraftsavesasdplayershippnozis.dat c:usersUserAppDataRoaming.minecraftsavesasdregionr.-1.-1.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.-1.0.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.-2.-1.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.-2.0.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.0.-1.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.0.0.mca c:usersUserAppDataRoaming.minecraftsavesasdsession.lock c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISdataMineshaft.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISdatavillages.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISlevel.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISlevel.dat_mcr c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISlevel.dat_old c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISplayershippnozis.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.-1.-1.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.-1.0.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.0.-1.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.0.0.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISsession.lock c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdataMineshaft.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdataStronghold.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdataTemple.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdatavillages.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGlevel.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGlevel.dat_mcr c:usersUserAppDataRoaming.minecraftsaveshippnozisBGlevel.dat_old c:usersUserAppDataRoaming.minecraftsaveshippnozisBGplayershippnozis.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-1.-1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-1.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-2.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-2.1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-2.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.3.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-4.1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-4.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-4.3.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-5.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-5.3.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.0.-1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.0.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGsession.lock c:usersUserAppDataRoaming.minecraftscreenshots2013-10-05_20.44.58.png c:usersUserAppDataRoaming.minecraftscreenshots2013-10-05_20.59.59.png c:usersUserAppDataRoaming.minecraftstatsstats_hippnozis_unsent.dat c:usersUserAppDataRoaming.minecraftstatsstats_hippnozis_unsent.old c:usersUserAppDataRoaming.minecraftversions1. c:usersUserAppDataRoaming.minecraftversions1.6.4Optifine1.6.4Optifine.jar c:usersUserAppDataRoaming.minecraftversionsnativesjinput-dx8.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-dx8_64.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-raw.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-raw_64.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-wintab.dll c:usersUserAppDataRoaming.minecraftversionsnativeslwjgl.dll c:usersUserAppDataRoaming.minecraftversionsnativeslwjgl64.dll c:usersUserAppDataRoaming.minecraftversionsnativesOpenAL32.dll c:usersUserAppDataRoaming.minecraftversionsnativesOpenAL64.dll c:windowssystem32driversavgtpx86.sys c:windowssystem32frapsvid.dll . . ((((((((((((((((((((((((((((((((((((((( Drivers/Services ))))))))))))))))))))))))))))))))))))))))))))))))) . . -------Legacy_AVGTP -------Service_avgtp . . ((((((((((((((((((((((((( Files Created from 2013-09-10 to 2013-10-10  ))))))))))))))))))))))))))))))) . . 2013-10-08 11:29 . 2013-10-08 11:29  --------  d-----w-  c:program filesMalwarebytes' Anti-Malware 2013-10-08 11:29 . 2013-04-04 11:50  22856  ----a-w-  c:windowssystem32driversmbam.sys 2013-10-08 11:21 . 2013-10-08 11:21  --------  d-----w-  c:windowsERUNT 2013-10-08 11:14 . 2013-10-08 11:17  --------  d-----w-  C:AdwCleaner 2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:usersUserAppDataLocalLogMeIn 2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:programdataLogMeIn 2013-09-30 17:52 . 2013-09-30 17:52  --------  d-----w-  c:program filesAcclaim Entertainment 2013-09-11 17:49 . 2013-09-11 17:49  --------  d-----w-  c:programdataNexon 2013-09-11 16:49 . 2013-09-11 16:50  --------  d-----w-  c:usersUserAppDataLocalAkamai . . . (((((((((((((((((((((((((((((((((((((((( Find3M Report )))))))))))))))))))))))))))))))))))))))))))))))))))) . 2013-10-10 13:45 . 2013-10-10 13:45  40392  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{22508C58-C50A-41F9-89D2-F57EA351158A}MpKsl83bfdb04.sys 2013-10-09 13:08 . 2012-03-30 11:00  692616  ----a-w-  c:windowssystem32FlashPlayerApp.exe 2013-10-09 13:08 . 2011-08-07 14:11  71048  ----a-w-  c:windowssystem32FlashPlayerCPLApp.cpl 2013-09-06 17:07 . 2013-09-06 17:07  718712  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{A791E496-9C9C-4EC1-BCB5-B6B12246FAC6}gapaengine.dll 2013-09-05 05:02 . 2013-10-09 16:59  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{22508C58-C50A-41F9-89D2-F57EA351158A}mpengine.dll 2013-09-05 05:02 . 2013-10-09 14:55  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesBackupmpengine.dll 2013-08-22 18:02 . 2011-08-11 08:57  697992  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesNISBackupgapaengine.dll 2013-07-25 08:57 . 2013-08-14 11:25  1620992  ----a-w-  c:windowssystem32WMVDECOD.DLL 2013-07-19 01:41 . 2013-08-14 11:25  2048  ----a-w-  c:windowssystem32tzres.dll 2011-09-10 00:24 . 2013-10-01 15:48  119808  ----a-w-  c:program filesmozilla firefoxcomponentsGoogleDesktopMozilla.dll . . ((((((((((((((((((((((((((((((((((((( Reg Loading Points )))))))))))))))))))))))))))))))))))))))))))))))))) . . *Note* empty entries & legit default entries are not shown REGEDIT4 . [HKEY_CURRENT_USERSOFTWAREMicrosoftWindowsCurrentVersionRun] "DAEMON Tools Lite"="c:program filesDAEMON Tools LiteDTLite.exe" [2011-08-02 4910912] "Sidebar"="c:program filesWindows Sidebarsidebar.exe" [2010-11-20 1174016] "Skype"="c:program filesSkypePhoneSkype.exe" [2013-10-02 20472992] "Akamai NetSession Interface"="c:usersUserAppDataLocalAkamainetsession_win.exe" [2013-06-04 4489472] . [HKEY_LOCAL_MACHINESOFTWAREMicrosoftWindowsCurrentVersionRun] "BCSSync"="c:program filesMicrosoft OfficeOffice14BCSSync.exe" [2010-03-13 91520] "ZSSnp211"="c:windowsZSSnp211.exe" [2007-04-06 57344] "Google Desktop Search"="c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe" [2011-09-10 30192] "MSC"="c:program filesMicrosoft Security Clientmsseces.exe" [2013-06-20 995176] "IgfxTray"="c:windowssystem32igfxtray.exe" [2012-11-13 138784] "HotKeysCmds"="c:windowssystem32hkcmd.exe" [2012-11-13 172064] "Persistence"="c:windowssystem32igfxpers.exe" [2012-11-13 173600] "SunJavaUpdateSched"="c:program filesCommon FilesJavaJava Updatejusched.exe" [2013-03-12 253816] "LogMeIn Hamachi Ui"="d:downloadsmyНова папкаhamachi-2-ui.exe" [2013-10-01 2345296] . [HKEY_LOCAL_MACHINEsoftwaremicrosoftwindowscurrentversionpoliciessystem] "ConsentPromptBehaviorUser"= 3 (0x3) "EnableUIADesktopToggle"= 0 (0x0) . [HKEY_LOCAL_MACHINEsoftwaremicrosoftwindows ntcurrentversionwindows] "AppInit_DLLs"=c:progra~1GoogleGOOGLE~2GoogleDesktopNetwork3.dll . [HKEY_LOCAL_MACHINESYSTEMCurrentControlSetControlSafeBootMinimalMsMpSvc] @="Service" . [HKLM~startupfolderC:^Users^User^AppData^Roaming^Microsoft^Windows^Start Menu^Programs^Startup^GamersFirst LIVE!.lnk] path=c:usersUserAppDataRoamingMicrosoftWindowsStart MenuProgramsStartupGamersFirst LIVE!.lnk backup=c:windowspssGamersFirst LIVE!.lnk.Startup backupExtension=.Startup . [HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregDomino] 2006-08-18 13:58  49152  ----a-w-  c:windowsDomino.exe . [HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregFacebook Update] 2012-07-11 20:44  138096  ----atw-  c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe . R2 SkypeUpdate;Skype Updater;c:program filesSkypeUpdaterUpdater.exe [2013-09-05 171680] R3 dmvsc;dmvsc;c:windowssystem32driversdmvsc.sys [2010-11-20 62464] R3 EagleXNt;EagleXNt;c:windowssystem32driversEagleXNt.sys [x] R3 FairplayKD;FairplayKD;c:programdataMTA San Andreas All1.3tempFairplayKD.sys [x] R3 GoogleDesktopManager-051210-111108;Диспечер на Google Desktop 5.9.1005.12335;c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe [2011-09-10 30192] R3 NisDrv;Microsoft Network Inspection System;c:windowssystem32DRIVERSNisDrvWFP.sys [2013-06-18 107392] R3 NisSrv;Мрежова проверка на Microsoft;c:program filesMicrosoft Security ClientNisSrv.exe [2013-06-20 295376] R3 RdpVideoMiniport;Remote Desktop Video Miniport Driver;c:windowssystem32driversrdpvideominiport.sys [2010-11-20 15872] R3 Synth3dVsc;Synth3dVsc;c:windowssystem32driverssynth3dvsc.sys [2010-11-20 77184] R3 terminpt;Microsoft Remote Desktop Input Driver;c:windowssystem32driversterminpt.sys [2010-11-20 25600] R3 TsUsbFlt;TsUsbFlt;c:windowssystem32driverstsusbflt.sys [2010-11-20 52224] R3 TsUsbGD;Remote Desktop Generic USB Device;c:windowssystem32driversTsUsbGD.sys [2010-11-20 27264] R3 tsusbhub;tsusbhub;c:windowssystem32driverstsusbhub.sys [2010-11-20 112640] R3 VGPU;VGPU;c:windowssystem32driversrdvgkmd.sys [x] R3 vvftav211;vvftav211;c:windowssystem32driversvvftav211.sys [2007-12-10 480128] R3 WatAdminSvc;Услуга на технологиите за активиране на Windows;c:windowssystem32WatWatAdminSvc.exe [2011-08-05 1343400] R3 WinRing0_1_2_0;WinRing0_1_2_0;d:mcRazer Game BoosterDriverWinRing0.sys [x] R3 XDva394;XDva394;c:windowssystem32XDva394.sys [x] R3 XDva397;XDva397;c:windowssystem32XDva397.sys [x] R3 XDva399;XDva399;c:windowssystem32XDva399.sys [x] R3 XDva401;XDva401;c:windowssystem32XDva401.sys [x] R3 ZSMC30x;USB PC Camera Service ZSMC30x;c:windowssystem32DriversZS211.sys [2007-12-05 1537024] S1 dtsoftbus01;DAEMON Tools Virtual Bus Driver;c:windowssystem32DRIVERSdtsoftbus01.sys [2011-08-05 232512] S1 MpKsl83bfdb04;MpKsl83bfdb04;c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{22508C58-C50A-41F9-89D2-F57EA351158A}MpKsl83bfdb04.sys [2013-10-10 40392] S2 Hamachi2Svc;LogMeIn Hamachi Tunneling Engine;d:downloadsmyНова папкаhamachi-2.exe [2013-10-01 1612112] S2 RzKLService;RzKLService;d:mcRazer Game BoosterRzKLService.exe [2013-09-18 106472] S2 Skype C2C Service;Skype C2C Service;c:programdataSkypeToolbarsSkype C2C Servicec2c_service.exe [2013-09-16 3273088] S2 TeamViewer8;TeamViewer 8;c:program filesTeamViewerVersion8TeamViewer_Service.exe [2013-08-07 4308320] S3 RTL8167;Realtek 8167 NT Driver;c:windowssystem32DRIVERSRt86win7.sys [2009-03-01 139776] . . [HKEY_LOCAL_MACHINEsoftwaremicrosoftactive setupinstalled components{8A69D345-D564-463c-AFF1-A69D9E530F96}] 2013-10-06 11:22  1185744  ----a-w-  c:program filesGoogleChromeApplication30.0.1599.69Installerchrmstp.exe . Contents of the 'Scheduled Tasks' folder . 2013-10-10 c:windowsTasksAdobe Flash Player Updater.job - c:windowssystem32MacromedFlashFlashPlayerUpdateService.exe [2012-03-30 13:08] . 2013-10-05 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000Core.job - c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44] . 2013-10-10 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000UA.job - c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44] . 2013-10-10 c:windowsTasksGoogleUpdateTaskMachineCore.job - c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14] . 2013-10-10 c:windowsTasksGoogleUpdateTaskMachineUA.job - c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14] . . ------- Supplementary Scan ------- . uInternet Settings,ProxyOverride = <local> IE: Download all by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm IE: Download by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm IE: E&xport to Microsoft Excel - c:progra~1MICROS~2Office14EXCEL.EXE/3000 IE: Free YouTube Download - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeytvdownloader.htm IE: Free YouTube to MP3 Converter - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeyoutubetomp3converter.htm IE: Se&nd to OneNote - c:progra~1MICROS~2Office14ONBttnIE.dll/105 IE: ????3?? - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm IE: ????3?????? - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm FF - ProfilePath - c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.default FF - prefs.js: browser.search.defaulturl - FF - ExtSQL: 2013-09-30 19:10; WebSiteRecommendation@weliketheweb.com; c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultextensionsWebSiteRecommendation@weliketheweb.com . . --------------------- LOCKED REGISTRY KEYS --------------------- . [HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}Џ] @Allowed: (Read) (RestrictedCode) @="c:Program FilesFlashGet NetworkFlashGet 3GetUrl.htm" "contexts"=dword:00000022 . [HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}ЏhQиђю”Ґc] @Allowed: (Read) (RestrictedCode) @="c:Program FilesFlashGet NetworkFlashGet 3GetAllUrl.htm" "contexts"=dword:000000f3 . [HKEY_LOCAL_MACHINESYSTEMControlSet001ControlClass{4D36E96D-E325-11CE-BFC1-08002BE10318}0000AllUserSettings] @Denied: (A) (Users) @Denied: (A) (Everyone) @Allowed: (B 1 2 3 4 5) (S-1-5-20) "BlindDial"=dword:00000000 . [HKEY_LOCAL_MACHINESYSTEMControlSet001ControlPCWSecurity] @Denied: (Full) (Everyone) . ------------------------ Other Running Processes ------------------------ . c:program filesMicrosoft Security ClientMsMpEng.exe c:windowssystem32PnkBstrA.exe c:windowssystem32taskhost.exe c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSVC.EXE c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSvcM.exe d:downloadsmyd:downloadsmyd:downloadsmyd:downloadsmyc:windowssystem32svchost.exe c:windowsSystem32WUDFHost.exe c:windowssystem32conhost.exe c:windowssystem32DllHost.exe c:windowssystem32sppsvc.exe c:program filesWindows Media Playerwmpnetwk.exe c:windowssystem32taskhost.exe . ************************************************************************** . Completion time: 2013-10-10  17:00:57 - machine was rebooted ComboFix-quarantined-files.txt  2013-10-10 14:00 ComboFix2.txt  2013-10-09 13:37 . Pre-Run: 20 357 251 072 bytes free Post-Run: 20 209 168 384 bytes free . - - End Of File - - 393043544EF5FC5DEAE02717291FDDBF A36C5E4F47E84449FF07ED3517B43A31  

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Какво е положението със системата ви след процедурите до тук..? Наблюдавате ли първоначалните проблеми...?

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Системата се държи доста добре.Имам чувството че все едно е преинсталирана .. :)


Радвам се ,че съм бил полезен..! :)



Деинсталирайте ComboFix така:

[*]Натиснете Start ==> Run ==> въведете командата Combofix /Uninstall ==> OK

[*]Публикувано изображение

[*]Моля, следвайте инструкциите, за да деинсталирате ComboFix. Ще получите съобщение, в което се казва ComboFix е деинсталиран успешно.


Публикувано изображение Изтеглете Delfix.exe и го стартирайте. Сложете отметка пред Remove disinfection tools => натиснете бутона Run Инструмента ще се самоизтрие след като приключи своята задача!


Публикувано изображение Деинсталирайте adwcleaner.exe

[*]Моля, затворете всички отворени програми и интернет браузъри.

[*]Кликнете два пъти върху adwcleaner.exe за да стартирате инструмента.

[*]Кликнете върху Uninstall .

[*]Щракнете върху Yes за да деинсталирате Adwcleaner


Публикувано изображение Изтрийте всичко друго което е останало след процедурите (използвано в лечението).Препоръчвам програмата Malwarebytes' Anti-Malware  да остане на вашия компютър и периодично да сканирате системата си с нея (поне един -два пъти в седмицата),като не забравяйте да обновите дефинициите и преди всяко сканиране..!


Стартирайте PatchMyPC и инсталирайте всички ъпдейти, които инструмента ви предложи.


Ако няма други проблеми,маркирам случая за "РЕШЕН"..Бъдете здрави и ви пожелавам безопасен интернет..! :)

  • Харесва ми 2

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Регистрирайте се или влезете в профила си за да коментирате

Трябва да имате регистрация за да може да коментирате това

Регистрирайте се

Създайте нова регистрация в нашия форум. Лесно е!

Нова регистрация


Имате регистрация? Влезте от тук.


  • Разглеждащи това в момента   0 потребители

    Няма регистрирани потребители разглеждащи тази страница.

  • Горещи теми в момента

  • Подобни теми

    • от D101149
      Здравейте! Имам вируси в компютъра. Имах Malwebytes anti-virus, изтече му лиценза пробният и го махнах и сега съм с есет за 30 дена. По-добър от Malwerbytes обаче постоянно ми вади някакъв вирус като вляза в chrome за CoinMiner
      прикачам файловете, които са ви нужни. благодаря!

    • от ℒℴ♥e
      Значи проблема е, че ми се товари процесора без видима причина, и към бонус това ми спами, някакви рандом реклами в браузера през (период от-време) без, да го стартирам, дори! (той сам се стартира)
      Вече съм с win10 pro и не знам какви са пръвите стъпки, които да направя (ако нещо се е променило (от преди време) да ми кажете), какво се правеше от самото начало?
      Като се има в предвид, че евентуално вирусите ми блокират "Malwarebytes Anti-Malware" (не се стартира след инстал) и може би, да са двойно повече от посл. път (към 500, да кажем сега).
      Не мога и да изтегля Farbar Recovery Scan Tool да кача! Не мога да го download изобщо. Браузера, които и да е, изключва при стартиране на линка!!
      Не завиждам, всъщност на този, който би се занимал с мен. И предварително, се извинявам на всеки, който съм обидил по-някакъв начин!
      И също така, съм много признателен на всички Вас, които ми оправихте последния мега-тера-гига-удар, който понесе компютъра ми, преди време и до-сега работи безотказно !!!
    • от ivan_pop
      Компютъра е с Win 8.1/32bit.През 2-3 минути в горния десен ъгъл ми излиза това съобщение.
      post a picture
      Това е от днес около обяд.Не съм забелязал да има проблем с работата на компютъра.Пуснах ъпдейти и съобщението пак си излиза.
      А в долния десен ъгъл,заедно с горното съобщение,излиза това.
      image hosting over 5mb
      Моля за помощ!
    • от Erkant Etem
      Здравейте , 
      Беше ми нужно инсталирането на Microsoft Office Pack-ет , по - стара версия и поради това използвах keygen (portable) версия потърсена чрез google търсачката и от тогава имам проблем с изкачащ прозорец от време на време ... С Windows 10 64 bit съм и използвам Chrome  и от време на време само тръгва да зарежда един и същ сайт при което аз го махам , но ми се струва , че е нещо сериозно ... Също ми се случи и без отворен Chrome , само да си зарежда Chrome и да стартира съответния сайт , мисля , че е някъкъв руски , защото изписва .ru и нещо си - "checker id" после пренасочва към някъкъв друг сайт - "3305382455.linkshort.pro"  .  
      Едит: Сайта , който изписва checking visitor , a не checker id e - di1stero.com  и отново само си пусна chorme и започна да зарежда споменатата страница... винаги е едно и също..  От .ru на checker id - di1stero.com   и след това 3305382455.linkshort.pro"  ...
      Благодаря предварително.
      Scan result of Farbar Recovery Scan Tool (FRST) (x64) Version: 16.05.2018 01
      Ran by Erkant (administrator) on DESKTOP-LLNRL7P (21-05-2018 16:15:21)
      Running from C:\Users\Erkant\Downloads
      Loaded Profiles: Erkant (Available Profiles: Erkant)
      Platform: Windows 10 Pro Version 1709 16299.431 (X64) Language: English (United States)
      Internet Explorer Version 11 (Default browser: Chrome)
      Boot Mode: Normal
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      (NVIDIA Corporation) C:\Program Files\NVIDIA Corporation\Display.NvContainer\NVDisplay.Container.exe
      (NVIDIA Corporation) C:\Program Files\NVIDIA Corporation\Display.NvContainer\NVDisplay.Container.exe
      (Microsoft Corporation) C:\ProgramData\Microsoft\Windows Defender\Platform\4.14.17639.18041-0\MsMpEng.exe
      () C:\Program Files\WindowsApps\Microsoft.SkypeApp_12.1813.286.0_x64__kzf8qxf38zg5c\SkypeHost.exe
      (Microsoft Corporation) C:\Program Files\Windows Defender\MSASCuiL.exe
      (Malwarebytes) C:\Program Files\Malwarebytes\Anti-Malware\MBAMService.exe
      (Microsoft Corporation) C:\ProgramData\Microsoft\Windows Defender\Platform\4.14.17639.18041-0\NisSrv.exe
      (Malwarebytes) C:\Program Files\Malwarebytes\Anti-Malware\mbamtray.exe
      (Oracle Corporation) C:\Program Files (x86)\Common Files\Java\Java Update\jusched.exe
      (Valve Corporation) C:\Program Files (x86)\Steam\Steam.exe
      (Valve Corporation) C:\Program Files (x86)\Steam\bin\cef\cef.win7\steamwebhelper.exe
      (Valve Corporation) C:\Program Files (x86)\Steam\bin\cef\cef.win7\steamwebhelper.exe
      (Valve Corporation) C:\Program Files (x86)\Common Files\Steam\SteamService.exe
      (Valve Corporation) C:\Program Files (x86)\Steam\bin\cef\cef.win7\steamwebhelper.exe
      (Valve Corporation) C:\Program Files (x86)\Steam\bin\cef\cef.win7\steamwebhelper.exe
      (Valve Corporation) C:\Program Files (x86)\Steam\bin\cef\cef.win7\steamwebhelper.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Microsoft Corporation) C:\Windows\System32\dllhost.exe
      (Microsoft Corporation) C:\Windows\SystemApps\Microsoft.Windows.SecHealthUI_cw5n1h2txyewy\SecHealthUI.exe
      (Microsoft Corporation) C:\Windows\System32\dllhost.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [SecurityHealth] => C:\Program Files\Windows Defender\MSASCuiL.exe [630168 2017-09-29] (Microsoft Corporation)
      HKLM\...\Run: [RTHDVCPL] => C:\Program Files\Realtek\Audio\HDA\RAVCpl64.exe [18381792 2017-06-29] (Realtek Semiconductor)
      HKLM-x32\...\Run: [SunJavaUpdateSched] => C:\Program Files (x86)\Common Files\Java\Java Update\jusched.exe [646680 2017-12-19] (Oracle Corporation)
      HKLM\SOFTWARE\Policies\Microsoft\Windows Defender: Restriction <==== ATTENTION
      HKU\S-1-5-21-449665086-573856661-688635114-1001\...\Run: [Steam] => C:\Program Files (x86)\Steam\steam.exe [3200800 2018-05-19] (Valve Corporation)
      GroupPolicy: Restriction - Windows Defender <==== ATTENTION
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      Hosts: keystone.mwbsys.com
      Tcpip\Parameters: [DhcpNameServer]
      Tcpip\..\Interfaces\{6f7c230f-23f8-4da3-a985-6efa2206f6cc}: [DhcpNameServer]
      Internet Explorer:
      BHO: Lync Browser Helper -> {31D09BA0-12F5-4CCE-BE8A-2923E76605DA} -> C:\Program Files\Microsoft Office\Office15\OCHelper.dll [2013-07-10] (Microsoft Corporation)
      BHO: Office Document Cache Handler -> {B4F3A835-0E21-4959-BA22-42B3008E02FF} -> C:\Program Files\Microsoft Office\Office15\URLREDIR.DLL [2012-10-01] (Microsoft Corporation)
      BHO: Microsoft SkyDrive Pro Browser Helper -> {D0498E0A-45B7-42AE-A9AA-ABA463DBD3BF} -> C:\Program Files\Microsoft Office\Office15\GROOVEEX.DLL [2013-07-13] (Microsoft Corporation)
      BHO-x32: Lync Browser Helper -> {31D09BA0-12F5-4CCE-BE8A-2923E76605DA} -> C:\Program Files (x86)\Microsoft Office\Office15\OCHelper.dll [2012-10-01] (Microsoft Corporation)
      BHO-x32: Office Document Cache Handler -> {B4F3A835-0E21-4959-BA22-42B3008E02FF} -> C:\Program Files (x86)\Microsoft Office\Office15\URLREDIR.DLL [2012-10-01] (Microsoft Corporation)
      BHO-x32: Microsoft SkyDrive Pro Browser Helper -> {D0498E0A-45B7-42AE-A9AA-ABA463DBD3BF} -> C:\Program Files (x86)\Microsoft Office\Office15\GROOVEEX.DLL [2013-07-13] (Microsoft Corporation)
      Handler: osf - {D924BDC6-C83A-4BD5-90D0-095128A113D1} - C:\Program Files\Microsoft Office\Office15\MSOSB.DLL [2012-10-01] (Microsoft Corporation)
      FF Plugin: @microsoft.com/SharePoint,version=14.0 -> C:\PROGRA~1\MICROS~1\Office15\NPSPWRAP.DLL [2012-10-01] (Microsoft Corporation)
      FF Plugin-x32: @microsoft.com/Lync,version=15.0 -> C:\Program Files (x86)\Mozilla Firefox\plugins\npmeetingjoinpluginoc.dll [No File]
      FF Plugin-x32: @microsoft.com/SharePoint,version=14.0 -> C:\PROGRA~2\MICROS~2\Office15\NPSPWRAP.DLL [2012-10-01] (Microsoft Corporation)
      FF Plugin-x32: @tools.google.com/Google Update;version=3 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [No File]
      FF Plugin-x32: @tools.google.com/Google Update;version=9 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [No File]
      CHR Profile: C:\Users\Erkant\AppData\Local\Google\Chrome\User Data\Default [2018-05-21]
      CHR Extension: (Slides) - C:\Users\Erkant\AppData\Local\Google\Chrome\User Data\Default\Extensions\aapocclcgogkmnckokdopfmhonfmgoek [2018-04-25]
      CHR Extension: (Docs) - C:\Users\Erkant\AppData\Local\Google\Chrome\User Data\Default\Extensions\aohghmighlieiainnegkcijnfilokake [2018-04-25]
      CHR Extension: (Google Drive) - C:\Users\Erkant\AppData\Local\Google\Chrome\User Data\Default\Extensions\apdfllckaahabafndbhieahigkjlhalf [2018-04-25]
      CHR Extension: (YouTube) - C:\Users\Erkant\AppData\Local\Google\Chrome\User Data\Default\Extensions\blpcfgokakmgnkcojhhkbfbldkacnbeo [2018-04-25]
      CHR Extension: (Sheets) - C:\Users\Erkant\AppData\Local\Google\Chrome\User Data\Default\Extensions\felcaaldnbdncclmgdcncolpebgiejap [2018-04-25]
      CHR Extension: (Google Docs Offline) - C:\Users\Erkant\AppData\Local\Google\Chrome\User Data\Default\Extensions\ghbmnnjooekpmoecnnnilnnbdlolhkhi [2018-04-25]
      CHR Extension: (Chrome Web Store Payments) - C:\Users\Erkant\AppData\Local\Google\Chrome\User Data\Default\Extensions\nmmhkkegccagdldgiimedpiccmgmieda [2018-04-25]
      CHR Extension: (Gmail) - C:\Users\Erkant\AppData\Local\Google\Chrome\User Data\Default\Extensions\pjkljhegncpnkpknbcohdijeoejaedia [2018-04-25]
      CHR Extension: (Chrome Media Router) - C:\Users\Erkant\AppData\Local\Google\Chrome\User Data\Default\Extensions\pkedcjkdefgpdelpbcmbmeomcjbeemfm [2018-04-25]
      CHR Extension: (Extension optimizator) - C:\Users\Erkant\AppData\Local\Google\Chrome\User Data\Default\Optimizator\1.3_0 [2018-05-20]
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R2 MBAMService; C:\Program Files\Malwarebytes\Anti-Malware\mbamservice.exe [6541008 2018-05-03] (Malwarebytes)
      S3 Sense; C:\Program Files\Windows Defender Advanced Threat Protection\MsSense.exe [4329952 2017-12-14] (Microsoft Corporation)
      R3 WdNisSvc; C:\ProgramData\Microsoft\Windows Defender\platform\4.14.17639.18041-0\NisSrv.exe [4632736 2018-04-26] (Microsoft Corporation)
      R2 WinDefend; C:\ProgramData\Microsoft\Windows Defender\platform\4.14.17639.18041-0\MsMpEng.exe [104680 2018-04-26] (Microsoft Corporation)
      S2 gupdate; "C:\Program Files (x86)\Google\Update\GoogleUpdate.exe" /svc [X]
      S3 gupdatem; "C:\Program Files (x86)\Google\Update\GoogleUpdate.exe" /medsvc [X]
      R2 NVDisplay.ContainerLocalSystem; "C:\Program Files\NVIDIA Corporation\Display.NvContainer\NVDisplay.Container.exe" -s NVDisplay.ContainerLocalSystem -f "C:\ProgramData\NVIDIA\NVDisplay.ContainerLocalSystem.log" -l 3 -d "C:\Program Files\NVIDIA Corporation\Display.NvContainer\plugins\LocalSystem" -r -p 30000
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R1 ESProtectionDriver; C:\WINDOWS\system32\drivers\mbae64.sys [152184 2018-04-26] (Malwarebytes)
      R2 MBAMChameleon; C:\WINDOWS\System32\Drivers\MbamChameleon.sys [190696 2018-05-21] (Malwarebytes)
      R3 MBAMFarflt; C:\WINDOWS\System32\DRIVERS\farflt.sys [112864 2018-05-21] (Malwarebytes)
      R3 MBAMProtection; C:\WINDOWS\system32\DRIVERS\mbam.sys [44768 2018-05-21] (Malwarebytes)
      R3 MBAMSwissArmy; C:\WINDOWS\System32\Drivers\mbamswissarmy.sys [253664 2018-05-21] (Malwarebytes)
      R3 MBAMWebProtection; C:\WINDOWS\system32\DRIVERS\mwac.sys [103648 2018-05-21] (Malwarebytes)
      R1 MpKslf3e4cdd1; C:\ProgramData\Microsoft\Windows Defender\Definition Updates\{F82E94D3-DD78-498F-9C67-3E8291EE6843}\MpKslf3e4cdd1.sys [58120 2018-05-21] (Microsoft Corporation)
      R3 nvlddmkm; C:\WINDOWS\System32\DriverStore\FileRepository\nv_ref_pubwu.inf_amd64_2e7fa54192fe16d0\nvlddmkm.sys [16936048 2017-11-09] (NVIDIA Corporation)
      R3 rt640x64; C:\WINDOWS\System32\drivers\rt640x64.sys [604160 2017-09-29] (Realtek )
      S3 smbdirect; C:\WINDOWS\System32\DRIVERS\smbdirect.sys [151552 2017-09-29] (Microsoft Corporation)
      S0 WdBoot; C:\WINDOWS\System32\drivers\wd\WdBoot.sys [46072 2018-04-26] (Microsoft Corporation)
      R0 WdFilter; C:\WINDOWS\System32\drivers\wd\WdFilter.sys [313888 2018-04-26] (Microsoft Corporation)
      R3 WdNisDrv; C:\WINDOWS\System32\drivers\wd\WdNisDrv.sys [61472 2018-04-26] (Microsoft Corporation)
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-05-21 16:15 - 2018-05-21 16:16 - 000010704 _____ C:\Users\Erkant\Downloads\FRST.txt
      2018-05-21 16:15 - 2018-05-21 16:15 - 000000000 ____D C:\FRST
      2018-05-21 16:13 - 2018-05-21 16:13 - 002413056 _____ (Farbar) C:\Users\Erkant\Downloads\FRST64.exe
      2018-05-21 15:19 - 2018-05-21 15:19 - 000044768 _____ (Malwarebytes) C:\WINDOWS\system32\Drivers\mbam.sys
      2018-05-21 15:18 - 2018-05-21 15:22 - 000103648 _____ (Malwarebytes) C:\WINDOWS\system32\Drivers\mwac.sys
      2018-05-21 15:18 - 2018-05-21 15:18 - 000253664 _____ (Malwarebytes) C:\WINDOWS\system32\Drivers\mbamswissarmy.sys
      2018-05-21 15:18 - 2018-05-21 15:18 - 000190696 _____ (Malwarebytes) C:\WINDOWS\system32\Drivers\MbamChameleon.sys
      2018-05-21 15:18 - 2018-05-21 15:18 - 000112864 _____ (Malwarebytes) C:\WINDOWS\system32\Drivers\farflt.sys
      2018-05-21 15:18 - 2018-05-21 15:18 - 000001912 _____ C:\Users\Public\Desktop\Malwarebytes.lnk
      2018-05-21 15:18 - 2018-05-21 15:18 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Malwarebytes
      2018-05-21 15:18 - 2018-05-21 15:18 - 000000000 ____D C:\ProgramData\Malwarebytes
      2018-05-21 15:18 - 2018-05-21 15:18 - 000000000 ____D C:\Program Files\Malwarebytes
      2018-05-21 15:18 - 2018-04-26 05:36 - 000152184 _____ (Malwarebytes) C:\WINDOWS\system32\Drivers\mbae64.sys
      2018-05-21 13:33 - 2018-05-21 13:33 - 000000880 _____ C:\Users\Erkant\Documents\hosts.txt
      2018-05-21 13:33 - 2018-05-21 13:33 - 000000000 ____D C:\Users\Erkant\AppData\Roaming\Obsidium
      2018-05-21 01:42 - 2018-05-21 01:42 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\qBittorrent
      2018-05-21 01:42 - 2018-05-21 01:42 - 000000000 ____D C:\Program Files\qBittorrent
      2018-05-21 01:16 - 2018-05-21 01:16 - 000000258 __RSH C:\Users\Erkant\ntuser.pol
      2018-05-21 00:08 - 2018-05-21 00:08 - 000001181 _____ C:\Users\Erkant\Desktop\Android Studio.lnk
      2018-05-20 23:59 - 2018-05-20 23:59 - 000000998 _____ C:\Users\Erkant\Desktop\Xampp.lnk
      2018-05-20 23:57 - 2018-05-20 23:57 - 000001779 _____ C:\Users\Erkant\Desktop\MySQL.lnk
      2018-05-20 21:43 - 2018-05-20 21:43 - 000002468 __RSH C:\ProgramData\ntuser.pol
      2018-05-20 21:41 - 2018-05-20 21:41 - 000004608 _____ C:\WINDOWS\SECOH-QAD.exe
      2018-05-20 21:41 - 2018-05-20 21:41 - 000000000 ____D C:\Users\Erkant\AppData\Roaming\FileModule
      2018-05-20 21:40 - 2018-05-20 21:40 - 000000000 ____D C:\Users\Erkant\AppData\Roaming\winhttp 5.1
      2018-05-20 21:38 - 2018-05-21 15:16 - 000000000 ____D C:\Users\Erkant\AppData\Roaming\qBittorrent
      2018-05-20 21:38 - 2018-05-20 21:38 - 000000000 ____D C:\Users\Erkant\AppData\Local\qBittorrent
      2018-05-20 21:21 - 2018-05-20 22:32 - 000005246 _____ C:\WINDOWS\System32\Tasks\Microsoft Office 15 Sync Maintenance for DESKTOP-LLNRL7P-Erkant DESKTOP-LLNRL7P
      2018-05-20 20:20 - 2018-05-20 20:20 - 000000000 ____D C:\Users\Erkant\AppData\Roaming\JetBrains
      2018-05-20 19:23 - 2018-05-21 00:08 - 000000000 ____D C:\Users\Erkant\AppData\Roaming\Postman
      2018-05-20 19:23 - 2018-05-20 19:23 - 000002210 _____ C:\Users\Erkant\Desktop\Postman.lnk
      2018-05-20 19:23 - 2018-05-20 19:23 - 000000000 ____D C:\Users\Erkant\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Postman
      2018-05-20 19:22 - 2018-05-20 19:23 - 000000000 ____D C:\Users\Erkant\AppData\Local\SquirrelTemp
      2018-05-20 19:22 - 2018-05-20 19:23 - 000000000 ____D C:\Users\Erkant\AppData\Local\Postman
      2018-05-20 19:21 - 2018-05-20 19:22 - 067730552 _____ (Postman) C:\Users\Erkant\Downloads\Postman-win64-6.1.2-Setup.exe
      2018-05-20 19:07 - 2018-05-20 19:07 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\MySQL
      2018-05-20 18:51 - 2018-05-20 18:51 - 000000000 ____D C:\Program Files (x86)\MySQL
      2018-05-20 18:21 - 2018-05-20 18:21 - 000000000 ____D C:\WINDOWS\system32\appmgmt
      2018-05-20 18:07 - 2018-05-20 18:07 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\XAMPP
      2018-05-20 18:04 - 2018-05-20 18:04 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Microsoft Office 2013
      2018-05-20 18:04 - 2018-05-20 18:04 - 000000000 ____D C:\Program Files\Common Files\DESIGNER
      2018-05-20 18:03 - 2018-05-20 18:03 - 000000000 ____D C:\WINDOWS\PCHEALTH
      2018-05-20 18:03 - 2018-05-20 18:03 - 000000000 ____D C:\Program Files\Microsoft SQL Server
      2018-05-20 18:03 - 2018-05-20 18:03 - 000000000 ____D C:\Program Files (x86)\Microsoft SQL Server
      2018-05-20 18:01 - 2018-05-20 18:04 - 000000000 ____D C:\WINDOWS\SHELLNEW
      2018-05-20 18:00 - 2018-05-20 18:03 - 000000000 ____D C:\Program Files\Microsoft Office
      2018-05-20 18:00 - 2018-05-20 18:00 - 000000000 ____D C:\Users\Erkant\AppData\Local\Microsoft Help
      2018-05-20 18:00 - 2018-05-20 18:00 - 000000000 ____D C:\Program Files\Microsoft Analysis Services
      2018-05-20 18:00 - 2018-05-20 18:00 - 000000000 ____D C:\Program Files (x86)\Microsoft Office
      2018-05-20 18:00 - 2018-05-20 18:00 - 000000000 ____D C:\Program Files (x86)\Microsoft Analysis Services
      2018-05-20 17:59 - 2018-05-20 17:59 - 000000000 __RHD C:\MSOCache
      2018-05-20 17:58 - 2018-05-20 23:52 - 000000000 ____D C:\xampp
      2018-05-20 17:54 - 2018-05-20 18:25 - 000000000 ____D C:\Users\Erkant\AppData\Roaming\MySQL
      2018-05-20 17:53 - 2018-05-20 18:24 - 000000000 ____D C:\Program Files\MySQL
      2018-05-20 17:48 - 2018-05-20 17:49 - 129956760 _____ (Bitnami) C:\Users\Erkant\Downloads\xampp-win32-7.2.5-0-VC15-installer.exe
      2018-05-20 17:47 - 2018-05-20 17:47 - 029601792 _____ C:\Users\Erkant\Downloads\mysql-workbench-community-6.3.10-winx64.msi
      2018-05-20 17:07 - 2018-05-20 17:07 - 000000000 ____D C:\Users\Erkant\Desktop\TimeAttendance
      2018-05-19 13:43 - 2018-05-19 13:43 - 000000000 ____D C:\Users\Erkant\AppData\Local\ElevatedDiagnostics
      2018-05-16 03:18 - 2018-05-16 03:18 - 000000222 _____ C:\Users\Erkant\Desktop\Stickman Destruction 2.url
      2018-05-16 03:18 - 2018-05-16 03:18 - 000000000 ____D C:\Users\Erkant\AppData\LocalLow\OtakuMaker
      2018-05-16 00:46 - 2018-05-16 00:46 - 000000000 ____D C:\WINDOWS\SysWOW64\AGEIA
      2018-05-16 00:46 - 2018-05-16 00:46 - 000000000 ____D C:\Program Files (x86)\AGEIA Technologies
      2018-05-15 19:48 - 2018-05-15 19:48 - 000000221 _____ C:\Users\Erkant\Desktop\Watchmen The End Is Nigh.url
      2018-05-14 10:15 - 2018-05-14 16:19 - 000000000 ____D C:\WINDOWS\Minidump
      2018-05-13 18:06 - 2018-05-13 18:06 - 000000000 ____H C:\WINDOWS\system32\Drivers\Msft_User_WpdFs_01_11_00.Wdf
      2018-05-10 21:57 - 2018-05-10 21:57 - 002276378 _____ C:\Users\Erkant\Downloads\app-debug.apk
      2018-05-10 16:17 - 2018-05-10 16:17 - 000000000 ____D C:\Users\Erkant\AppData\Local\Notepad++
      2018-05-10 13:02 - 2018-05-10 13:02 - 000000000 ____D C:\Users\Erkant\ApkProjects
      2018-05-10 11:55 - 2018-05-10 11:55 - 000000000 ____D C:\Users\Erkant\AppData\Local\NVIDIA
      2018-05-09 20:06 - 2018-05-09 20:06 - 000000000 ____D C:\Users\Erkant\AppData\Local\Icycle On Thin Ice
      2018-05-09 20:05 - 2018-05-09 20:05 - 000000222 _____ C:\Users\Erkant\Desktop\Icycle On Thin Ice.url
      2018-05-09 19:05 - 2018-05-09 19:05 - 000000000 ____D C:\Users\Erkant\AppData\Local\Stories
      2018-05-09 18:50 - 2018-05-09 18:50 - 000000222 _____ C:\Users\Erkant\Desktop\Stories The Path of Destinies.url
      2018-05-08 23:08 - 2018-05-02 00:25 - 000835064 _____ (Adobe Systems Incorporated) C:\WINDOWS\SysWOW64\FlashPlayerApp.exe
      2018-05-08 23:08 - 2018-05-02 00:25 - 000179704 _____ (Adobe Systems Incorporated) C:\WINDOWS\SysWOW64\FlashPlayerCPLApp.cpl
      2018-05-08 21:13 - 2018-05-03 10:57 - 000599448 _____ (Microsoft Corporation) C:\WINDOWS\system32\securekernel.exe
      2018-05-08 21:13 - 2018-05-03 10:56 - 001092016 _____ (Microsoft Corporation) C:\WINDOWS\system32\winresume.efi
      2018-05-08 21:13 - 2018-05-03 10:56 - 000924648 _____ (Microsoft Corporation) C:\WINDOWS\system32\winresume.exe
      2018-05-08 21:13 - 2018-05-03 10:54 - 000748448 _____ (Microsoft Corporation) C:\WINDOWS\system32\generaltel.dll
      2018-05-08 21:13 - 2018-05-03 10:54 - 000608160 _____ (Microsoft Corporation) C:\WINDOWS\system32\devinv.dll
      2018-05-08 21:13 - 2018-05-03 10:53 - 000461216 _____ (Microsoft Corporation) C:\WINDOWS\system32\dcntel.dll
      2018-05-08 21:13 - 2018-05-03 10:53 - 000300448 _____ (Microsoft Corporation) C:\WINDOWS\system32\acmigration.dll
      2018-05-08 21:13 - 2018-05-03 10:52 - 001568160 _____ (Microsoft Corporation) C:\WINDOWS\system32\appraiser.dll
      2018-05-08 21:13 - 2018-05-03 10:52 - 001415296 _____ (Microsoft Corporation) C:\WINDOWS\system32\winload.efi
      2018-05-08 21:13 - 2018-05-03 10:52 - 000137112 _____ (Microsoft Corporation) C:\WINDOWS\system32\CompatTelRunner.exe
      2018-05-08 21:13 - 2018-05-03 10:51 - 001056152 _____ (Microsoft Corporation) C:\WINDOWS\system32\hvax64.exe
      2018-05-08 21:13 - 2018-05-03 10:50 - 001206688 _____ (Microsoft Corporation) C:\WINDOWS\system32\hvix64.exe
      2018-05-08 21:13 - 2018-05-03 10:50 - 000664992 _____ (Microsoft Corporation) C:\WINDOWS\system32\aeinv.dll
      2018-05-08 21:13 - 2018-05-03 10:50 - 000423328 _____ (Microsoft Corporation) C:\WINDOWS\system32\invagent.dll
      2018-05-08 21:13 - 2018-05-03 10:50 - 000069536 _____ (Microsoft Corporation) C:\WINDOWS\system32\win32appinventorycsp.dll
      2018-05-08 21:13 - 2018-05-03 10:49 - 000035232 _____ (Microsoft Corporation) C:\WINDOWS\system32\DeviceCensus.exe
      2018-05-08 21:13 - 2018-05-03 10:48 - 002002336 _____ (Microsoft Corporation) C:\WINDOWS\system32\aitstatic.exe
      2018-05-08 21:13 - 2018-05-03 10:48 - 000793960 _____ (Microsoft Corporation) C:\WINDOWS\system32\oleaut32.dll
      2018-05-08 21:13 - 2018-05-03 10:48 - 000272288 _____ (Microsoft Corporation) C:\WINDOWS\system32\aepic.dll
      2018-05-08 21:13 - 2018-05-03 10:48 - 000077216 _____ (Microsoft Corporation) C:\WINDOWS\system32\hvloader.dll
      2018-05-08 21:13 - 2018-05-03 10:47 - 008600472 _____ (Microsoft Corporation) C:\WINDOWS\system32\ntoskrnl.exe
      2018-05-08 21:13 - 2018-05-03 10:47 - 001209760 _____ (Microsoft Corporation) C:\WINDOWS\system32\winload.exe
      2018-05-08 21:13 - 2018-05-03 10:45 - 002395040 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\ntfs.sys
      2018-05-08 21:13 - 2018-05-03 10:45 - 000711936 _____ (Microsoft Corporation) C:\WINDOWS\system32\ci.dll
      2018-05-08 21:13 - 2018-05-03 10:43 - 000702568 _____ (Microsoft Corporation) C:\WINDOWS\system32\kernel32.dll
      2018-05-08 21:13 - 2018-05-03 10:43 - 000373664 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\clfs.sys
      2018-05-08 21:13 - 2018-05-03 10:41 - 000540064 _____ (Microsoft Corporation) C:\WINDOWS\system32\pcasvc.dll
      2018-05-08 21:13 - 2018-05-03 10:38 - 002574240 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\dxgkrnl.sys
      2018-05-08 21:13 - 2018-05-03 10:37 - 000749984 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\dxgmms2.sys
      2018-05-08 21:13 - 2018-05-03 10:37 - 000408992 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\dxgmms1.sys
      2018-05-08 21:13 - 2018-05-03 10:36 - 007675792 _____ (Microsoft Corporation) C:\WINDOWS\system32\windows.storage.dll
      2018-05-08 21:13 - 2018-05-03 10:36 - 002710736 _____ (Microsoft Corporation) C:\WINDOWS\system32\iertutil.dll
      2018-05-08 21:13 - 2018-05-03 10:36 - 000437664 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\USBXHCI.SYS
      2018-05-08 21:13 - 2018-05-03 10:36 - 000397728 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppVScripting.dll
      2018-05-08 21:13 - 2018-05-03 10:36 - 000247200 _____ (Microsoft Corporation) C:\WINDOWS\system32\browserbroker.dll
      2018-05-08 21:13 - 2018-05-03 10:35 - 002472864 _____ (Microsoft Corporation) C:\WINDOWS\system32\UpdateAgent.dll
      2018-05-08 21:13 - 2018-05-03 10:35 - 001628064 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppVIntegration.dll
      2018-05-08 21:13 - 2018-05-03 10:35 - 000831392 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppVOrchestration.dll
      2018-05-08 21:13 - 2018-05-03 10:35 - 000645536 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppVPublishing.dll
      2018-05-08 21:13 - 2018-05-03 10:35 - 000358496 _____ (Microsoft Corporation) C:\WINDOWS\system32\wintrust.dll
      2018-05-08 21:13 - 2018-05-03 10:34 - 021356824 _____ (Microsoft Corporation) C:\WINDOWS\system32\shell32.dll
      2018-05-08 21:13 - 2018-05-03 10:34 - 000070864 _____ (Microsoft Corporation) C:\WINDOWS\system32\wldp.dll
      2018-05-08 21:13 - 2018-05-03 10:32 - 001054280 _____ (Microsoft Corporation) C:\WINDOWS\system32\msvproc.dll
      2018-05-08 21:13 - 2018-05-03 10:32 - 000744864 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppVReporting.dll
      2018-05-08 21:13 - 2018-05-03 10:32 - 000670104 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppVCatalog.dll
      2018-05-08 21:13 - 2018-05-03 10:32 - 000231328 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppVShNotify.exe
      2018-05-08 21:13 - 2018-05-03 10:31 - 001420704 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppVEntSubsystemController.dll
      2018-05-08 21:13 - 2018-05-03 10:30 - 001778584 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppVEntVirtualization.dll
      2018-05-08 21:13 - 2018-05-03 10:30 - 000819096 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppVClient.exe
      2018-05-08 21:13 - 2018-05-03 10:30 - 000813984 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppVEntStreamingManager.dll
      2018-05-08 21:13 - 2018-05-03 10:30 - 000495000 _____ (Microsoft Corporation) C:\WINDOWS\system32\TransportDSA.dll
      2018-05-08 21:13 - 2018-05-03 09:44 - 000595448 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\kernel32.dll
      2018-05-08 21:13 - 2018-05-03 09:43 - 000594056 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\oleaut32.dll
      2018-05-08 21:13 - 2018-05-03 09:39 - 000212896 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\aepic.dll
      2018-05-08 21:13 - 2018-05-03 09:36 - 025254400 _____ (Microsoft Corporation) C:\WINDOWS\system32\edgehtml.dll
      2018-05-08 21:13 - 2018-05-03 09:31 - 006092672 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\windows.storage.dll
      2018-05-08 21:13 - 2018-05-03 09:31 - 002193688 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\iertutil.dll
      2018-05-08 21:13 - 2018-05-03 09:29 - 000285144 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\wintrust.dll
      2018-05-08 21:13 - 2018-05-03 09:28 - 000061024 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\wldp.dll
      2018-05-08 21:13 - 2018-05-03 09:26 - 001057824 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\msvproc.dll
      2018-05-08 21:13 - 2018-05-03 09:25 - 020290248 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\shell32.dll
      2018-05-08 21:13 - 2018-05-03 09:19 - 003663360 _____ (Microsoft Corporation) C:\WINDOWS\system32\win32kfull.sys
      2018-05-08 21:13 - 2018-05-03 09:19 - 001300992 _____ (Microsoft Corporation) C:\WINDOWS\system32\usocore.dll
      2018-05-08 21:13 - 2018-05-03 09:19 - 000496640 _____ (Microsoft Corporation) C:\WINDOWS\system32\updatehandlers.dll
      2018-05-08 21:13 - 2018-05-03 09:18 - 000584192 _____ (Microsoft Corporation) C:\WINDOWS\system32\UIRibbonRes.dll
      2018-05-08 21:13 - 2018-05-03 09:18 - 000400896 _____ (Microsoft Corporation) C:\WINDOWS\system32\MusNotification.exe
      2018-05-08 21:13 - 2018-05-03 09:18 - 000206848 _____ (Microsoft Corporation) C:\WINDOWS\system32\IndexedDbLegacy.dll
      2018-05-08 21:13 - 2018-05-03 09:18 - 000064000 _____ (Microsoft Corporation) C:\WINDOWS\system32\AcSpecfc.dll
      2018-05-08 21:13 - 2018-05-03 09:17 - 007545344 _____ (Microsoft Corporation) C:\WINDOWS\system32\twinui.dll
      2018-05-08 21:13 - 2018-05-03 09:16 - 023674880 _____ (Microsoft Corporation) C:\WINDOWS\system32\mshtml.dll
      2018-05-08 21:13 - 2018-05-03 09:16 - 000331264 _____ (Microsoft Corporation) C:\WINDOWS\system32\browserexport.exe
      2018-05-08 21:13 - 2018-05-03 09:16 - 000231936 _____ (Microsoft Corporation) C:\WINDOWS\system32\aadauthhelper.dll
      2018-05-08 21:13 - 2018-05-03 09:16 - 000201728 _____ (Microsoft Corporation) C:\WINDOWS\system32\EdgeManager.dll
      2018-05-08 21:13 - 2018-05-03 09:16 - 000172544 _____ (Microsoft Corporation) C:\WINDOWS\system32\itss.dll
      2018-05-08 21:13 - 2018-05-03 09:16 - 000143872 _____ (Microsoft Corporation) C:\WINDOWS\system32\mssprxy.dll
      2018-05-08 21:13 - 2018-05-03 09:16 - 000104960 _____ (Microsoft Corporation) C:\WINDOWS\system32\Chakradiag.dll
      2018-05-08 21:13 - 2018-05-03 09:16 - 000041984 _____ (Microsoft Corporation) C:\WINDOWS\system32\LaunchWinApp.exe
      2018-05-08 21:13 - 2018-05-03 09:16 - 000033792 _____ (Microsoft Corporation) C:\WINDOWS\system32\wups2.dll
      2018-05-08 21:13 - 2018-05-03 09:16 - 000023552 _____ (Microsoft Corporation) C:\WINDOWS\system32\credssp.dll
      2018-05-08 21:13 - 2018-05-03 09:15 - 000118272 _____ (Microsoft Corporation) C:\WINDOWS\system32\TSpkg.dll
      2018-05-08 21:13 - 2018-05-03 09:15 - 000055808 _____ (Microsoft Corporation) C:\WINDOWS\system32\imgutil.dll
      2018-05-08 21:13 - 2018-05-03 09:14 - 000675328 _____ (Microsoft Corporation) C:\WINDOWS\system32\webplatstorageserver.dll
      2018-05-08 21:13 - 2018-05-03 09:14 - 000623616 _____ (Microsoft Corporation) C:\WINDOWS\system32\aadcloudap.dll
      2018-05-08 21:13 - 2018-05-03 09:14 - 000093696 _____ (Microsoft Corporation) C:\WINDOWS\system32\mshtmled.dll
      2018-05-08 21:13 - 2018-05-03 09:13 - 000276480 _____ (Microsoft Corporation) C:\WINDOWS\system32\dxtrans.dll
      2018-05-08 21:13 - 2018-05-03 09:13 - 000253440 _____ (Microsoft Corporation) C:\WINDOWS\system32\domgmt.dll
      2018-05-08 21:13 - 2018-05-03 09:12 - 000816128 _____ (Microsoft Corporation) C:\WINDOWS\system32\ieproxy.dll
      2018-05-08 21:13 - 2018-05-03 09:12 - 000672768 _____ (Microsoft Corporation) C:\WINDOWS\system32\jscript9diag.dll
      2018-05-08 21:13 - 2018-05-03 09:12 - 000657408 _____ (Microsoft Corporation) C:\WINDOWS\system32\hhctrl.ocx
      2018-05-08 21:13 - 2018-05-03 09:12 - 000403968 _____ (Microsoft Corporation) C:\WINDOWS\system32\WpAXHolder.dll
      2018-05-08 21:13 - 2018-05-03 09:11 - 000595456 _____ (Microsoft Corporation) C:\WINDOWS\system32\vbscript.dll
      2018-05-08 21:13 - 2018-05-03 09:09 - 008432640 _____ (Microsoft Corporation) C:\WINDOWS\system32\mstscax.dll
      2018-05-08 21:13 - 2018-05-03 09:09 - 008068608 _____ (Microsoft Corporation) C:\WINDOWS\system32\Chakra.dll
      2018-05-08 21:13 - 2018-05-03 09:09 - 004723712 _____ (Microsoft Corporation) C:\WINDOWS\system32\jscript9.dll
      2018-05-08 21:13 - 2018-05-03 09:09 - 003405824 _____ (Microsoft Corporation) C:\WINDOWS\system32\tquery.dll
      2018-05-08 21:13 - 2018-05-03 09:09 - 003334144 _____ (Microsoft Corporation) C:\WINDOWS\system32\wininet.dll
      2018-05-08 21:13 - 2018-05-03 09:09 - 002784256 _____ (Microsoft Corporation) C:\WINDOWS\system32\wuaueng.dll
      2018-05-08 21:13 - 2018-05-03 09:09 - 002086400 _____ (Microsoft Corporation) C:\WINDOWS\system32\win32kbase.sys
      2018-05-08 21:13 - 2018-05-03 09:09 - 001856000 _____ (Microsoft Corporation) C:\WINDOWS\system32\msxml3.dll
      2018-05-08 21:13 - 2018-05-03 09:09 - 001548288 _____ (Microsoft Corporation) C:\WINDOWS\system32\lsasrv.dll
      2018-05-08 21:13 - 2018-05-03 09:09 - 001344000 _____ (Microsoft Corporation) C:\WINDOWS\system32\dosvc.dll
      2018-05-08 21:13 - 2018-05-03 09:08 - 001597952 _____ (Microsoft Corporation) C:\WINDOWS\system32\ieapfltr.dll
      2018-05-08 21:13 - 2018-05-03 09:08 - 000808960 _____ (Microsoft Corporation) C:\WINDOWS\system32\jscript.dll
      2018-05-08 21:13 - 2018-05-03 09:07 - 001822720 _____ (Microsoft Corporation) C:\WINDOWS\system32\urlmon.dll
      2018-05-08 21:13 - 2018-05-03 09:06 - 003630080 _____ (Microsoft Corporation) C:\WINDOWS\system32\mstsc.exe
      2018-05-08 21:13 - 2018-05-03 09:05 - 001717248 _____ (Microsoft Corporation) C:\WINDOWS\system32\comsvcs.dll
      2018-05-08 21:13 - 2018-05-03 09:05 - 000483840 _____ (Microsoft Corporation) C:\WINDOWS\system32\catsrvut.dll
      2018-05-08 21:13 - 2018-05-03 09:05 - 000389120 _____ (Microsoft Corporation) C:\WINDOWS\system32\ninput.dll
      2018-05-08 21:13 - 2018-05-03 09:04 - 000030208 _____ (Microsoft Corporation) C:\WINDOWS\system32\msisip.dll
      2018-05-08 21:13 - 2018-05-03 09:03 - 000050176 _____ (Microsoft Corporation) C:\WINDOWS\system32\pcalua.exe
      2018-05-08 21:13 - 2018-05-03 09:02 - 000584192 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\UIRibbonRes.dll
      2018-05-08 21:13 - 2018-05-03 09:00 - 002902528 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\win32kfull.sys
      2018-05-08 21:13 - 2018-05-03 09:00 - 000473088 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\AcSpecfc.dll
      2018-05-08 21:13 - 2018-05-03 09:00 - 000162304 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\IndexedDbLegacy.dll
      2018-05-08 21:13 - 2018-05-03 08:59 - 018924544 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\edgehtml.dll
      2018-05-08 21:13 - 2018-05-03 08:58 - 006467072 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\twinui.dll
      2018-05-08 21:13 - 2018-05-03 08:58 - 000155648 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\EdgeManager.dll
      2018-05-08 21:13 - 2018-05-03 08:57 - 019354624 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\mshtml.dll
      2018-05-08 21:13 - 2018-05-03 08:57 - 000155136 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\aadauthhelper.dll
      2018-05-08 21:13 - 2018-05-03 08:57 - 000150528 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\itss.dll
      2018-05-08 21:13 - 2018-05-03 08:57 - 000098304 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\TSpkg.dll
      2018-05-08 21:13 - 2018-05-03 08:57 - 000079360 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Chakradiag.dll
      2018-05-08 21:13 - 2018-05-03 08:57 - 000019456 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\credssp.dll
      2018-05-08 21:13 - 2018-05-03 08:56 - 002677248 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\tquery.dll
      2018-05-08 21:13 - 2018-05-03 08:56 - 000268288 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\dxtrans.dll
      2018-05-08 21:13 - 2018-05-03 08:56 - 000078336 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\mshtmled.dll
      2018-05-08 21:13 - 2018-05-03 08:55 - 000459776 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\webplatstorageserver.dll
      2018-05-08 21:13 - 2018-05-03 08:54 - 000365568 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\ieproxy.dll
      2018-05-08 21:13 - 2018-05-03 08:53 - 007813120 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\mstscax.dll
      2018-05-08 21:13 - 2018-05-03 08:53 - 006060544 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Chakra.dll
      2018-05-08 21:13 - 2018-05-03 08:53 - 000531968 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\jscript9diag.dll
      2018-05-08 21:13 - 2018-05-03 08:52 - 003662848 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\jscript9.dll
      2018-05-08 21:13 - 2018-05-03 08:52 - 000664064 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\jscript.dll
      2018-05-08 21:13 - 2018-05-03 08:52 - 000463872 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\vbscript.dll
      2018-05-08 21:13 - 2018-05-03 08:51 - 002869760 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\wininet.dll
      2018-05-08 21:13 - 2018-05-03 08:51 - 001560064 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\urlmon.dll
      2018-05-08 21:13 - 2018-05-03 08:50 - 001587712 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\msxml3.dll
      2018-05-08 21:13 - 2018-05-03 08:50 - 001474560 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\ieapfltr.dll
      2018-05-08 21:13 - 2018-05-03 08:49 - 003430400 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\mstsc.exe
      2018-05-08 21:13 - 2018-05-03 08:48 - 001353728 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\comsvcs.dll
      2018-05-08 21:13 - 2018-05-03 08:48 - 000328704 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\ninput.dll
      2018-05-08 21:13 - 2018-05-03 08:47 - 000026624 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\msisip.dll
      2018-05-08 21:13 - 2018-04-16 01:07 - 001463344 _____ (Microsoft Corporation) C:\WINDOWS\system32\msctf.dll
      2018-05-08 21:13 - 2018-04-16 01:04 - 000779952 _____ (Microsoft Corporation) C:\WINDOWS\system32\fontdrvhost.exe
      2018-05-08 21:13 - 2018-04-16 01:03 - 000128408 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\tm.sys
      2018-05-08 21:13 - 2018-04-16 00:57 - 000279968 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\msiscsi.sys
      2018-05-08 21:13 - 2018-04-16 00:51 - 002513920 _____ (Microsoft Corporation) C:\WINDOWS\system32\KernelBase.dll
      2018-05-08 21:13 - 2018-04-16 00:50 - 001925760 _____ (Microsoft Corporation) C:\WINDOWS\system32\Windows.ApplicationModel.Store.dll
      2018-05-08 21:13 - 2018-04-16 00:49 - 001954056 _____ (Microsoft Corporation) C:\WINDOWS\system32\ntdll.dll
      2018-05-08 21:13 - 2018-04-16 00:49 - 000563632 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppResolver.dll
      2018-05-08 21:13 - 2018-04-16 00:49 - 000382368 _____ (Adobe Systems Incorporated) C:\WINDOWS\system32\atmfd.dll
      2018-05-08 21:13 - 2018-04-16 00:48 - 005859248 _____ (Microsoft Corporation) C:\WINDOWS\system32\StartTileData.dll
      2018-05-08 21:13 - 2018-04-16 00:48 - 001638424 _____ (Microsoft Corporation) C:\WINDOWS\system32\gdi32full.dll
      2018-05-08 21:13 - 2018-04-16 00:47 - 000398744 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\fltMgr.sys
      2018-05-08 21:13 - 2018-04-16 00:38 - 003180720 _____ (Microsoft Corporation) C:\WINDOWS\system32\combase.dll
      2018-05-08 21:13 - 2018-04-16 00:38 - 000979360 _____ (Microsoft Corporation) C:\WINDOWS\system32\LicenseManager.dll
      2018-05-08 21:13 - 2018-04-16 00:36 - 002376088 _____ (Microsoft Corporation) C:\WINDOWS\system32\Microsoft.Uev.AppAgent.dll
      2018-05-08 21:13 - 2018-04-16 00:34 - 000230304 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\mrxsmb20.sys
      2018-05-08 21:13 - 2018-04-16 00:33 - 001269616 _____ (Microsoft Corporation) C:\WINDOWS\system32\WinTypes.dll
      2018-05-08 21:13 - 2018-04-16 00:33 - 000362904 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\pci.sys
      2018-05-08 21:13 - 2018-04-16 00:32 - 003904296 _____ (Microsoft Corporation) C:\WINDOWS\explorer.exe
      2018-05-08 21:13 - 2018-04-16 00:32 - 001416392 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3D12.dll
      2018-05-08 21:13 - 2018-04-16 00:30 - 002268024 _____ (Microsoft Corporation) C:\WINDOWS\system32\mfsrcsnk.dll
      2018-05-08 21:13 - 2018-04-16 00:29 - 001873944 _____ (Microsoft Corporation) C:\WINDOWS\system32\crypt32.dll
      2018-05-08 21:13 - 2018-04-16 00:29 - 001779936 _____ (Microsoft Corporation) C:\WINDOWS\system32\mfplat.dll
      2018-05-08 21:13 - 2018-04-16 00:29 - 000198440 _____ (Microsoft Corporation) C:\WINDOWS\system32\CloudStorageWizard.exe
      2018-05-08 21:13 - 2018-04-16 00:28 - 000688064 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppXDeploymentClient.dll
      2018-05-08 21:13 - 2018-04-16 00:26 - 007384576 _____ (Microsoft Corporation) C:\WINDOWS\system32\Windows.Media.Protection.PlayReady.dll
      2018-05-08 21:13 - 2018-04-16 00:26 - 002711176 _____ (Microsoft Corporation) C:\WINDOWS\system32\mfmp4srcsnk.dll
      2018-05-08 21:13 - 2018-04-16 00:26 - 001506200 _____ (Microsoft Corporation) C:\WINDOWS\system32\mfmpeg2srcsnk.dll
      2018-05-08 21:13 - 2018-04-16 00:25 - 001430768 _____ (Microsoft Corporation) C:\WINDOWS\system32\WpcMon.exe
      2018-05-08 21:13 - 2018-04-16 00:25 - 000661920 _____ (Microsoft Corporation) C:\WINDOWS\system32\comctl32.dll
      2018-05-08 21:13 - 2018-04-16 00:23 - 001101208 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\http.sys
      2018-05-08 21:13 - 2018-04-15 23:47 - 001929712 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\KernelBase.dll
      2018-05-08 21:13 - 2018-04-15 23:47 - 001615712 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\ntdll.dll
      2018-05-08 21:13 - 2018-04-15 23:47 - 001490856 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Windows.ApplicationModel.Store.dll
      2018-05-08 21:13 - 2018-04-15 23:47 - 001433360 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\gdi32full.dll
      2018-05-08 21:13 - 2018-04-15 23:47 - 001323336 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\msctf.dll
      2018-05-08 21:13 - 2018-04-15 23:47 - 000649304 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\fontdrvhost.exe
      2018-05-08 21:13 - 2018-04-15 23:47 - 000311192 _____ (Adobe Systems Incorporated) C:\WINDOWS\SysWOW64\atmfd.dll
      2018-05-08 21:13 - 2018-04-15 23:38 - 003485392 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\explorer.exe
      2018-05-08 21:13 - 2018-04-15 23:38 - 001123464 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3D12.dll
      2018-05-08 21:13 - 2018-04-15 23:38 - 000444280 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\AppResolver.dll
      2018-05-08 21:13 - 2018-04-15 23:37 - 000747416 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\LicenseManager.dll
      2018-05-08 21:13 - 2018-04-15 23:36 - 002386832 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\combase.dll
      2018-05-08 21:13 - 2018-04-15 23:36 - 001575896 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\crypt32.dll
      2018-05-08 21:13 - 2018-04-15 23:36 - 000832648 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\WinTypes.dll
      2018-05-08 21:13 - 2018-04-15 23:36 - 000543920 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\AppXDeploymentClient.dll
      2018-05-08 21:13 - 2018-04-15 23:35 - 002462704 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\mfmp4srcsnk.dll
      2018-05-08 21:13 - 2018-04-15 23:34 - 006482664 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Windows.Media.Protection.PlayReady.dll
      2018-05-08 21:13 - 2018-04-15 23:34 - 001524776 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\mfplat.dll
      2018-05-08 21:13 - 2018-04-15 23:34 - 001456104 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\mfsrcsnk.dll
      2018-05-08 21:13 - 2018-04-15 23:34 - 001017048 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\mfmpeg2srcsnk.dll
      2018-05-08 21:13 - 2018-04-15 23:34 - 000077552 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\CloudNotifications.exe
      2018-05-08 21:13 - 2018-04-15 23:33 - 001623960 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Microsoft.Uev.AppAgent.dll
      2018-05-08 21:13 - 2018-04-15 23:16 - 003995136 _____ (Microsoft Corporation) C:\WINDOWS\system32\UIRibbon.dll
      2018-05-08 21:13 - 2018-04-15 23:15 - 003490816 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\UIRibbon.dll
      2018-05-08 21:13 - 2018-04-15 23:15 - 000674304 _____ (Microsoft Corporation) C:\WINDOWS\system32\LockController.dll
      2018-05-08 21:13 - 2018-04-15 23:14 - 000375296 _____ (Microsoft Corporation) C:\WINDOWS\system32\AssignedAccessManager.dll
      2018-05-08 21:13 - 2018-04-15 23:14 - 000250368 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppxAllUserStore.dll
      2018-05-08 21:13 - 2018-04-15 23:14 - 000202240 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\AppxAllUserStore.dll
      2018-05-08 21:13 - 2018-04-15 23:14 - 000175616 _____ (Microsoft Corporation) C:\WINDOWS\system32\t2embed.dll
      2018-05-08 21:13 - 2018-04-15 23:14 - 000133632 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\t2embed.dll
      2018-05-08 21:13 - 2018-04-15 23:14 - 000121856 _____ (Microsoft Corporation) C:\WINDOWS\system32\fontsub.dll
      2018-05-08 21:13 - 2018-04-15 23:14 - 000101888 _____ (Microsoft Corporation) C:\WINDOWS\system32\CredProv2faHelper.dll
      2018-05-08 21:13 - 2018-04-15 23:14 - 000096768 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\fontsub.dll
      2018-05-08 21:13 - 2018-04-15 23:14 - 000084992 _____ (Microsoft Corporation) C:\WINDOWS\system32\DeviceUpdateAgent.dll
      2018-05-08 21:13 - 2018-04-15 23:13 - 002890240 _____ (Microsoft Corporation) C:\WINDOWS\system32\Windows.UI.Xaml.Resources.dll
      2018-05-08 21:13 - 2018-04-15 23:12 - 017160704 _____ (Microsoft Corporation) C:\WINDOWS\system32\Windows.UI.Xaml.dll
      2018-05-08 21:13 - 2018-04-15 23:12 - 013704704 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Windows.UI.Xaml.dll
      2018-05-08 21:13 - 2018-04-15 23:12 - 000169472 _____ (Microsoft Corporation) C:\WINDOWS\system32\wuuhosdeployment.dll
      2018-05-08 21:13 - 2018-04-15 23:12 - 000164864 _____ (Microsoft Corporation) C:\WINDOWS\system32\dmcertinst.exe
      2018-05-08 21:13 - 2018-04-15 23:11 - 000531456 _____ (Microsoft Corporation) C:\WINDOWS\system32\daxexec.dll
      2018-05-08 21:13 - 2018-04-15 23:11 - 000301056 _____ (Microsoft Corporation) C:\WINDOWS\system32\MicrosoftAccountWAMExtension.dll
      2018-05-08 21:13 - 2018-04-15 23:10 - 001576960 _____ (Microsoft Corporation) C:\WINDOWS\system32\enterprisecsps.dll
      2018-05-08 21:13 - 2018-04-15 23:10 - 001498112 _____ (Microsoft Corporation) C:\WINDOWS\system32\WebRuntimeManager.dll
      2018-05-08 21:13 - 2018-04-15 23:10 - 000371712 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\daxexec.dll
      2018-05-08 21:13 - 2018-04-15 23:10 - 000363008 _____ (Microsoft Corporation) C:\WINDOWS\system32\SettingsEnvironment.Desktop.dll
      2018-05-08 21:13 - 2018-04-15 23:10 - 000316928 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\netbt.sys
      2018-05-08 21:13 - 2018-04-15 23:10 - 000271872 _____ (Microsoft Corporation) C:\WINDOWS\system32\DAFWSD.dll
      2018-05-08 21:13 - 2018-04-15 23:10 - 000220672 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\MicrosoftAccountWAMExtension.dll
      2018-05-08 21:13 - 2018-04-15 23:10 - 000218112 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\credprovhost.dll
      2018-05-08 21:13 - 2018-04-15 23:09 - 000503808 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Microsoft.Uev.Office2013CustomActions.dll
      2018-05-08 21:13 - 2018-04-15 23:09 - 000503296 _____ (Microsoft Corporation) C:\WINDOWS\system32\SettingsHandlers_User.dll
      2018-05-08 21:13 - 2018-04-15 23:09 - 000408064 _____ (Microsoft Corporation) C:\WINDOWS\system32\profsvc.dll
      2018-05-08 21:13 - 2018-04-15 23:09 - 000153600 _____ (Microsoft Corporation) C:\WINDOWS\system32\BrowserSettingSync.dll
      2018-05-08 21:13 - 2018-04-15 23:08 - 006576128 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Windows.Data.Pdf.dll
      2018-05-08 21:13 - 2018-04-15 23:08 - 003181568 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\cdp.dll
      2018-05-08 21:13 - 2018-04-15 23:08 - 000859648 _____ (Microsoft Corporation) C:\WINDOWS\system32\appwiz.cpl
      2018-05-08 21:13 - 2018-04-15 23:08 - 000735232 _____ (Microsoft Corporation) C:\WINDOWS\system32\Microsoft.Uev.Office2013CustomActions.dll
      2018-05-08 21:13 - 2018-04-15 23:08 - 000703488 _____ (Microsoft Corporation) C:\WINDOWS\system32\ngccredprov.dll
      2018-05-08 21:13 - 2018-04-15 23:08 - 000627712 _____ (Microsoft Corporation) C:\WINDOWS\system32\rdpcore.dll
      2018-05-08 21:13 - 2018-04-15 23:08 - 000583680 _____ (Microsoft Corporation) C:\WINDOWS\system32\Windows.CloudStore.Schema.Shell.dll
      2018-05-08 21:13 - 2018-04-15 23:08 - 000535552 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\rdpcore.dll
      2018-05-08 21:13 - 2018-04-15 23:08 - 000448000 _____ (Microsoft Corporation) C:\WINDOWS\system32\LockHostingFramework.dll
      2018-05-08 21:13 - 2018-04-15 23:08 - 000358400 _____ (Microsoft Corporation) C:\WINDOWS\system32\Wldap32.dll
      2018-05-08 21:13 - 2018-04-15 23:08 - 000262656 _____ (Microsoft Corporation) C:\WINDOWS\system32\credprovhost.dll
      2018-05-08 21:13 - 2018-04-15 23:08 - 000246272 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Windows.ApplicationModel.Store.TestingFramework.dll
      2018-05-08 21:13 - 2018-04-15 23:08 - 000181760 _____ (Microsoft Corporation) C:\WINDOWS\system32\twext.dll
      2018-05-08 21:13 - 2018-04-15 23:08 - 000169472 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\SettingMonitor.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 012689920 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\wmp.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 008031744 _____ (Microsoft Corporation) C:\WINDOWS\system32\Windows.Data.Pdf.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 005195776 _____ (Microsoft Corporation) C:\WINDOWS\system32\cdp.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 003367936 _____ (Microsoft Corporation) C:\WINDOWS\system32\SyncCenter.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 001495552 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppXDeploymentExtensions.desktop.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 001425408 _____ (Microsoft Corporation) C:\WINDOWS\system32\SystemSettings.Handlers.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 000837632 _____ (Microsoft Corporation) C:\WINDOWS\system32\Windows.Security.Authentication.Web.Core.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 000792064 _____ (Microsoft Corporation) C:\WINDOWS\system32\mssvp.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 000702464 _____ (Microsoft Corporation) C:\WINDOWS\system32\Windows.Internal.Management.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 000658432 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\netlogon.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 000598528 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Windows.Security.Authentication.Web.Core.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 000386560 _____ (Microsoft Corporation) C:\WINDOWS\system32\zipfldr.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 000319488 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Wldap32.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 000308736 _____ (Microsoft Corporation) C:\WINDOWS\system32\Windows.ApplicationModel.Store.TestingFramework.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 000225280 _____ (Microsoft Corporation) C:\WINDOWS\system32\SearchFilterHost.exe
      2018-05-08 21:13 - 2018-04-15 23:07 - 000158208 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\twext.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 000124928 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\BrowserSettingSync.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 000112640 _____ (Microsoft Corporation) C:\WINDOWS\system32\IdCtrls.dll
      2018-05-08 21:13 - 2018-04-15 23:07 - 000096256 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\IdCtrls.dll
      2018-05-08 21:13 - 2018-04-15 23:06 - 013660672 _____ (Microsoft Corporation) C:\WINDOWS\system32\wmp.dll
      2018-05-08 21:13 - 2018-04-15 23:06 - 011924480 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\ieframe.dll
      2018-05-08 21:13 - 2018-04-15 23:06 - 000899072 _____ (Microsoft Corporation) C:\WINDOWS\system32\SmartcardCredentialProvider.dll
      2018-05-08 21:13 - 2018-04-15 23:06 - 000820224 _____ (Microsoft Corporation) C:\WINDOWS\system32\netlogon.dll
      2018-05-08 21:13 - 2018-04-15 23:06 - 000721920 _____ (Microsoft Corporation) C:\WINDOWS\system32\LogonController.dll
      2018-05-08 21:13 - 2018-04-15 23:06 - 000421376 _____ (Microsoft Corporation) C:\WINDOWS\system32\InputSwitch.dll
      2018-05-08 21:13 - 2018-04-15 23:06 - 000377856 _____ (Microsoft Corporation) C:\WINDOWS\system32\SearchProtocolHost.exe
      2018-05-08 21:13 - 2018-04-15 23:05 - 004113408 _____ (Microsoft Corporation) C:\WINDOWS\system32\SettingsHandlers_nt.dll
      2018-05-08 21:13 - 2018-04-15 23:05 - 000863744 _____ (Microsoft Corporation) C:\WINDOWS\system32\ntshrui.dll
      2018-05-08 21:13 - 2018-04-15 23:05 - 000626176 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\SmartcardCredentialProvider.dll
      2018-05-08 21:13 - 2018-04-15 23:05 - 000526336 _____ (Microsoft Corporation) C:\WINDOWS\system32\authui.dll
      2018-05-08 21:13 - 2018-04-15 23:05 - 000456704 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\LockAppBroker.dll
      2018-05-08 21:13 - 2018-04-15 23:05 - 000324608 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\SearchProtocolHost.exe
      2018-05-08 21:13 - 2018-04-15 23:04 - 012833280 _____ (Microsoft Corporation) C:\WINDOWS\system32\ieframe.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 002523136 _____ (Microsoft Corporation) C:\WINDOWS\system32\gameux.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 002490880 _____ (Microsoft Corporation) C:\WINDOWS\system32\themecpl.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 002464768 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\dwmcore.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 002209280 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppXDeploymentExtensions.onecore.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 001342464 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Wpc.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 001236480 _____ (Microsoft Corporation) C:\WINDOWS\system32\TokenBroker.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 001230848 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\usercpl.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 001057792 _____ (Microsoft Corporation) C:\WINDOWS\system32\comdlg32.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 000997376 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\ShareHost.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 000982016 _____ (Microsoft Corporation) C:\WINDOWS\system32\SearchIndexer.exe
      2018-05-08 21:13 - 2018-04-15 23:04 - 000976896 _____ (Microsoft Corporation) C:\WINDOWS\HelpPane.exe
      2018-05-08 21:13 - 2018-04-15 23:04 - 000965632 _____ (Microsoft Corporation) C:\WINDOWS\system32\fontext.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 000884736 _____ (Microsoft Corporation) C:\WINDOWS\system32\Windows.UI.Search.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 000648704 _____ (Microsoft Corporation) C:\WINDOWS\system32\UserLanguagesCpl.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 000621056 _____ (Microsoft Corporation) C:\WINDOWS\system32\hgcpl.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 000576512 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\hgcpl.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 000559104 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\UserLanguagesCpl.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 000556544 _____ (Microsoft Corporation) C:\WINDOWS\system32\LockAppBroker.dll
      2018-05-08 21:13 - 2018-04-15 23:04 - 000524800 _____ (Microsoft Corporation) C:\WINDOWS\system32\windows.immersiveshell.serviceprovider.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 004772352 _____ (Microsoft Corporation) C:\WINDOWS\system32\ExplorerFrame.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 004385280 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\ExplorerFrame.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 004248064 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\MFMediaEngine.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 003287040 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\SyncCenter.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 003177472 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppXDeploymentServer.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 002976256 _____ (Microsoft Corporation) C:\WINDOWS\system32\twinui.pcshell.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 002857984 _____ (Microsoft Corporation) C:\WINDOWS\system32\dwmcore.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 002814976 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\themeui.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 002741248 _____ (Microsoft Corporation) C:\WINDOWS\system32\mssrch.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 002628608 _____ (Microsoft Corporation) C:\WINDOWS\system32\diagtrack.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 002462208 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\themecpl.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 002413568 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\gameux.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 001353728 _____ (Microsoft Corporation) C:\WINDOWS\system32\usercpl.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 001224704 _____ (Microsoft Corporation) C:\WINDOWS\system32\ShareHost.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 000920064 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\TokenBroker.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 000840192 _____ (Microsoft Corporation) C:\WINDOWS\system32\BFE.DLL
      2018-05-08 21:13 - 2018-04-15 23:03 - 000826880 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\SearchIndexer.exe
      2018-05-08 21:13 - 2018-04-15 23:03 - 000825856 _____ (Microsoft Corporation) C:\WINDOWS\system32\twinui.appcore.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 000695296 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Windows.UI.Search.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 000508928 _____ (Microsoft Corporation) C:\WINDOWS\system32\SettingSync.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 000417792 _____ (Microsoft Corporation) C:\WINDOWS\system32\stobject.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 000402432 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\SettingSync.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 000383488 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\stobject.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 000329728 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\InputSwitch.dll
      2018-05-08 21:13 - 2018-04-15 23:03 - 000197632 _____ (Microsoft Corporation) C:\WINDOWS\system32\SettingMonitor.dll
      2018-05-08 21:13 - 2018-04-15 23:02 - 004814336 _____ (Microsoft Corporation) C:\WINDOWS\system32\MFMediaEngine.dll
      2018-05-08 21:13 - 2018-04-15 23:02 - 001669120 _____ (Microsoft Corporation) C:\WINDOWS\system32\Wpc.dll
      2018-05-08 21:13 - 2018-04-15 23:02 - 000842240 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\comdlg32.dll
      2018-05-08 21:13 - 2018-04-15 23:02 - 000462336 _____ (Microsoft Corporation) C:\WINDOWS\system32\wuuhext.dll
      2018-05-08 21:13 - 2018-04-15 23:01 - 001509888 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Windows.UI.Immersive.dll
      2018-05-08 21:13 - 2018-04-15 23:01 - 000531968 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\wlidprov.dll
      2018-05-08 21:13 - 2018-04-15 23:01 - 000518144 _____ (Microsoft Corporation) C:\WINDOWS\system32\dmenrollengine.dll
      2018-05-08 21:13 - 2018-04-15 23:01 - 000366592 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Geolocation.dll
      2018-05-08 21:13 - 2018-04-15 23:00 - 002223616 _____ (Microsoft Corporation) C:\WINDOWS\system32\wlidsvc.dll
      2018-05-08 21:13 - 2018-04-15 23:00 - 001739264 _____ (Microsoft Corporation) C:\WINDOWS\system32\Windows.UI.Immersive.dll
      2018-05-08 21:13 - 2018-04-15 23:00 - 000726016 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\srv2.sys
      2018-05-08 21:13 - 2018-04-15 23:00 - 000682496 _____ (Microsoft Corporation) C:\WINDOWS\system32\wlidprov.dll
      2018-05-08 21:13 - 2018-04-15 23:00 - 000496640 _____ (Microsoft Corporation) C:\WINDOWS\system32\Geolocation.dll
      2018-05-08 21:13 - 2018-04-15 22:58 - 000125952 _____ (Microsoft Corporation) C:\WINDOWS\system32\AppxSysprep.dll
      2018-05-08 21:13 - 2017-11-26 16:26 - 000048112 _____ (Microsoft Corporation) C:\WINDOWS\system32\wuauclt.exe
      2018-05-08 21:12 - 2018-05-03 09:15 - 000194048 _____ (Microsoft Corporation) C:\WINDOWS\system32\itircl.dll
      2018-05-08 21:12 - 2018-05-03 09:03 - 000067584 _____ (Microsoft Corporation) C:\WINDOWS\system32\pcadm.dll
      2018-05-08 21:12 - 2018-05-03 09:03 - 000012800 _____ (Microsoft Corporation) C:\WINDOWS\system32\pcaevts.dll
      2018-05-08 21:12 - 2018-05-03 08:57 - 000162304 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\itircl.dll
      2018-05-08 21:12 - 2018-05-03 08:53 - 000540672 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\hhctrl.ocx
      2018-05-08 21:12 - 2018-05-03 08:48 - 000408576 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\catsrvut.dll
      2018-05-08 21:12 - 2018-04-16 00:25 - 000327008 _____ (Microsoft Corporation) C:\WINDOWS\system32\shlwapi.dll
      2018-05-08 21:12 - 2018-04-16 00:25 - 000092032 _____ (Microsoft Corporation) C:\WINDOWS\system32\CloudNotifications.exe
      2018-05-08 21:12 - 2018-04-16 00:24 - 000063656 _____ (Microsoft Corporation) C:\WINDOWS\system32\appidapi.dll
      2018-05-08 21:12 - 2018-04-15 23:34 - 000572312 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\comctl32.dll
      2018-05-08 21:12 - 2018-04-15 23:34 - 000279472 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\shlwapi.dll
      2018-05-08 21:12 - 2018-04-15 23:34 - 000166408 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\CloudStorageWizard.exe
      2018-05-08 21:12 - 2018-04-15 23:34 - 000052248 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\appidapi.dll
      2018-05-08 21:12 - 2018-04-15 23:14 - 000436224 _____ (Microsoft Corporation) C:\WINDOWS\system32\wincorlib.dll
      2018-05-08 21:12 - 2018-04-15 23:14 - 000078336 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\CredProv2faHelper.dll
      2018-05-08 21:12 - 2018-04-15 23:13 - 000084992 _____ C:\WINDOWS\system32\DataStoreCacheDumpTool.exe
      2018-05-08 21:12 - 2018-04-15 23:12 - 000126976 _____ (Microsoft Corporation) C:\WINDOWS\system32\mssitlb.dll
      2018-05-08 21:12 - 2018-04-15 23:12 - 000045056 _____ (Microsoft Corporation) C:\WINDOWS\system32\Microsoft.Uev.Office2010CustomActions.dll
      2018-05-08 21:12 - 2018-04-15 23:11 - 000182272 _____ (Microsoft Corporation) C:\WINDOWS\system32\BitLockerCsp.dll
      2018-05-08 21:12 - 2018-04-15 23:11 - 000143872 _____ (Microsoft Corporation) C:\WINDOWS\system32\srpapi.dll
      2018-05-08 21:12 - 2018-04-15 23:11 - 000125440 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\srpapi.dll
      2018-05-08 21:12 - 2018-04-15 23:11 - 000113664 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\BitLockerCsp.dll
      2018-05-08 21:12 - 2018-04-15 23:11 - 000109568 _____ (Microsoft Corporation) C:\WINDOWS\system32\eShims.dll
      2018-05-08 21:12 - 2018-04-15 23:10 - 000571904 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\ngccredprov.dll
      2018-05-08 21:12 - 2018-04-15 23:10 - 000225280 _____ (Microsoft Corporation) C:\WINDOWS\system32\credprovs.dll
      2018-05-08 21:12 - 2018-04-15 23:10 - 000192000 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\credprovs.dll
      2018-05-08 21:12 - 2018-04-15 23:10 - 000120320 _____ (Microsoft Corporation) C:\WINDOWS\system32\appidsvc.dll
      2018-05-08 21:12 - 2018-04-15 23:10 - 000074240 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\SettingSyncPolicy.dll
      2018-05-08 21:12 - 2018-04-15 23:09 - 000145408 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\mssph.dll
      2018-05-08 21:12 - 2018-04-15 23:09 - 000090624 _____ (Microsoft Corporation) C:\WINDOWS\system32\SettingSyncPolicy.dll
      2018-05-08 21:12 - 2018-04-15 23:09 - 000037888 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\TokenBrokerUI.dll
      2018-05-08 21:12 - 2018-04-15 23:08 - 000490496 _____ (Microsoft Corporation) C:\WINDOWS\system32\SystemSettings.UserAccountsHandlers.dll
      2018-05-08 21:12 - 2018-04-15 23:08 - 000059904 _____ (Microsoft Corporation) C:\WINDOWS\system32\Windows.Shell.Search.UriHandler.dll
      2018-05-08 21:12 - 2018-04-15 23:07 - 000477184 _____ (Microsoft Corporation) C:\WINDOWS\system32\schannel.dll
      2018-05-08 21:12 - 2018-04-15 23:07 - 000406016 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\schannel.dll
      2018-05-08 21:12 - 2018-04-15 23:07 - 000312832 _____ (Microsoft Corporation) C:\WINDOWS\system32\AboveLockAppHost.dll
      2018-05-08 21:12 - 2018-04-15 23:07 - 000252928 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\AboveLockAppHost.dll
      2018-05-08 21:12 - 2018-04-15 23:07 - 000179712 _____ (Microsoft Corporation) C:\WINDOWS\system32\mssph.dll
      2018-05-08 21:12 - 2018-04-15 23:07 - 000044032 _____ (Microsoft Corporation) C:\WINDOWS\system32\TokenBrokerUI.dll
      2018-05-08 21:12 - 2018-04-15 23:06 - 000392192 _____ (Microsoft Corporation) C:\WINDOWS\system32\RDXTaskFactory.dll
      2018-05-08 21:12 - 2018-04-15 23:06 - 000139264 _____ (Microsoft Corporation) C:\WINDOWS\system32\mdmmigrator.dll
      2018-05-08 21:12 - 2018-04-15 23:05 - 000516608 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\Windows.Internal.Management.dll
      2018-05-08 21:12 - 2018-04-15 23:03 - 000697344 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\twinui.appcore.dll
      2018-05-08 21:12 - 2018-04-15 23:02 - 000440832 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\dmenrollengine.dll
      2018-05-08 21:12 - 2018-04-15 23:01 - 000194560 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\mdmregistration.dll
      2018-05-08 21:12 - 2018-04-15 23:01 - 000048128 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\ByteCodeGenerator.exe
      2018-05-08 21:12 - 2018-04-15 23:00 - 000669184 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\MCRecvSrc.dll
      2018-05-08 21:12 - 2018-04-15 23:00 - 000356352 _____ (Microsoft Corporation) C:\WINDOWS\system32\DeviceEnroller.exe
      2018-05-08 21:12 - 2018-04-15 23:00 - 000252416 _____ (Microsoft Corporation) C:\WINDOWS\system32\coredpus.dll
      2018-05-08 21:12 - 2018-04-15 23:00 - 000231936 _____ (Microsoft Corporation) C:\WINDOWS\system32\mdmregistration.dll
      2018-05-08 21:12 - 2018-04-15 23:00 - 000215552 _____ (Microsoft Corporation) C:\WINDOWS\system32\enrollmentapi.dll
      2018-05-08 21:12 - 2018-04-15 23:00 - 000058880 _____ (Microsoft Corporation) C:\WINDOWS\system32\ByteCodeGenerator.exe
      2018-05-08 21:12 - 2018-04-15 22:59 - 001332736 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\wsecedit.dll
      2018-05-08 21:12 - 2018-04-15 22:59 - 000971264 _____ (Microsoft Corporation) C:\WINDOWS\system32\MCRecvSrc.dll
      2018-05-08 21:12 - 2018-04-15 22:58 - 001472000 _____ (Microsoft Corporation) C:\WINDOWS\system32\wsecedit.dll
      2018-05-08 17:27 - 2018-05-08 17:27 - 000000000 ____D C:\Program Files\Intel
      2018-05-08 17:27 - 2017-08-21 17:13 - 000126584 _____ (Intel Corporation) C:\WINDOWS\system32\Drivers\IntelHaxm.sys
      2018-05-08 17:14 - 2018-05-08 17:14 - 000000000 ____D C:\Users\Erkant\AppData\Local\Android
      2018-05-08 17:13 - 2018-05-20 21:01 - 000000000 ____D C:\Users\Erkant\.android
      2018-05-08 17:13 - 2018-05-08 17:13 - 000000000 ____D C:\Users\Erkant\.AndroidStudio3.1
      2018-05-08 17:13 - 2018-05-08 17:13 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Android Studio
      2018-05-08 17:08 - 2018-05-08 17:08 - 000000000 ____D C:\Program Files\Android
      2018-05-08 17:06 - 2018-05-08 17:08 - 794908256 _____ (Google Inc.) C:\Users\Erkant\Downloads\android-studio-ide-173.4720617-windows.exe
      2018-05-08 17:04 - 2018-05-20 17:24 - 000000000 ____D C:\Users\Erkant\.gradle
      2018-05-08 17:04 - 2018-05-20 17:07 - 000000000 ____D C:\Users\Erkant\Downloads\TimeAttendance
      2018-05-08 17:03 - 2018-05-08 22:33 - 000000000 ____D C:\Users\Erkant\Downloads\Manchester-University
      2018-05-08 17:02 - 2018-05-08 17:02 - 004162176 _____ C:\Users\Erkant\Downloads\Manchester-University.rar
      2018-05-07 18:08 - 2018-05-07 18:08 - 000000000 ____H C:\WINDOWS\system32\Drivers\Msft_User_WpdMtpDr_01_11_00.Wdf
      2018-05-03 13:33 - 2018-05-03 13:33 - 000469851 _____ C:\Users\Erkant\Downloads\TimeAttendance.rar
      2018-05-03 13:24 - 2018-05-03 13:24 - 001438086 _____ (Igor Pavlov) C:\Users\Erkant\Downloads\7z1805-x64.exe
      2018-05-03 13:24 - 2018-05-03 13:24 - 000000000 ____D C:\Program Files\7-Zip
      2018-05-03 12:57 - 2018-05-03 12:57 - 000000000 ____D C:\Users\Erkant\AppData\LocalLow\Temp
      2018-05-02 19:37 - 2018-05-02 19:37 - 000000222 _____ C:\Users\Erkant\Desktop\Fossil Hunters.url
      2018-04-27 19:49 - 2018-04-27 19:49 - 000000000 ____D C:\Users\Erkant\AppData\Local\NVIDIA Corporation
      2018-04-27 19:48 - 2018-05-09 19:05 - 000000000 ____D C:\Users\Erkant\AppData\Local\UnrealEngine
      2018-04-27 19:47 - 2008-10-15 06:22 - 005631312 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DX9_40.dll
      2018-04-27 19:47 - 2008-10-15 06:22 - 004379984 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DX9_40.dll
      2018-04-27 19:47 - 2008-10-15 06:22 - 002605920 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DCompiler_40.dll
      2018-04-27 19:47 - 2008-10-15 06:22 - 002036576 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DCompiler_40.dll
      2018-04-27 19:47 - 2008-10-15 06:22 - 000519000 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx10_40.dll
      2018-04-27 19:47 - 2008-10-15 06:22 - 000452440 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx10_40.dll
      2018-04-27 19:44 - 2018-04-27 19:44 - 000000000 ____D C:\Users\Erkant\AppData\Local\TekkenGame
      2018-04-27 19:13 - 2018-04-27 19:15 - 022930498 _____ C:\Users\Erkant\Downloads\programming-basics-java-bg.pdf
      2018-04-27 17:59 - 2018-04-27 17:59 - 000000222 _____ C:\Users\Erkant\Desktop\TEKKEN 7.url
      2018-04-26 11:38 - 2018-04-26 11:49 - 000000000 ____D C:\WINDOWS\system32\Drivers\wd
      2018-04-26 11:38 - 2018-04-26 11:36 - 000548000 ____N (Microsoft Corporation) C:\WINDOWS\system32\MpSigStub.exe
      2018-04-26 11:37 - 2018-05-08 21:23 - 000000000 ____D C:\WINDOWS\system32\MRT
      2018-04-26 11:36 - 2018-05-08 21:22 - 141696960 ____C (Microsoft Corporation) C:\WINDOWS\system32\MRT-KB890830.exe
      2018-04-26 11:36 - 2018-05-08 21:22 - 141696960 ____C (Microsoft Corporation) C:\WINDOWS\system32\MRT.exe
      2018-04-26 00:14 - 2018-04-26 00:14 - 000000000 ____D C:\WINDOWS\InfusedApps
      2018-04-26 00:14 - 2018-04-25 13:28 - 000000000 ____D C:\WINDOWS\Panther
      2018-04-26 00:13 - 2018-04-26 00:13 - 000008192 _____ C:\WINDOWS\system32\config\userdiff
      2018-04-26 00:13 - 2018-04-25 13:16 - 000000000 ____D C:\WINDOWS\ServiceProfiles
      2018-04-26 00:11 - 2018-04-26 00:11 - 000000000 ____D C:\WINDOWS\Setup
      2018-04-26 00:10 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\containers
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\zu-ZA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\yo-NG
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\xh-ZA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\wo-SN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\vi-VN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\uz-Latn-UZ
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\ur-PK
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\ug-CN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\tt-RU
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\tn-ZA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\tk-TM
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\ti-ET
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\tg-Cyrl-TJ
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\te-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\ta-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\sw-KE
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\sr-Cyrl-RS
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\sr-Cyrl-BA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\sq-AL
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\si-LK
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\sd-Arab-PK
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\rw-RW
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\quz-PE
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\quc-Latn-GT
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\prs-AF
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\pa-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\pa-Arab-PK
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\or-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\nso-ZA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\nn-NO
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\ne-NP
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\mt-MT
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\mr-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\mn-MN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\ml-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\mk-MK
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\mi-NZ
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\lo-LA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\lb-LU
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\ky-KG
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\ku-Arab-IQ
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\kok-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\kn-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\km-KH
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\kk-KZ
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\ka-GE
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\is-IS
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\ig-NG
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\id-ID
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\hy-AM
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\ha-Latn-NG
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\gu-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\gd-GB
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\ga-IE
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\fil-PH
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\fa-IR
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\cy-GB
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\chr-CHER-US
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\ca-ES-valencia
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\bs-Latn-BA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\bn-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\bn-BD
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\be-BY
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\az-Latn-AZ
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\as-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\am-ET
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\af-ZA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\zu-ZA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\yo-NG
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\xh-ZA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\wo-SN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\vi-VN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\uz-Latn-UZ
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\ur-PK
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\ug-CN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\tt-RU
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\tn-ZA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\tk-TM
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\ti-ET
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\tg-Cyrl-TJ
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\te-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\ta-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\sw-KE
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\sr-Cyrl-RS
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\sr-Cyrl-BA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\sq-AL
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\si-LK
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\sd-Arab-PK
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\rw-RW
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\quz-PE
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\quc-Latn-GT
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\prs-AF
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\pa-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\pa-Arab-PK
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\or-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\nso-ZA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\nn-NO
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\ne-NP
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\mt-MT
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\mr-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\mn-MN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\ml-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\mk-MK
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\mi-NZ
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\lo-LA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\lb-LU
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\ky-KG
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\ku-Arab-IQ
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\kok-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\kn-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\km-KH
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\kk-KZ
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\ka-GE
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\is-IS
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\ig-NG
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\id-ID
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\hy-AM
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\ha-Latn-NG
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\gu-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\gd-GB
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\ga-IE
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\fil-PH
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\fa-IR
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\cy-GB
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\chr-CHER-US
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\ca-ES-valencia
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\bs-Latn-BA
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\bn-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\bn-BD
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\be-BY
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\az-Latn-AZ
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\as-IN
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\am-ET
      2018-04-26 00:07 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\af-ZA
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\WINDOWS\SysWOW64\MailContactsCalendarSync
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\WINDOWS\SysWOW64\hi-IN
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\WINDOWS\SysWOW64\gl-ES
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\WINDOWS\SysWOW64\eu-ES
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\WINDOWS\SysWOW64\ca-ES
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\WINDOWS\system32\MailContactsCalendarSync
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\WINDOWS\system32\hi-IN
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\WINDOWS\system32\gl-ES
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\WINDOWS\system32\eu-ES
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\WINDOWS\system32\ca-ES
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\WINDOWS\OCR
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\Program Files\Reference Assemblies
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\Program Files\MSBuild
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\Program Files (x86)\Reference Assemblies
      2018-04-26 00:07 - 2018-04-26 00:07 - 000000000 ____D C:\Program Files (x86)\MSBuild
      2018-04-26 00:03 - 2018-04-26 00:05 - 000000000 ____D C:\WINDOWS\SysWOW64\WCN
      2018-04-26 00:03 - 2018-04-26 00:05 - 000000000 ____D C:\WINDOWS\system32\WCN
      2018-04-26 00:03 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\SysWOW64\winrm
      2018-04-26 00:03 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\SysWOW64\sysprep
      2018-04-26 00:03 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\SysWOW64\slmgr
      2018-04-26 00:03 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\SysWOW64\Printing_Admin_Scripts
      2018-04-26 00:03 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\SysWOW64\0409
      2018-04-26 00:03 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\system32\winrm
      2018-04-26 00:03 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\system32\slmgr
      2018-04-26 00:03 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\system32\Printing_Admin_Scripts
      2018-04-26 00:03 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\system32\bg
      2018-04-26 00:03 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\system32\0409
      2018-04-26 00:03 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\DigitalLocker
      2018-04-25 23:58 - 2018-05-21 15:12 - 000000000 ____D C:\WINDOWS\DeliveryOptimization
      2018-04-25 23:58 - 2018-05-21 14:52 - 000000000 ___HD C:\WINDOWS\ELAMBKUP
      2018-04-25 23:58 - 2018-05-20 23:58 - 000000000 ___RD C:\Program Files (x86)
      2018-04-25 23:58 - 2018-05-20 21:43 - 000000000 ____D C:\WINDOWS\system32\GroupPolicy
      2018-04-25 23:58 - 2018-05-20 18:12 - 000000167 _____ C:\WINDOWS\win.ini
      2018-04-25 23:58 - 2018-05-20 18:04 - 000000000 ____D C:\Program Files\Common Files\microsoft shared
      2018-04-25 23:58 - 2018-05-20 18:03 - 000000000 ____D C:\ProgramData\regid.1991-06.com.microsoft
      2018-04-25 23:58 - 2018-05-20 18:01 - 000000000 ____D C:\Program Files\Common Files\system
      2018-04-25 23:58 - 2018-05-19 21:18 - 000000000 ___HD C:\Program Files\WindowsApps
      2018-04-25 23:58 - 2018-05-19 21:18 - 000000000 ____D C:\WINDOWS\AppReadiness
      2018-04-25 23:58 - 2018-05-19 13:42 - 000000000 ____D C:\WINDOWS\system32\NDF
      2018-04-25 23:58 - 2018-05-18 00:28 - 000000000 ____D C:\WINDOWS\system32\config\RegBack
      2018-04-25 23:58 - 2018-05-10 21:42 - 000000000 ____D C:\WINDOWS\rescache
      2018-04-25 23:58 - 2018-05-08 23:05 - 000000000 ___SD C:\WINDOWS\SysWOW64\DiagSvcs
      2018-04-25 23:58 - 2018-05-08 23:05 - 000000000 ____D C:\WINDOWS\SysWOW64\Dism
      2018-04-25 23:58 - 2018-05-08 23:04 - 000000000 ___SD C:\WINDOWS\system32\DiagSvcs
      2018-04-25 23:58 - 2018-05-08 23:04 - 000000000 ___RD C:\WINDOWS\ImmersiveControlPanel
      2018-04-25 23:58 - 2018-05-08 23:04 - 000000000 ____D C:\WINDOWS\system32\oobe
      2018-04-25 23:58 - 2018-05-08 23:04 - 000000000 ____D C:\WINDOWS\system32\Dism
      2018-04-25 23:58 - 2018-05-08 23:04 - 000000000 ____D C:\WINDOWS\ShellExperiences
      2018-04-25 23:58 - 2018-04-27 20:09 - 000000000 ____D C:\WINDOWS\LiveKernelReports
      2018-04-25 23:58 - 2018-04-26 11:38 - 000000000 ___RD C:\Program Files\Windows Defender
      2018-04-25 23:58 - 2018-04-26 00:14 - 000028672 _____ C:\WINDOWS\system32\config\BCD-Template
      2018-04-25 23:58 - 2018-04-26 00:14 - 000000000 ____D C:\WINDOWS\system32\WinBioDatabase
      2018-04-25 23:58 - 2018-04-26 00:14 - 000000000 ____D C:\WINDOWS\CSC
      2018-04-25 23:58 - 2018-04-26 00:10 - 000000000 ___SD C:\WINDOWS\SysWOW64\F12
      2018-04-25 23:58 - 2018-04-26 00:10 - 000000000 ___SD C:\WINDOWS\system32\F12
      2018-04-25 23:58 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\TextInput
      2018-04-25 23:58 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\SysWOW64\WinMetadata
      2018-04-25 23:58 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\WinMetadata
      2018-04-25 23:58 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\WinBioPlugIns
      2018-04-25 23:58 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\migwiz
      2018-04-25 23:58 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\system32\appraiser
      2018-04-25 23:58 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\Provisioning
      2018-04-25 23:58 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\PolicyDefinitions
      2018-04-25 23:58 - 2018-04-26 00:10 - 000000000 ____D C:\WINDOWS\bcastdvr
      2018-04-25 23:58 - 2018-04-26 00:10 - 000000000 ____D C:\Program Files\Windows Defender Advanced Threat Protection
      2018-04-25 23:58 - 2018-04-26 00:05 - 000000000 ____D C:\WINDOWS\system32\SystemResetPlatform
      2018-04-25 23:58 - 2018-04-26 00:05 - 000000000 ____D C:\Program Files\Windows Photo Viewer
      2018-04-25 23:58 - 2018-04-26 00:05 - 000000000 ____D C:\Program Files (x86)\Windows Photo Viewer
      2018-04-25 23:58 - 2018-04-26 00:05 - 000000000 ____D C:\Program Files (x86)\Windows Defender
      2018-04-25 23:58 - 2018-04-26 00:03 - 000000000 ___SD C:\WINDOWS\system32\dsc
      2018-04-25 23:58 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\SysWOW64\setup
      2018-04-25 23:58 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\SysWOW64\oobe
      2018-04-25 23:58 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\SysWOW64\MUI
      2018-04-25 23:58 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\SysWOW64\com
      2018-04-25 23:58 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\system32\setup
      2018-04-25 23:58 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\system32\MUI
      2018-04-25 23:58 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\system32\com
      2018-04-25 23:58 - 2018-04-26 00:03 - 000000000 ____D C:\WINDOWS\IME
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 __SHD C:\WINDOWS\BitLockerDiscoveryVolumeContents
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 __SHD C:\Program Files\Windows Sidebar
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 __SHD C:\Program Files (x86)\Windows Sidebar
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 __RSD C:\WINDOWS\media
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ___SD C:\WINDOWS\SysWOW64\Nui
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ___SD C:\WINDOWS\SysWOW64\Configuration
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ___SD C:\WINDOWS\system32\UNP
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ___SD C:\WINDOWS\system32\Nui
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ___SD C:\WINDOWS\system32\Configuration
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ___SD C:\WINDOWS\system32\AppV
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ___SD C:\WINDOWS\Downloaded Program Files
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ___RD C:\WINDOWS\Offline Web Pages
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\Web
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\Vss
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\tracing
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\TAPI
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\SMI
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\ras
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\NDF
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\Msdtc
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\migwiz
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\Macromed
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\Ipmi
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\InputMethod
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\inetsrv
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\IME
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\icsxml
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\GroupPolicyUsers
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\FxsTmp
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\downlevel
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\Bthprops
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\AppLocker
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SysWOW64\AdvancedInstallers
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SystemResources
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SystemApps
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\winevt
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\spool
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\SecureBootUpdates
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\ras
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\ProximityToast
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\PointOfService
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\MsDtc
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\Macromed
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\Ipmi
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\InputMethod
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\inetsrv
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\IME
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\icsxml
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\ias
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\hydrogen
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\GroupPolicyUsers
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\downlevel
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\DDFs
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\config\TxR
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\config\systemprofile
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\config\Journal
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\Bthprops
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\AppLocker
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\AdvancedInstallers
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\System
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SKB
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\security
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\schemas
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\SchCache
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\Resources
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\RemotePackages
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\Registration
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\PLA
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\Performance
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\ModemLogs
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\L2Schemas
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\InputMethod
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\Globalization
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\GameBarPresenceWriter
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\Cursors
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\Branding
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\appcompat
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\addins
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\ProgramData\WindowsHolographicDevices
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\Program Files\Windows Security
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\Program Files\Windows Portable Devices
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\Program Files\windows nt
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\Program Files\Windows Multimedia Platform
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\Program Files\Common Files\Services
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\Program Files (x86)\Windows Portable Devices
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\Program Files (x86)\windows nt
      2018-04-25 23:58 - 2018-04-25 23:58 - 000000000 ____D C:\Program Files (x86)\Windows Multimedia Platform
      2018-04-25 23:58 - 2018-04-25 23:55 - 000215943 _____ C:\WINDOWS\SysWOW64\dssec.dat
      2018-04-25 23:58 - 2018-04-25 23:55 - 000208384 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\msclmd.dll
      2018-04-25 23:58 - 2018-04-25 23:55 - 000027136 _____ (Khronos Group) C:\WINDOWS\SysWOW64\opencl.dll
      2018-04-25 23:58 - 2018-04-25 23:55 - 000000741 _____ C:\WINDOWS\SysWOW64\NOISE.DAT
      2018-04-25 23:58 - 2018-04-25 23:54 - 000229376 _____ (Microsoft Corporation) C:\WINDOWS\system32\msclmd.dll
      2018-04-25 23:58 - 2018-04-25 23:54 - 000215943 _____ C:\WINDOWS\system32\dssec.dat
      2018-04-25 23:58 - 2018-04-25 23:54 - 000017635 _____ C:\WINDOWS\system32\Drivers\etc\services
      2018-04-25 23:58 - 2018-04-25 23:54 - 000017572 _____ C:\WINDOWS\system32\OEMDefaultAssociations.xml
      2018-04-25 23:58 - 2018-04-25 23:54 - 000004096 _____ C:\WINDOWS\system32\config\VSMIDK
      2018-04-25 23:58 - 2018-04-25 23:54 - 000003683 _____ C:\WINDOWS\system32\Drivers\etc\lmhosts.sam
      2018-04-25 23:58 - 2018-04-25 23:54 - 000001358 _____ C:\WINDOWS\system32\Drivers\etc\protocol
      2018-04-25 23:58 - 2018-04-25 23:54 - 000000858 _____ C:\WINDOWS\system32\DefaultQuestions.json
      2018-04-25 23:58 - 2018-04-25 23:54 - 000000741 _____ C:\WINDOWS\system32\NOISE.DAT
      2018-04-25 23:58 - 2018-04-25 23:54 - 000000407 _____ C:\WINDOWS\system32\Drivers\etc\networks
      2018-04-25 23:58 - 2018-04-25 23:54 - 000000219 _____ C:\WINDOWS\system.ini
      2018-04-25 23:58 - 2018-04-25 13:28 - 000000000 ____D C:\ProgramData\USOPrivate
      2018-04-25 23:58 - 2018-04-25 13:25 - 000000000 __RHD C:\Users\Public\Libraries
      2018-04-25 23:58 - 2018-04-25 13:23 - 000000000 ____D C:\WINDOWS\system32\FxsTmp
      2018-04-25 23:58 - 2018-04-25 13:22 - 000000000 ____D C:\WINDOWS\system32\Sysprep
      2018-04-25 23:58 - 2018-04-25 13:19 - 000000000 ___RD C:\WINDOWS\PrintDialog
      2018-04-25 23:58 - 2018-04-25 13:18 - 000000000 ____D C:\WINDOWS\Help
      2018-04-25 23:56 - 2018-05-21 14:52 - 000000000 ____D C:\WINDOWS\INF
      2018-04-25 23:42 - 2018-05-08 21:21 - 000000000 ____D C:\WINDOWS\CbsTemp
      2018-04-25 23:38 - 2018-05-21 15:17 - 088342528 _____ C:\WINDOWS\system32\config\SOFTWARE
      2018-04-25 23:38 - 2018-05-21 15:17 - 013107200 _____ C:\WINDOWS\system32\config\SYSTEM
      2018-04-25 23:38 - 2018-05-21 15:17 - 000524288 _____ C:\WINDOWS\system32\config\DEFAULT
      2018-04-25 23:38 - 2018-05-21 15:17 - 000524288 _____ C:\WINDOWS\system32\config\BBI
      2018-04-25 23:38 - 2018-05-21 15:17 - 000024576 _____ C:\WINDOWS\system32\config\SECURITY
      2018-04-25 23:38 - 2018-05-08 23:04 - 000000000 ____D C:\WINDOWS\servicing
      2018-04-25 23:38 - 2018-04-26 00:14 - 000032768 _____ C:\WINDOWS\system32\config\SAM
      2018-04-25 23:38 - 2018-04-25 23:58 - 000000000 ____D C:\WINDOWS\system32\SMI
      2018-04-25 23:38 - 2018-04-25 13:26 - 000032768 _____ C:\WINDOWS\system32\config\ELAM
      2018-04-25 23:37 - 2018-04-26 00:15 - 000000000 ___HD C:\$SysReset
      2018-04-25 22:44 - 2010-06-02 04:55 - 000527192 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAudio2_7.dll
      2018-04-25 22:44 - 2010-06-02 04:55 - 000518488 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAudio2_7.dll
      2018-04-25 22:44 - 2010-06-02 04:55 - 000239960 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine3_7.dll
      2018-04-25 22:44 - 2010-06-02 04:55 - 000176984 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine3_7.dll
      2018-04-25 22:44 - 2010-06-02 04:55 - 000077656 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAPOFX1_5.dll
      2018-04-25 22:44 - 2010-06-02 04:55 - 000074072 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAPOFX1_5.dll
      2018-04-25 22:44 - 2010-05-26 11:41 - 002526056 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DCompiler_43.dll
      2018-04-25 22:44 - 2010-05-26 11:41 - 002401112 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DX9_43.dll
      2018-04-25 22:44 - 2010-05-26 11:41 - 002106216 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DCompiler_43.dll
      2018-04-25 22:44 - 2010-05-26 11:41 - 001998168 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DX9_43.dll
      2018-04-25 22:44 - 2010-05-26 11:41 - 001907552 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dcsx_43.dll
      2018-04-25 22:44 - 2010-05-26 11:41 - 001868128 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dcsx_43.dll
      2018-04-25 22:44 - 2010-05-26 11:41 - 000511328 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx10_43.dll
      2018-04-25 22:44 - 2010-05-26 11:41 - 000470880 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx10_43.dll
      2018-04-25 22:44 - 2010-05-26 11:41 - 000276832 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx11_43.dll
      2018-04-25 22:44 - 2010-05-26 11:41 - 000248672 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx11_43.dll
      2018-04-25 22:44 - 2010-02-04 10:01 - 000530776 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAudio2_6.dll
      2018-04-25 22:44 - 2010-02-04 10:01 - 000528216 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAudio2_6.dll
      2018-04-25 22:44 - 2010-02-04 10:01 - 000238936 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine3_6.dll
      2018-04-25 22:44 - 2010-02-04 10:01 - 000176984 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine3_6.dll
      2018-04-25 22:44 - 2010-02-04 10:01 - 000078680 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAPOFX1_4.dll
      2018-04-25 22:44 - 2010-02-04 10:01 - 000074072 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAPOFX1_4.dll
      2018-04-25 22:44 - 2010-02-04 10:01 - 000024920 _____ (Microsoft Corporation) C:\WINDOWS\system32\X3DAudio1_7.dll
      2018-04-25 22:44 - 2010-02-04 10:01 - 000022360 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\X3DAudio1_7.dll
      2018-04-25 22:44 - 2009-09-04 17:44 - 000517960 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAudio2_5.dll
      2018-04-25 22:44 - 2009-09-04 17:44 - 000515416 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAudio2_5.dll
      2018-04-25 22:44 - 2009-09-04 17:44 - 000238936 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine3_5.dll
      2018-04-25 22:44 - 2009-09-04 17:44 - 000176968 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine3_5.dll
      2018-04-25 22:44 - 2009-09-04 17:44 - 000073544 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAPOFX1_3.dll
      2018-04-25 22:44 - 2009-09-04 17:44 - 000069464 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAPOFX1_3.dll
      2018-04-25 22:44 - 2009-09-04 17:29 - 005554512 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dcsx_42.dll
      2018-04-25 22:44 - 2009-09-04 17:29 - 005501792 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dcsx_42.dll
      2018-04-25 22:44 - 2009-09-04 17:29 - 002582888 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DCompiler_42.dll
      2018-04-25 22:44 - 2009-09-04 17:29 - 002475352 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DX9_42.dll
      2018-04-25 22:44 - 2009-09-04 17:29 - 001974616 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DCompiler_42.dll
      2018-04-25 22:44 - 2009-09-04 17:29 - 001892184 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DX9_42.dll
      2018-04-25 22:44 - 2009-09-04 17:29 - 000523088 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx10_42.dll
      2018-04-25 22:44 - 2009-09-04 17:29 - 000453456 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx10_42.dll
      2018-04-25 22:44 - 2009-09-04 17:29 - 000285024 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx11_42.dll
      2018-04-25 22:44 - 2009-09-04 17:29 - 000235344 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx11_42.dll
      2018-04-25 22:44 - 2009-03-16 14:18 - 000521560 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAudio2_4.dll
      2018-04-25 22:44 - 2009-03-16 14:18 - 000174936 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine3_4.dll
      2018-04-25 22:44 - 2009-03-16 14:18 - 000024920 _____ (Microsoft Corporation) C:\WINDOWS\system32\X3DAudio1_6.dll
      2018-04-25 22:44 - 2009-03-09 15:27 - 005425496 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DX9_41.dll
      2018-04-25 22:44 - 2009-03-09 15:27 - 004178264 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DX9_41.dll
      2018-04-25 22:44 - 2009-03-09 15:27 - 002430312 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DCompiler_41.dll
      2018-04-25 22:44 - 2009-03-09 15:27 - 001846632 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DCompiler_41.dll
      2018-04-25 22:44 - 2009-03-09 15:27 - 000520544 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx10_41.dll
      2018-04-25 22:44 - 2009-03-09 15:27 - 000453456 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx10_41.dll
      2018-04-25 22:44 - 2008-10-27 10:04 - 000518480 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAudio2_3.dll
      2018-04-25 22:44 - 2008-10-27 10:04 - 000514384 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAudio2_3.dll
      2018-04-25 22:44 - 2008-10-27 10:04 - 000235856 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine3_3.dll
      2018-04-25 22:44 - 2008-10-27 10:04 - 000175440 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine3_3.dll
      2018-04-25 22:44 - 2008-10-27 10:04 - 000074576 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAPOFX1_2.dll
      2018-04-25 22:44 - 2008-10-27 10:04 - 000070992 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAPOFX1_2.dll
      2018-04-25 22:44 - 2008-10-27 10:04 - 000025936 _____ (Microsoft Corporation) C:\WINDOWS\system32\X3DAudio1_5.dll
      2018-04-25 22:44 - 2008-10-27 10:04 - 000023376 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\X3DAudio1_5.dll
      2018-04-25 22:44 - 2008-07-31 10:41 - 000238088 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine3_2.dll
      2018-04-25 22:44 - 2008-07-31 10:41 - 000177672 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine3_2.dll
      2018-04-25 22:44 - 2008-07-31 10:41 - 000072200 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAPOFX1_1.dll
      2018-04-25 22:44 - 2008-07-31 10:41 - 000068616 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAPOFX1_1.dll
      2018-04-25 22:44 - 2008-07-31 10:40 - 000513544 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAudio2_2.dll
      2018-04-25 22:44 - 2008-07-31 10:40 - 000509448 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAudio2_2.dll
      2018-04-25 22:44 - 2008-07-10 11:01 - 000467984 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx10_39.dll
      2018-04-25 22:44 - 2008-07-10 11:00 - 004992520 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DX9_39.dll
      2018-04-25 22:44 - 2008-07-10 11:00 - 003851784 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DX9_39.dll
      2018-04-25 22:44 - 2008-07-10 11:00 - 001942552 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DCompiler_39.dll
      2018-04-25 22:44 - 2008-07-10 11:00 - 001493528 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DCompiler_39.dll
      2018-04-25 22:44 - 2008-07-10 11:00 - 000540688 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx10_39.dll
      2018-04-25 22:44 - 2008-05-30 14:19 - 000511496 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAudio2_1.dll
      2018-04-25 22:44 - 2008-05-30 14:19 - 000507400 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAudio2_1.dll
      2018-04-25 22:44 - 2008-05-30 14:18 - 000238088 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine3_1.dll
      2018-04-25 22:44 - 2008-05-30 14:18 - 000177672 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine3_1.dll
      2018-04-25 22:44 - 2008-05-30 14:17 - 000068104 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAPOFX1_0.dll
      2018-04-25 22:44 - 2008-05-30 14:17 - 000065032 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAPOFX1_0.dll
      2018-04-25 22:44 - 2008-05-30 14:17 - 000025608 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\X3DAudio1_4.dll
      2018-04-25 22:44 - 2008-05-30 14:16 - 000028168 _____ (Microsoft Corporation) C:\WINDOWS\system32\X3DAudio1_4.dll
      2018-04-25 22:44 - 2008-05-30 14:11 - 004991496 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DX9_38.dll
      2018-04-25 22:44 - 2008-05-30 14:11 - 003850760 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DX9_38.dll
      2018-04-25 22:44 - 2008-05-30 14:11 - 001941528 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DCompiler_38.dll
      2018-04-25 22:44 - 2008-05-30 14:11 - 001491992 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DCompiler_38.dll
      2018-04-25 22:44 - 2008-05-30 14:11 - 000540688 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx10_38.dll
      2018-04-25 22:44 - 2008-05-30 14:11 - 000467984 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx10_38.dll
      2018-04-25 22:44 - 2008-03-05 16:04 - 000489480 _____ (Microsoft Corporation) C:\WINDOWS\system32\XAudio2_0.dll
      2018-04-25 22:44 - 2008-03-05 16:03 - 000479752 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAudio2_0.dll
      2018-04-25 22:44 - 2008-03-05 16:03 - 000238088 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine3_0.dll
      2018-04-25 22:44 - 2008-03-05 16:03 - 000177672 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine3_0.dll
      2018-04-25 22:44 - 2008-03-05 16:00 - 000028168 _____ (Microsoft Corporation) C:\WINDOWS\system32\X3DAudio1_3.dll
      2018-04-25 22:44 - 2008-03-05 16:00 - 000025608 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\X3DAudio1_3.dll
      2018-04-25 22:44 - 2008-03-05 15:56 - 004910088 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DX9_37.dll
      2018-04-25 22:44 - 2008-03-05 15:56 - 003786760 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DX9_37.dll
      2018-04-25 22:44 - 2008-03-05 15:56 - 001860120 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DCompiler_37.dll
      2018-04-25 22:44 - 2008-03-05 15:56 - 001420824 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DCompiler_37.dll
      2018-04-25 22:44 - 2008-02-05 23:07 - 000529424 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx10_37.dll
      2018-04-25 22:44 - 2008-02-05 23:07 - 000462864 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx10_37.dll
      2018-04-25 22:44 - 2007-10-22 03:40 - 000411656 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine2_10.dll
      2018-04-25 22:44 - 2007-10-22 03:39 - 000267272 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine2_10.dll
      2018-04-25 22:44 - 2007-10-22 03:37 - 000021000 _____ (Microsoft Corporation) C:\WINDOWS\system32\X3DAudio1_2.dll
      2018-04-25 22:44 - 2007-10-22 03:37 - 000017928 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\X3DAudio1_2.dll
      2018-04-25 22:44 - 2007-10-12 15:14 - 005081608 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx9_36.dll
      2018-04-25 22:44 - 2007-10-12 15:14 - 003734536 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx9_36.dll
      2018-04-25 22:44 - 2007-10-12 15:14 - 002006552 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DCompiler_36.dll
      2018-04-25 22:44 - 2007-10-12 15:14 - 001374232 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DCompiler_36.dll
      2018-04-25 22:44 - 2007-10-02 09:56 - 000508264 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx10_36.dll
      2018-04-25 22:44 - 2007-10-02 09:56 - 000444776 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx10_36.dll
      2018-04-25 22:44 - 2007-07-20 00:57 - 000411496 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine2_9.dll
      2018-04-25 22:44 - 2007-07-20 00:57 - 000267112 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine2_9.dll
      2018-04-25 22:44 - 2007-07-19 18:14 - 005073256 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx9_35.dll
      2018-04-25 22:44 - 2007-07-19 18:14 - 003727720 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx9_35.dll
      2018-04-25 22:44 - 2007-07-19 18:14 - 001985904 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DCompiler_35.dll
      2018-04-25 22:44 - 2007-07-19 18:14 - 001358192 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DCompiler_35.dll
      2018-04-25 22:44 - 2007-07-19 18:14 - 000508264 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx10_35.dll
      2018-04-25 22:44 - 2007-07-19 18:14 - 000444776 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx10_35.dll
      2018-04-25 22:44 - 2007-06-20 20:49 - 000409960 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine2_8.dll
      2018-04-25 22:44 - 2007-06-20 20:46 - 000266088 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine2_8.dll
      2018-04-25 22:44 - 2007-05-16 16:45 - 001401200 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DCompiler_34.dll
      2018-04-25 22:44 - 2007-05-16 16:45 - 001124720 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DCompiler_34.dll
      2018-04-25 22:44 - 2007-05-16 16:45 - 000506728 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx10_34.dll
      2018-04-25 22:44 - 2007-05-16 16:45 - 000443752 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx10_34.dll
      2018-04-25 22:43 - 2007-05-16 16:45 - 004496232 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx9_34.dll
      2018-04-25 22:43 - 2007-05-16 16:45 - 003497832 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx9_34.dll
      2018-04-25 22:43 - 2007-04-04 18:55 - 000403304 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine2_7.dll
      2018-04-25 22:43 - 2007-04-04 18:55 - 000261480 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine2_7.dll
      2018-04-25 22:43 - 2007-04-04 18:54 - 000107368 _____ (Microsoft Corporation) C:\WINDOWS\system32\xinput1_3.dll
      2018-04-25 22:43 - 2007-03-15 16:57 - 000506728 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx10_33.dll
      2018-04-25 22:43 - 2007-03-15 16:57 - 000443752 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx10_33.dll
      2018-04-25 22:43 - 2007-03-12 16:42 - 004494184 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx9_33.dll
      2018-04-25 22:43 - 2007-03-12 16:42 - 001400176 _____ (Microsoft Corporation) C:\WINDOWS\system32\D3DCompiler_33.dll
      2018-04-25 22:43 - 2007-03-12 16:42 - 001123696 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\D3DCompiler_33.dll
      2018-04-25 22:43 - 2007-03-05 12:42 - 000017688 _____ (Microsoft Corporation) C:\WINDOWS\system32\x3daudio1_1.dll
      2018-04-25 22:43 - 2007-03-05 12:42 - 000015128 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\x3daudio1_1.dll
      2018-04-25 22:43 - 2007-01-24 15:27 - 000393576 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine2_6.dll
      2018-04-25 22:43 - 2007-01-24 15:27 - 000255848 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine2_6.dll
      2018-04-25 22:43 - 2006-12-08 12:02 - 000251672 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine2_5.dll
      2018-04-25 22:43 - 2006-12-08 12:00 - 000390424 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine2_5.dll
      2018-04-25 22:43 - 2006-11-29 13:06 - 004398360 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx9_32.dll
      2018-04-25 22:43 - 2006-11-29 13:06 - 003426072 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx9_32.dll
      2018-04-25 22:43 - 2006-11-29 13:06 - 000469264 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx10.dll
      2018-04-25 22:43 - 2006-11-29 13:06 - 000440080 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx10.dll
      2018-04-25 22:43 - 2006-09-28 16:05 - 003977496 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx9_31.dll
      2018-04-25 22:43 - 2006-09-28 16:05 - 000237848 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine2_4.dll
      2018-04-25 22:43 - 2006-09-28 16:04 - 000364824 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine2_4.dll
      2018-04-25 22:43 - 2006-07-28 09:31 - 000083736 _____ (Microsoft Corporation) C:\WINDOWS\system32\xinput1_2.dll
      2018-04-25 22:43 - 2006-07-28 09:30 - 000363288 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine2_3.dll
      2018-04-25 22:43 - 2006-07-28 09:30 - 000236824 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine2_3.dll
      2018-04-25 22:43 - 2006-07-28 09:30 - 000062744 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xinput1_2.dll
      2018-04-25 22:43 - 2006-05-31 07:24 - 000230168 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine2_2.dll
      2018-04-25 22:43 - 2006-05-31 07:22 - 000354072 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine2_2.dll
      2018-04-25 22:43 - 2006-03-31 12:41 - 003927248 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx9_30.dll
      2018-04-25 22:43 - 2006-03-31 12:40 - 002388176 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx9_30.dll
      2018-04-25 22:43 - 2006-03-31 12:40 - 000352464 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine2_1.dll
      2018-04-25 22:43 - 2006-03-31 12:39 - 000229584 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine2_1.dll
      2018-04-25 22:43 - 2006-03-31 12:39 - 000083664 _____ (Microsoft Corporation) C:\WINDOWS\system32\xinput1_1.dll
      2018-04-25 22:43 - 2006-03-31 12:39 - 000062672 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xinput1_1.dll
      2018-04-25 22:43 - 2006-02-03 08:43 - 003830992 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx9_29.dll
      2018-04-25 22:43 - 2006-02-03 08:43 - 002332368 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx9_29.dll
      2018-04-25 22:43 - 2006-02-03 08:42 - 000355536 _____ (Microsoft Corporation) C:\WINDOWS\system32\xactengine2_0.dll
      2018-04-25 22:43 - 2006-02-03 08:42 - 000230096 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine2_0.dll
      2018-04-25 22:43 - 2006-02-03 08:41 - 000016592 _____ (Microsoft Corporation) C:\WINDOWS\system32\x3daudio1_0.dll
      2018-04-25 22:43 - 2006-02-03 08:41 - 000014032 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\x3daudio1_0.dll
      2018-04-25 22:43 - 2005-12-05 18:09 - 003815120 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx9_28.dll
      2018-04-25 22:43 - 2005-12-05 18:09 - 002323664 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx9_28.dll
      2018-04-25 22:43 - 2005-07-22 19:59 - 003807440 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx9_27.dll
      2018-04-25 22:43 - 2005-07-22 19:59 - 002319568 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx9_27.dll
      2018-04-25 22:43 - 2005-05-26 15:34 - 003767504 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx9_26.dll
      2018-04-25 22:43 - 2005-05-26 15:34 - 002297552 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx9_26.dll
      2018-04-25 22:43 - 2005-03-18 17:19 - 003823312 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx9_25.dll
      2018-04-25 22:43 - 2005-03-18 17:19 - 002337488 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx9_25.dll
      2018-04-25 22:43 - 2005-02-05 19:45 - 003544272 _____ (Microsoft Corporation) C:\WINDOWS\system32\d3dx9_24.dll
      2018-04-25 22:43 - 2005-02-05 19:45 - 002222800 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx9_24.dll
      2018-04-25 22:41 - 2018-04-25 22:44 - 000000000 ____D C:\WINDOWS\SysWOW64\directx
      2018-04-25 22:41 - 2018-04-25 22:41 - 000000000 ____D C:\Program Files (x86)\Microsoft XNA
      2018-04-25 22:41 - 2009-03-16 14:18 - 000517448 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\XAudio2_4.dll
      2018-04-25 22:41 - 2009-03-16 14:18 - 000235352 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xactengine3_4.dll
      2018-04-25 22:41 - 2009-03-16 14:18 - 000022360 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\X3DAudio1_6.dll
      2018-04-25 22:41 - 2007-04-04 18:53 - 000081768 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\xinput1_3.dll
      2018-04-25 22:41 - 2007-03-12 16:42 - 003495784 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx9_33.dll
      2018-04-25 22:41 - 2006-09-28 16:05 - 002414360 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\d3dx9_31.dll
      2018-04-25 21:49 - 2018-04-25 21:49 - 000000000 ____D C:\Users\Erkant\AppData\Local\DBG
      2018-04-25 21:48 - 2018-05-09 19:05 - 000000000 ____D C:\ProgramData\Package Cache
      2018-04-25 20:26 - 2018-04-25 20:26 - 000000222 _____ C:\Users\Erkant\Desktop\Bastion.url
      2018-04-25 14:36 - 2018-04-26 11:11 - 000000000 ____D C:\Users\Erkant\AppData\Local\Steam
      2018-04-25 14:36 - 2018-04-25 14:36 - 000000000 ____D C:\Users\Erkant\AppData\Local\CEF
      2018-04-25 14:35 - 2018-05-20 01:46 - 000000000 ____D C:\Users\Erkant\AppData\Local\Eclipse
      2018-04-25 14:35 - 2018-04-25 14:35 - 000001087 _____ C:\Users\Erkant\Desktop\Eclipse Java Oxygen.lnk
      2018-04-25 14:30 - 2018-05-21 15:45 - 000000000 ____D C:\Program Files (x86)\Steam
      2018-04-25 14:30 - 2018-04-25 14:30 - 000001028 _____ C:\Users\Public\Desktop\Steam.lnk
      2018-04-25 14:27 - 2018-05-10 16:19 - 000000000 ____D C:\Users\Erkant\AppData\Roaming\Notepad++
      2018-04-25 14:27 - 2018-04-25 14:28 - 000000000 ____D C:\Program Files\Notepad++
      2018-04-25 14:27 - 2018-04-25 14:27 - 000000865 _____ C:\Users\Public\Desktop\Notepad++.lnk
      2018-04-25 14:21 - 2018-04-25 14:21 - 000003734 _____ C:\WINDOWS\System32\Tasks\JavaUpdateSched
      2018-04-25 14:21 - 2018-04-25 14:21 - 000000000 ____D C:\Users\Erkant\AppData\Roaming\Sun
      2018-04-25 14:21 - 2018-04-25 14:21 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Java
      2018-04-25 14:21 - 2018-04-25 14:20 - 000144448 _____ (Oracle Corporation) C:\WINDOWS\system32\WindowsAccessBridge-64.dll
      2018-04-25 14:14 - 2018-04-25 14:20 - 000000000 ____D C:\Program Files\Java
      2018-04-25 14:10 - 2018-04-25 14:10 - 000000000 ____D C:\ProgramData\Oracle
      2018-04-25 13:54 - 2018-04-25 13:54 - 000000000 ____D C:\Users\Erkant\AppData\Roaming\Google
      2018-04-25 13:50 - 2018-05-17 21:16 - 000002301 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Google Chrome.lnk
      2018-04-25 13:50 - 2018-05-17 21:16 - 000002260 _____ C:\Users\Public\Desktop\Google Chrome.lnk
      2018-04-25 13:50 - 2018-05-17 21:09 - 000003418 _____ C:\WINDOWS\System32\Tasks\GoogleUpdateTaskMachineUA
      2018-04-25 13:50 - 2018-05-17 21:09 - 000003294 _____ C:\WINDOWS\System32\Tasks\GoogleUpdateTaskMachineCore
      2018-04-25 13:49 - 2018-05-21 01:16 - 000000000 ____D C:\Program Files (x86)\Google
      2018-04-25 13:49 - 2018-04-25 14:50 - 000000000 ____D C:\Users\Erkant\AppData\Local\Google
      2018-04-25 13:48 - 2018-04-25 13:48 - 000000000 ____D C:\Users\Erkant\AppData\Local\PeerDistRepub
      2018-04-25 13:33 - 2018-04-25 13:33 - 000000000 ____D C:\ProgramData\USOShared
      2018-04-25 13:31 - 2018-04-25 13:32 - 000000000 ___RD C:\Users\Erkant\OneDrive
      2018-04-25 13:30 - 2018-04-25 13:30 - 000000000 ____D C:\Users\Erkant\AppData\Local\Comms
      2018-04-25 13:30 - 2018-04-25 13:30 - 000000000 ____D C:\ProgramData\Microsoft OneDrive
      2018-04-25 13:29 - 2018-05-21 14:13 - 000996206 _____ C:\WINDOWS\system32\PerfStringBackup.INI
      2018-04-25 13:29 - 2018-04-25 13:29 - 000000000 ____D C:\Users\Erkant\AppData\Local\Publishers
      2018-04-25 13:29 - 2018-04-25 13:29 - 000000000 ____D C:\Users\Erkant\AppData\Local\MicrosoftEdge
      2018-04-25 13:28 - 2018-05-20 23:55 - 000000000 ____D C:\Users\Erkant\AppData\Local\Packages
      2018-04-25 13:28 - 2018-04-25 13:28 - 000000020 ___SH C:\Users\Erkant\ntuser.ini
      2018-04-25 13:28 - 2018-04-25 13:28 - 000000000 ____D C:\Users\Erkant\AppData\Roaming\Adobe
      2018-04-25 13:28 - 2018-04-25 13:28 - 000000000 ____D C:\Users\Erkant\AppData\Local\VirtualStore
      2018-04-25 13:28 - 2018-04-25 13:28 - 000000000 ____D C:\Users\Erkant\AppData\Local\ConnectedDevicesPlatform
      2018-04-25 13:27 - 2018-04-25 13:27 - 000000000 _SHDL C:\Users\Default User
      2018-04-25 13:27 - 2018-04-25 13:27 - 000000000 _SHDL C:\Users\All Users
      2018-04-25 13:26 - 2018-05-21 15:17 - 000000006 ____H C:\WINDOWS\Tasks\SA.DAT
      2018-04-25 13:22 - 2018-05-21 13:51 - 000000000 ____D C:\Users\Erkant
      2018-04-25 13:19 - 2018-03-13 08:02 - 002241024 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\PrintConfig.dll
      2018-04-25 13:18 - 2018-05-21 15:17 - 000000000 ____D C:\ProgramData\NVIDIA
      2018-04-25 13:18 - 2018-04-25 13:18 - 000000000 ____H C:\ProgramData\DP45977C.lfl
      2018-04-25 13:18 - 2018-04-25 13:18 - 000000000 ____D C:\WINDOWS\system32\DAX3
      2018-04-25 13:18 - 2018-04-25 13:18 - 000000000 ____D C:\WINDOWS\system32\DAX2
      2018-04-25 13:18 - 2018-04-25 13:18 - 000000000 ____D C:\ProgramData\NVIDIA Corporation
      2018-04-25 13:18 - 2018-04-25 13:18 - 000000000 ____D C:\ProgramData\Audyssey Labs
      2018-04-25 13:18 - 2018-04-25 13:18 - 000000000 ____D C:\Program Files\NVIDIA Corporation
      2018-04-25 13:18 - 2018-04-25 13:18 - 000000000 ____D C:\Program Files (x86)\NVIDIA Corporation
      2018-04-25 13:18 - 2017-10-27 19:36 - 000001951 _____ C:\WINDOWS\NvContainerRecovery.bat
      2018-04-25 13:18 - 2017-10-27 19:12 - 005960824 _____ (NVIDIA Corporation) C:\WINDOWS\system32\nvcpl.dll
      2018-04-25 13:18 - 2017-10-27 19:12 - 002587768 _____ (NVIDIA Corporation) C:\WINDOWS\system32\nvsvc64.dll
      2018-04-25 13:18 - 2017-10-27 19:12 - 001766520 _____ (NVIDIA Corporation) C:\WINDOWS\system32\nvsvcr.dll
      2018-04-25 13:18 - 2017-10-27 19:12 - 000607168 _____ (NVIDIA Corporation) C:\WINDOWS\system32\nv3dappshext.dll
      2018-04-25 13:18 - 2017-10-27 19:12 - 000449656 _____ (NVIDIA Corporation) C:\WINDOWS\system32\nvmctray.dll
      2018-04-25 13:18 - 2017-10-27 19:12 - 000123000 _____ (NVIDIA Corporation) C:\WINDOWS\system32\nvshext.dll
      2018-04-25 13:18 - 2017-10-27 19:12 - 000081856 _____ (NVIDIA Corporation) C:\WINDOWS\system32\nv3dappshextr.dll
      2018-04-25 13:18 - 2017-10-25 13:33 - 007802921 _____ C:\WINDOWS\system32\nvcoproc.bin
      2018-04-25 13:17 - 2018-04-25 13:17 - 000000000 ____D C:\WINDOWS\SysWOW64\RTCOM
      2018-04-25 13:17 - 2018-04-25 13:17 - 000000000 ____D C:\Program Files\Realtek
      2018-04-25 13:16 - 2018-05-21 13:59 - 000000000 ____D C:\WINDOWS\system32\SleepStudy
      2018-04-25 13:16 - 2018-05-21 01:16 - 000393320 _____ C:\WINDOWS\system32\FNTCACHE.DAT
      2018-04-21 22:43 - 2018-04-21 22:43 - 000000000 ____D C:\Users\Erkant\AppData\LocalLow\Reptoid Games
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-05-20 01:46 - 2018-03-14 17:53 - 000000000 ____D C:\Users\Erkant\.p2
      2018-05-19 14:46 - 2018-04-17 11:42 - 000000073 _____ C:\Users\Erkant\Desktop\Key.txt
      2018-05-16 00:46 - 2018-03-13 12:59 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\NVIDIA Corporation
      2018-05-10 16:38 - 2018-03-14 17:58 - 000000000 ____D C:\Users\Erkant\eclipse-workspace
      2018-05-08 23:09 - 2018-03-13 00:04 - 000000000 __RHD C:\Users\Public\AccountPictures
      2018-05-08 23:09 - 2018-03-13 00:04 - 000000000 ___RD C:\Users\Erkant\3D Objects
      2018-05-08 21:16 - 2017-09-29 16:42 - 000045056 _____ (Microsoft Corporation) C:\WINDOWS\SysWOW64\jsproxy.dll
      2018-05-08 21:15 - 2017-09-29 16:41 - 000073112 _____ (Microsoft Corporation) C:\WINDOWS\system32\Drivers\hvservice.sys
      2018-05-08 21:15 - 2017-09-29 16:41 - 000050688 _____ (Microsoft Corporation) C:\WINDOWS\system32\jsproxy.dll
      2018-05-08 21:15 - 2017-09-29 16:41 - 000020888 _____ (Microsoft Corporation) C:\WINDOWS\system32\kdhvcom.dll
      2018-05-03 13:24 - 2018-03-13 15:45 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\7-Zip
      2018-04-25 14:32 - 2018-03-14 17:54 - 000000000 ____D C:\Users\Erkant\eclipse
      2018-04-25 14:30 - 2018-03-14 15:29 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Steam
      2018-04-25 14:27 - 2018-03-14 17:28 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Notepad++
      2018-04-25 14:21 - 2018-03-14 17:29 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Java Development Kit
      2018-04-25 13:25 - 2018-04-05 13:24 - 000000000 ___SD C:\Users\Erkant\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\OpenOffice 4.1.2
      2018-04-25 13:25 - 2018-03-14 17:57 - 000000000 ____D C:\Users\Erkant\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Eclipse
      Some files in TEMP:
      2018-05-21 13:39 - 2018-05-21 13:26 - 078346672 _____ (Malwarebytes                                                ) C:\Users\Erkant\AppData\Local\Temp\mb3-setup-consumer-
      2018-05-21 15:15 - 2018-05-21 15:14 - 074288784 _____ (Malwarebytes                                                ) C:\Users\Erkant\AppData\Local\Temp\mb3-setup-consumer-
      2017-10-26 11:07 - 2017-10-26 11:07 - 000488960 _____ () C:\Users\Erkant\AppData\Local\Temp\sqlite3.exe
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\WINDOWS\system32\winlogon.exe => File is digitally signed
      C:\WINDOWS\system32\wininit.exe => File is digitally signed
      C:\WINDOWS\explorer.exe => File is digitally signed
      C:\WINDOWS\SysWOW64\explorer.exe => File is digitally signed
      C:\WINDOWS\system32\svchost.exe => File is digitally signed
      C:\WINDOWS\SysWOW64\svchost.exe => File is digitally signed
      C:\WINDOWS\system32\services.exe => File is digitally signed
      C:\WINDOWS\system32\User32.dll => File is digitally signed
      C:\WINDOWS\SysWOW64\User32.dll => File is digitally signed
      C:\WINDOWS\system32\userinit.exe => File is digitally signed
      C:\WINDOWS\SysWOW64\userinit.exe => File is digitally signed
      C:\WINDOWS\system32\rpcss.dll => File is digitally signed
      C:\WINDOWS\system32\dnsapi.dll => File is digitally signed
      C:\WINDOWS\SysWOW64\dnsapi.dll => File is digitally signed
      C:\WINDOWS\system32\Drivers\volsnap.sys => File is digitally signed
      LastRegBack: 2018-05-18 00:28
      ==================== End of FRST.txt ============================
      Addition_21-05-2018 16.20.10.txt
    • от kalinm
      Имам проблем с JRT и AdwCleaner. Имам ги и двете, но не могат да се стартират. Като щракна в папката на AdwCleaner, се затваря файловия мениджър (експлорер) и не мога да достигна до .ехе файла. Същото се случва и когато отида на страницата за изтегляне на AdwCleaner. Явно имам някаква зараза. Това се случи, след сваляне на една програма  и се накачиха вируси, които засече Windows Defender и уж ги изчисти, но това остана като проблем.
      Промени се и началната страница за зареждане на мозилата, но го оправих. Дори текстов файл, в заглавието на който има име AdwCleaner не се отворя. По някакъв начин един път успях да отворя програмата AdwCleaner и сканирам компа, която откри доста неща, които  видях в лог файла след сканирането, че са премахнати и докато се наканих да го запаша в друга директория, той се затвори и се е записал в папката на AdwCleaner, която не мога да отворя. Добре че първия текстов лог файл при първоначалното сканиране записах какво е открил, но го преименувах с име промяна.txt , защото с име AdwCleaner(...).тхт не се отваря. Прикачвам го.
      JRT уж се стартира, но приключва без видимо стартиране.
      Въпросът ми е, може ли да ми помогнете с решаването на този проблем.
      За всеки случай, моят Е-майл: kalinm@gbg.bg. Използвам лицензиран Windows 10 Home, който актуализирах да последната версия 1803 на 7 май.
      Интересното е, че и точките за възстановяване на системата ги няма. Все едно че тази опция не е избирана, т.е. казва ми да включа опцията за възстановяване. А беше включена...
      Дефендера казва, че няма вируси, но явно има нещо много нередно.
      А не ми се иска да преинсталирам
      В момента не разполагам с компакт диск за операционната система WINDOWS 10 Home 64 bit for OEM версия 1511, тъй като съм в друго населено място. Имам диск дори и втори, който създадох миналата година с по-новата версия  1607, но не са при мен, но разполагам с  Регистрационния 25-знаков продуктов ключ. Сега съм с Windows 10 Home последната версия 1803, който обнових, но след заразата.
  • Дарение



Поставихме бисквитки на устройството ви за най-добро потребителско изживяване. Можете да промените настройките си за бисквитки, или в противен случай приемаме, че сте съгласни с нашите условия за ползване.