Премини към съдържанието

Препоръчан отговор

Здравейте на всички :)

Така, от доста време забелязвам, че компютъра се товари доста, бавно зарежда уиндолса, малко фпс в игри ;/

И реших да направим една проверка .. : )





DDS (Ver_2011-09-30.01) - NTFS_x86 Internet Explorer: 9.10.9200.16686  BrowserJavaVersion: 10.25.2 Run by User at 19:14:52 on 2013-10-07 Microsoft Windows 7 Enterprise 6.1.7601.1.1251.359.1026.18.1917.915 [GMT 3:00] . AV: Microsoft Security Essentials *Disabled/Updated* {641105E6-77ED-3F35-A304-765193BCB75F} SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46} SP: Microsoft Security Essentials *Disabled/Updated* {DF70E402-51D7-30BB-99B4-4D23E83BFDE2} . ============== Running Processes ================ . C:Windowssystem32wininit.exe C:Windowssystem32lsm.exe C:Program FilesMicrosoft Security ClientMsMpEng.exe C:WindowsSystem32spoolsv.exe C:Program FilesApplication UpdaterApplicationUpdater.exe C:PROGRA~1MYWEBS~1bar1.binmwssvc.exe C:Windowssystem32taskhost.exe C:Windowssystem32PnkBstrA.exe D:MCRazer Game BoosterRzKLService.exe C:ProgramDataSkypeToolbarsSkype C2C Servicec2c_service.exe C:Windowssystem32Dwm.exe C:WindowsExplorer.EXE C:Program FilesTeamViewerVersion8TeamViewer_Service.exe C:Program FilesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exe C:WindowsZSSnp211.exe C:Program FilesMicrosoft Security Clientmsseces.exe C:Program FilesAVG Secure Searchvprot.exe C:WindowsSystem32hkcmd.exe C:WindowsSystem32igfxpers.exe C:Program FilesCommon FilesJavaJava Updatejusched.exe C:Program FilesCommon FilesSpigotSearch SettingsSearchSettings.exe D:DownloadsmyНова папкаhamachi-2-ui.exe C:Program FilesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12loggingserver.exe C:Windowssystem32conhost.exe C:Windowssystem32driverssfuservice.exe D:DownloadsmyНова папкаLMIGuardianSvc.exe C:Program FilesCommon FilesMicrosoft SharedWindows LiveWLIDSVC.EXE C:Program FilesCommon FilesMicrosoft SharedWindows LiveWLIDSvcM.exe D:DownloadsmyНова папкаhamachi-2.exe D:DownloadsmyНова папкаLMIGuardianSvc.exe C:Program FilesWindows Sidebarsidebar.exe C:Windowssystem32SearchIndexer.exe C:WindowsMicrosoft.NetFrameworkv3.0WPFPresentationFontCache.exe C:UsersUserAppDataLocalAkamainetsession_win.exe C:UsersUserAppDataLocalAkamainetsession_win.exe C:WindowsSystem32WUDFHost.exe C:Program FilesWindows Media Playerwmpnetwk.exe C:Windowssystem32DllHost.exe C:Program FilesMozilla Firefoxfirefox.exe C:Program FilesMozilla Firefoxplugin-container.exe C:Windowssystem32MacromedFlashFlashPlayerPlugin_11_8_800_168.exe C:Windowssystem32MacromedFlashFlashPlayerPlugin_11_8_800_168.exe C:Windowssystem32wbemwmiprvse.exe C:Windowssystem32vssvc.exe C:Windowssystem32SearchProtocolHost.exe C:Windowssystem32SearchFilterHost.exe C:Windowssystem32conhost.exe C:Windowssystem32svchost.exe -k DcomLaunch C:Windowssystem32svchost.exe -k RPCSS C:WindowsSystem32svchost.exe -k LocalServiceNetworkRestricted C:WindowsSystem32svchost.exe -k LocalSystemNetworkRestricted C:Windowssystem32svchost.exe -k LocalService C:Windowssystem32svchost.exe -k netsvcs C:Windowssystem32svchost.exe -k NetworkService C:Windowssystem32svchost.exe -k LocalServiceNoNetwork C:Windowssystem32svchost.exe -k LocalServiceAndNoImpersonation C:Windowssystem32svchost.exe -k imgsvc C:Windowssystem32svchost.exe -k NetworkServiceNetworkRestricted C:WindowsSystem32svchost.exe -k LocalServicePeerNet C:WindowsSystem32svchost.exe -k swprv . ============== Pseudo HJT Report =============== . uProxyOverride = <local> uURLSearchHooks: YTD Toolbar: {F3FEE66E-E034-436a-86E4-9690573BEE8A} - uURLSearchHooks: {00A6FAF6-072E-44cf-8957-5838F569A31D} - <orphaned> BHO: privitize Helper Object: {1ACB5ABE-4890-4747-952C-F13BDB93FB75} - c:program filesindustriyaprivitize1.8.21.6bhprivitize.dll BHO: Groove GFS Browser Helper: {72853161-30C5-4D22-B7F9-0BBC1D38A37E} - c:program filesmicrosoft officeoffice14GROOVEEX.DLL BHO: Java Plug-In SSV Helper: {761497BB-D6F0-462C-B6EB-D4DAF1D92D43} - c:program filesjavajre7binssv.dll BHO: Windows Live ID Sign-in Helper: {9030D464-4C02-4ABF-8ECC-5164760863C6} - c:program filescommon filesmicrosoft sharedwindows liveWindowsLiveLogin.dll BHO: AVG Security Toolbar: {95B7759C-8C7F-4BF1-B163-73684A933233} - c:program filesavg secure search17.0.1.12AVG Secure Search_toolbar.dll BHO: Skype Browser Helper: {AE805869-2E5C-4ED4-8F7B-F1F7851A4497} - c:program filesskypetoolbarsinternet explorerskypeieplugin.dll BHO: Office Document Cache Handler: {B4F3A835-0E21-4959-BA22-42B3008E02FF} - c:program filesmicrosoft officeoffice14URLREDIR.DLL BHO: Java Plug-In 2 SSV Helper: {DBC80044-A445-435b-BC74-9C25C1C588A9} - c:program filesjavajre7binjp2ssv.dll BHO: YTD Toolbar: {F3FEE66E-E034-436a-86E4-9690573BEE8A} - TB: <No Name>: {E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39} - LocalServer32 - <no file> TB: AVG Security Toolbar: {95B7759C-8C7F-4BF1-B163-73684A933233} - c:program filesavg secure search17.0.1.12AVG Secure Search_toolbar.dll TB: privitize Toolbar: {1C46A0DD-D53E-46C4-A435-CA11103E255E} - c:program filesindustriyaprivitize1.8.21.6privitizeTlbr.dll TB: YTD Toolbar: {F3FEE66E-E034-436a-86E4-9690573BEE8A} - uRun: [DAEMON Tools Lite] "c:program filesdaemon tools liteDTLite.exe" -autorun uRun: [sidebar] c:program fileswindows sidebarsidebar.exe /autoRun uRun: [skype] "c:program filesskypephoneSkype.exe" /minimized /regrun uRun: [Clownfish] "c:program filesclownfishClownfish.exe" uRun: [Akamai NetSession Interface] "c:usersuserappdatalocalakamainetsession_win.exe" mRun: [bCSSync] "c:program filesmicrosoft officeoffice14BCSSync.exe" /DelayServices mRun: [ZSSnp211] c:windowsZSSnp211.exe mRun: [Google Desktop Search] "c:program filesgooglegoogle desktop searchGoogleDesktop.exe" /startup mRun: [MSC] "c:program filesmicrosoft security clientmsseces.exe" -hide -runkey mRun: [vProt] "c:program filesavg secure searchvprot.exe" mRun: [Driver Genius] <no file> mPolicies-System: ConsentPromptBehaviorUser = dword:3 mPolicies-System: EnableUIADesktopToggle = dword:0 IE: Download all by FlashGet3 - c:program filesflashget networkflashget 3GetAllUrl.htm IE: Download by FlashGet3 - c:program filesflashget networkflashget 3GetUrl.htm IE: E&xport to Microsoft Excel - c:progra~1micros~2office14EXCEL.EXE/3000 IE: Free YouTube Download - c:usersuserappdataroamingdvdvideosoftiehelpersfreeytvdownloader.htm IE: Free YouTube to MP3 Converter - c:usersuserappdataroamingdvdvideosoftiehelpersfreeyoutubetomp3converter.htm IE: Se&nd to OneNote - c:progra~1micros~2office14ONBttnIE.dll/105 IE: ????3?? - <no file> IE: ????3?????? - <no file> IE: {2670000A-7350-4f3c-8081-5663EE0C6C49} - {48E73304-E1D6-4330-914C-F5F514E3486C} - c:program filesmicrosoft officeoffice14ONBttnIE.dll IE: {789FE86F-6FC4-46A1-9849-EDE0DB0C95CA} - {FFFDC614-B694-4AE6-AB38-5D6374584B52} - c:program filesmicrosoft officeoffice14ONBttnIELinkedNotes.dll IE: {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - c:program filesskypetoolbarsinternet explorerskypeieplugin.dll Trusted Zone: clonewarsadventures.com Trusted Zone: freerealms.com Trusted Zone: soe.com Trusted Zone: sony.com TCP: NameServer = TCP: Interfaces{2C4E44DB-F385-4EEB-A10C-DCAB6B3D8099} : DHCPNameServer = Filter: text/xml - {807573E5-5146-11D5-A672-00B0D022E945} - c:program filescommon filesmicrosoft sharedoffice14MSOXMLMF.DLL Handler: skype-ie-addon-data - {91774881-D725-4E58-B298-07617B9B86A8} - c:program filesskypetoolbarsinternet explorerskypeieplugin.dll Handler: skype4com - {FFC8B962-9B40-4DFF-9458-1830C7DD7F5D} - c:program filescommon filesskypeSkype4COM.dll Handler: viprotocol - {B658800C-F66E-4EF3-AB85-6C0C227862A9} - c:program filescommon filesavg secure searchviprotocolinstaller17.0.12ViProtocol.dll Handler: wlpg - {E43EF6CD-A37A-4A9B-9E6F-83F89B8E6324} - c:program fileswindows livephoto galleryAlbumDownloadProtocolHandler.dll Notify: igfxcui - igfxdev.dll SSODL: WebCheck - <orphaned> SEH: Groove GFS Stub Execution Hook - {B5A7F190-DDA6-4420-B3BA-52453494E6CD} - c:program filesmicrosoft officeoffice14GROOVEEX.DLL LSA: Security Packages =  kerberos msv1_0 schannel wdigest tspkg pku2u livessp mASetup: {8A69D345-D564-463c-AFF1-A69D9E530F96} - "c:program filesgooglechromeapplication30.0.1599.69installerchrmstp.exe" --configure-user-settings --verbose-logging --system-level --multi-install --chrome . ================= FIREFOX =================== . FF - ProfilePath - c:usersuserappdataroamingmozillafirefoxprofilesptoklpuh.default FF - prefs.js: browser.search.defaulturl - FF - prefs.js: browser.search.selectedEngine - Search The Web (privitize) FF - plugin: c:progra~1micros~2office14NPAUTHZ.DLL FF - plugin: c:progra~1micros~2office14NPSPWRAP.DLL FF - plugin: c:program filescommon filesavg secure searchsitesafetyinstaller17.0.12npsitesafety.dll FF - plugin: c:program filesgooglegoogle earthpluginnpgeplugin.dll FF - plugin: c:program filesgoogleupdate1.3.21.153npGoogleUpdate3.dll FF - plugin: c:program filesjavajre7binplugin2npjp2.dll FF - plugin: c:program filesmicrosoft silverlight5.1.20513.0npctrlui.dll FF - plugin: c:program filesmywebsearchbar1.binNPMYWEBS.DLL FF - plugin: c:program filespando networksmedia boosternpPandoWebPlugin.dll FF - plugin: c:program fileswindows livephoto galleryNPWLPG.dll FF - plugin: c:programdatanexoneungmnpNxGameEU.dll FF - plugin: c:usersuserappdatalocalfacebookvideoskypenpFacebookVideoCalling.dll FF - plugin: c:windowssystem32macromedflashNPSWF32_11_8_800_168.dll FF - plugin: c:windowssystem32npDeployJava1.dll FF - plugin: c:windowssystem32npmproxy.dll . ---- FIREFOX POLICIES ---- FF - user.js: extensions.softonic_i.newTab - false FF - user.js: extensions.softonic_i.id - d65288460000000000002c27d72d77db FF - user.js: extensions.softonic_i.instlDay - 15401 FF - user.js: extensions.softonic_i.vrsn - FF - user.js: extensions.softonic_i.vrsni - FF - user.js: extensions.softonic_i.vrsnTs - FF - user.js: extensions.softonic_i.prtnrId - softonic FF - user.js: extensions.softonic_i.prdct - softonic FF - user.js: extensions.softonic_i.aflt - orgnl FF - user.js: extensions.softonic_i.smplGrp - eng7 FF - user.js: extensions.softonic_i.tlbrId - eng7 FF - user.js: extensions.softonic_i.instlRef - MON00001 FF - user.js: extensions.softonic_i.dfltLng - FF - user.js: extensions.softonic_i.excTlbr - false FF - user.js: extensions.privitize.id - d65288460000000000002c27d72d77db FF - user.js: extensions.privitize.appId - {301966DF-A84B-4255-AAB9-574B5CE237E4} FF - user.js: extensions.privitize.instlDay - 15876 FF - user.js: extensions.privitize.vrsn - FF - user.js: extensions.privitize.vrsni - FF - user.js: extensions.privitize.vrsnTs - FF - user.js: extensions.privitize.prtnrId - privitize FF - user.js: extensions.privitize.prdct - privitize FF - user.js: extensions.privitize.aflt - 5 FF - user.js: extensions.privitize.smplGrp - none FF - user.js: extensions.privitize.tlbrId - base FF - user.js: extensions.privitize.instlRef - FF - user.js: extensions.privitize.dfltLng - FF - user.js: extensions.privitize.excTlbr - false FF - user.js: extensions.privitize.ffxUnstlRst - false FF - user.js: extensions.privitize.admin - false FF - user.js: extensions.privitize.autoRvrt - false FF - user.js: extensions.privitize.rvrt - false FF - user.js: extensions.privitize.hmpg - true FF - user.js: extensions.privitize.dfltSrch - true FF - user.js: extensions.privitize.srchPrvdr - Search The Web (privitize) FF - user.js: extensions.privitize.dnsErr - true FF - user.js: extensions.privitize.newTab - true . ============= SERVICES / DRIVERS =============== . R0 MpFilter;Microsoft Malware Protection Driver;c:windowssystem32driversMpFilter.sys [2013-6-18 211560] R1 avgtp;avgtp;c:windowssystem32driversavgtpx86.sys [2012-7-22 37664] R1 dtsoftbus01;DAEMON Tools Virtual Bus Driver;c:windowssystem32driversdtsoftbus01.sys [2011-8-5 232512] R2 Application Updater;Application Updater;c:program filesapplication updaterApplicationUpdater.exe [2013-9-2 807800] R2 Hamachi2Svc;LogMeIn Hamachi Tunneling Engine;d:downloadsmyнова папкаhamachi-2.exe [2013-10-1 1612112] R2 MyWebSearchService;My Web Search Service;c:progra~1mywebs~1bar1.binmwssvc.exe [2011-9-19 34320] R2 RzKLService;RzKLService;d:mcrazer game boosterRzKLService.exe [2013-9-19 106472] R2 Skype C2C Service;Skype C2C Service;c:programdataskypetoolbarsskype c2c servicec2c_service.exe [2013-9-16 3273088] R2 TeamViewer8;TeamViewer 8;c:program filesteamviewerversion8TeamViewer_Service.exe [2013-8-16 4308320] R2 vToolbarUpdater17.0.12;vToolbarUpdater17.0.12;c:program filescommon filesavg secure searchvtoolbarupdater17.0.12ToolbarUpdater.exe [2013-10-2 1734680] R2 WindowsServices;Windows Debug Service;c:windowssystem32driverssfuservice.exe [2011-7-8 785920] R3 RTL8167;Realtek 8167 NT Driver;c:windowssystem32driversRt86win7.sys [2009-3-2 139776] S2 clr_optimization_v4.0.30319_32;Microsoft .NET Framework NGEN v4.0.30319_X86;c:windowsmicrosoft.netframeworkv4.0.30319mscorsvw.exe [2012-7-9 104912] S2 gupdate;Услуга на Google Актуализация (gupdate);c:program filesgoogleupdateGoogleUpdate.exe [2011-8-16 136176] S2 SkypeUpdate;Skype Updater;c:program filesskypeupdaterUpdater.exe [2013-6-21 162408] S3 AdobeFlashPlayerUpdateSvc;Adobe Flash Player Update Service;c:windowssystem32macromedflashFlashPlayerUpdateService.exe [2012-3-30 257416] S3 b57nd60x;Broadcom NetXtreme Gigabit Ethernet - NDIS 6.0;c:windowssystem32driversb57nd60x.sys [2009-7-14 229888] S3 dmvsc;dmvsc;c:windowssystem32driversdmvsc.sys [2010-11-21 62464] S3 GoogleDesktopManager-051210-111108;Диспечер на Google Desktop 5.9.1005.12335;c:program filesgooglegoogle desktop searchGoogleDesktop.exe [2011-9-10 30192] S3 gupdatem;Услуга на Google Актуализация (gupdatem);c:program filesgoogleupdateGoogleUpdate.exe [2011-8-16 136176] S3 Microsoft SharePoint Workspace Audit Service;Microsoft SharePoint Workspace Audit Service;c:program filesmicrosoft officeoffice14GROOVE.EXE [2012-9-20 30785672] S3 MozillaMaintenance;Mozilla Maintenance Service;c:program filesmozilla maintenance servicemaintenanceservice.exe [2012-7-22 118680] S3 NisDrv;Microsoft Network Inspection System;c:windowssystem32driversNisDrvWFP.sys [2011-4-27 107392] S3 NisSrv;Мрежова проверка на Microsoft;c:program filesmicrosoft security clientNisSrv.exe [2013-6-20 295376] S3 osppsvc;Office Software Protection Platform;c:program filescommon filesmicrosoft sharedofficesoftwareprotectionplatformOSPPSVC.EXE [2010-1-9 4640000] S3 RdpVideoMiniport;Remote Desktop Video Miniport Driver;c:windowssystem32driversrdpvideominiport.sys [2010-11-21 15872] S3 StorSvc;Storage Service;c:windowssystem32svchost.exe -k LocalSystemNetworkRestricted [2009-7-14 20992] S3 Synth3dVsc;Synth3dVsc;c:windowssystem32driversSynth3dVsc.sys [2010-11-21 77184] S3 terminpt;Microsoft Remote Desktop Input Driver;c:windowssystem32driversterminpt.sys [2010-11-21 25600] S3 TsUsbFlt;TsUsbFlt;c:windowssystem32driversTsUsbFlt.sys [2010-11-21 52224] S3 TsUsbGD;Remote Desktop Generic USB Device;c:windowssystem32driversTsUsbGD.sys [2010-11-21 27264] S3 tsusbhub;tsusbhub;c:windowssystem32driverstsusbhub.sys [2010-11-21 112640] S3 vvftav211;vvftav211;c:windowssystem32driversvvftav211.sys [2011-8-27 480128] S3 WatAdminSvc;Услуга на технологиите за активиране на Windows;c:windowssystem32watWatAdminSvc.exe [2011-8-5 1343400] S3 ZSMC30x;USB PC Camera Service ZSMC30x;c:windowssystem32driversZS211.sys [2011-8-27 1537024] . =============== Created Last 30 ================ . 2013-10-06 18:30:38  7328304  ----a-w-  c:programdatamicrosoftmicrosoft antimalwaredefinition updates{8127aff6-5691-460e-853c-9df99258f093}mpengine.dll 2013-10-05 17:39:19  --------  d-----w-  c:usersuserappdataroaming.minecraft 2013-10-05 17:28:55  7328304  ----a-w-  c:programdatamicrosoftmicrosoft antimalwaredefinition updatesbackupmpengine.dll 2013-10-03 10:17:21  --------  d-----w-  c:usersuserappdatalocalLogMeIn 2013-10-03 10:17:21  --------  d-----w-  c:programdataLogMeIn 2013-09-30 17:52:09  --------  d-----w-  c:program filesAcclaim Entertainment 2013-09-30 16:10:23  --------  d-----w-  c:program filesSimilarSites 2013-09-30 16:10:19  --------  d-----w-  c:usersuserappdataroamingSimilarSites 2013-09-11 17:49:49  --------  d-----w-  c:programdataNexon 2013-09-11 17:33:20  --------  d-----w-  c:programdataNexonEU 2013-09-11 16:49:56  --------  d-----w-  c:usersuserappdatalocalAkamai 2013-09-09 17:09:22  --------  d--h--w-  c:program filesTemp . ==================== Find3M  ==================== . 2013-10-02 15:06:23  37664  ----a-w-  c:windowssystem32driversavgtpx86.sys 2013-09-21 18:08:08  692616  ----a-w-  c:windowssystem32FlashPlayerApp.exe 2013-09-21 18:08:07  71048  ----a-w-  c:windowssystem32FlashPlayerCPLApp.cpl 2013-08-10 03:59:10  1767936  ----a-w-  c:windowssystem32wininet.dll 2013-08-10 03:58:09  2876928  ----a-w-  c:windowssystem32jscript9.dll 2013-08-10 03:58:06  61440  ----a-w-  c:windowssystem32iesetup.dll 2013-08-10 03:58:06  109056  ----a-w-  c:windowssystem32iesysprep.dll 2013-08-10 03:07:50  2706432  ----a-w-  c:windowssystem32mshtml.tlb 2013-08-10 02:17:19  71680  ----a-w-  c:windowssystem32RegisterIEPKEYs.exe 2013-08-08 01:03:07  2348544  ----a-w-  c:windowssystem32win32k.sys 2013-08-05 01:56:47  133056  ----a-w-  c:windowssystem32driversataport.sys 2013-08-02 01:50:36  169984  ----a-w-  c:windowssystem32winsrv.dll 2013-08-02 01:49:19  293376  ----a-w-  c:windowssystem32KernelBase.dll 2013-08-02 00:52:57  271360  ----a-w-  c:windowssystem32conhost.exe 2013-08-02 00:43:05  6144  ---ha-w-  c:windowssystem32api-ms-win-security-base-l1-1-0.dll 2013-08-02 00:43:05  4608  ---ha-w-  c:windowssystem32api-ms-win-core-threadpool-l1-1-0.dll 2013-08-02 00:43:05  3584  ---ha-w-  c:windowssystem32api-ms-win-core-xstate-l1-1-0.dll 2013-08-02 00:43:05  3072  ---ha-w-  c:windowssystem32api-ms-win-core-util-l1-1-0.dll 2013-07-25 08:57:27  1620992  ----a-w-  c:windowssystem32WMVDECOD.DLL 2013-07-19 01:41:01  2048  ----a-w-  c:windowssystem32tzres.dll . ============= FINISH: 19:15:00,70 ===============  








. UNLESS SPECIFICALLY INSTRUCTED, DO NOT POST THIS LOG. IF REQUESTED, ZIP IT UP & ATTACH IT . DDS (Ver_2011-09-30.01) . Microsoft Windows 7 Enterprise Boot Device: DeviceHarddiskVolume1 Install Date: 5.8.2011 г. 12:40:24 System Uptime: 7.10.2013 г. 18:14:02 (1 hours ago) . Motherboard: FOXCONN |  | 2A8C Processor: Pentium® Dual-Core  CPU   E5800  @ 3.20GHz | CPU 1 | 3203/800mhz . ==== Disk Partitions ========================= . C: is FIXED (NTFS) - 49 GiB total, 18,056 GiB free. D: is FIXED (NTFS) - 249 GiB total, 163,313 GiB free. E: is CDROM (CDFS) F: is CDROM () G: is Removable H: is CDROM () . ==== Disabled Device Manager Items ============= . ==== System Restore Points =================== . RP452: 6.10.2013 г. 21:30:22 - Windows Update . ==== Installed Programs ====================== .  toolbar   Фотогалерия на Windows Live µTorrent Русификатор Rettungswagen Simulator 2012 4x4 Hummer Ace of Spades Adobe AIR Adobe Download Assistant Adobe Flash Player 11 ActiveX Adobe Flash Player 11 Plugin Akamai NetSession Interface Animated Wallpaper - Snowy Desktop 3D Apple Software Update Bandisoft MPEG-1 Decoder BeamNG-Techdemo-0.3 (remove only) Cabela's 4x4 Off-Road Adventure  2 Call of Juarez Camtasia Studio 8 CCleaner ClipGrab Clownfish for Skype Combat Arms EU Counter-Strike 1.6 Counter-Strike 1.6 Escom 3d!7!0n - by AmaRelle v1.0 Counter-Strike 1.6: New Era Counter-Strike Mega Edition v2.0 Counter-Strike Source, версия 1765266 Craften Terminal 3.3.4897.28268 CSS_Update_from_v1765266_to_v1765266_210513 1.00 D3DX10 DAEMON Tools Lite Dead Space™ Decal Converter Deer Hunter 2004 - Legendary Hunting Definition Update for Microsoft Office 2010 (KB982726) 32-Bit Edition DJ Studio Pro Driver Genius Professional Edition Driver Sweeper version 3.2.0 Dxtory License Cracked Dxtory version 2.0.112 Euro Truck Simulator 2 Facebook Video Calling FIFA 11 FormatFactory 3.0.1 Fraps (remove only) Free Studio version GamersFirst LIVE! German Truck Simulator Google Земя Google Chrome Google Desktop Google Update Helper Grand Theft Auto Vice City GTA San Andreas Hero_Online Iminent IMinent Toolbar Intel Drivers Update Utility Intel® Graphics Media Accelerator Driver ItaEst - Taka e! Java 7 Update 25 Java Auto Updater Java 6 Update 31 JavaFX 2.1.1 K-Lite Codec Pack 7.5.0 (Standard) League of Legends LogMeIn Hamachi Magic The Gathering Tactics MagniPic Malwarebytes Anti-Malware, версия Medal of Honor Microsoft .NET Framework 1.1 Microsoft .NET Framework 4.5 Microsoft Antimalware Service BG-BG Language Pack Microsoft Application Error Reporting Microsoft Games for Windows - LIVE Microsoft Games for Windows - LIVE Redistributable Microsoft Office 2010 Service Pack 1 (SP1) Microsoft Office Access MUI (English) 2010 Microsoft Office Access Setup Metadata MUI (English) 2010 Microsoft Office Excel MUI (English) 2010 Microsoft Office Groove MUI (English) 2010 Microsoft Office InfoPath MUI (English) 2010 Microsoft Office OneNote MUI (English) 2010 Microsoft Office Outlook MUI (English) 2010 Microsoft Office PowerPoint MUI (English) 2010 Microsoft Office Professional Plus 2010 Microsoft Office Proof (English) 2010 Microsoft Office Proof (French) 2010 Microsoft Office Proof (Spanish) 2010 Microsoft Office Proofing (English) 2010 Microsoft Office Publisher MUI (English) 2010 Microsoft Office Shared MUI (English) 2010 Microsoft Office Shared Setup Metadata MUI (English) 2010 Microsoft Office Word MUI (English) 2010 Microsoft Security Client Microsoft Security Client BG-BG Language Pack Microsoft Security Essentials Microsoft Silverlight Microsoft SQL Server 2005 Compact Edition [ENU] Microsoft Visual C++ 2005 Redistributable Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.17 Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.6161 Microsoft XNA Framework Redistributable 4.0 Minecraft Minecraft 1.6.2 Minecraft1.6.2 Mozilla Firefox 24.0 (x86 bg) Mozilla Maintenance Service MSVCRT MSVCRT Redists MSXML 4.0 SP2 (KB954430) MSXML 4.0 SP2 (KB973688) MTA:SA v1.3.1 My Web Search (MyWebFace) Need For Speed™ World Nokia Connectivity Cable Driver NVIDIA PhysX OMSI - Der Omnibussimulator OpenAL Opera 12.14 Pando Media Booster PunkBuster Services Race Driver: GRID Razer Game Booster Realtek High Definition Audio Driver Recuva Revolt Safari Security Update for CAPICOM (KB931906) Security Update for Microsoft .NET Framework 4.5 (KB2737083) Security Update for Microsoft .NET Framework 4.5 (KB2742613) Security Update for Microsoft .NET Framework 4.5 (KB2789648) Security Update for Microsoft .NET Framework 4.5 (KB2804582) Security Update for Microsoft .NET Framework 4.5 (KB2833957) Security Update for Microsoft .NET Framework 4.5 (KB2840642v2) Security Update for Microsoft Excel 2010 (KB2597126) 32-Bit Edition Security Update for Microsoft Filter Pack 2.0 (KB2553501) 32-Bit Edition Security Update for Microsoft InfoPath 2010 (KB2687417) 32-Bit Edition Security Update for Microsoft InfoPath 2010 (KB2687422) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2553091) Security Update for Microsoft Office 2010 (KB2553096) Security Update for Microsoft Office 2010 (KB2553371) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2553447) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2589320) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2598243) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2687501) 32-Bit Edition Security Update for Microsoft Office 2010 (KB2687510) 32-Bit Edition Security Update for Microsoft OneNote 2010 (KB2760600) 32-Bit Edition Security Update for Microsoft Visio 2010 (KB2760762) 32-Bit Edition Security Update for Microsoft Visio Viewer 2010 (KB2687505) 32-Bit Edition Security Update for Microsoft Word 2010 (KB2760410) 32-Bit Edition Skype Click to Call Skype™ 6.6 Speccy Steam System Requirements Lab CYRI System Requirements Lab for Intel TeamViewer 8 TOAoT-315-UTMod-v2 uGet, версия 2.0.6 Update for Microsoft .NET Framework 4.5 (KB2750147) Update for Microsoft .NET Framework 4.5 (KB2805221) Update for Microsoft .NET Framework 4.5 (KB2805226) Update for Microsoft Office 2010 (KB2494150) Update for Microsoft Office 2010 (KB2553065) Update for Microsoft Office 2010 (KB2553092) Update for Microsoft Office 2010 (KB2553181) 32-Bit Edition Update for Microsoft Office 2010 (KB2553267) 32-Bit Edition Update for Microsoft Office 2010 (KB2553310) 32-Bit Edition Update for Microsoft Office 2010 (KB2553378) 32-Bit Edition Update for Microsoft Office 2010 (KB2566458) Update for Microsoft Office 2010 (KB2596964) 32-Bit Edition Update for Microsoft Office 2010 (KB2598242) 32-Bit Edition Update for Microsoft Office 2010 (KB2687503) 32-Bit Edition Update for Microsoft Office 2010 (KB2687509) 32-Bit Edition Update for Microsoft Office 2010 (KB2760631) 32-Bit Edition Update for Microsoft Office 2010 (KB2767886) 32-Bit Edition Update for Microsoft OneNote 2010 (KB2553290) 32-Bit Edition Update for Microsoft Outlook 2010 (KB2597090) 32-Bit Edition Update for Microsoft Outlook 2010 (KB2687623) 32-Bit Edition Update for Microsoft Outlook Social Connector 2010 (KB2553406) 32-Bit Edition Update for Microsoft PowerPoint 2010 (KB2553145) 32-Bit Edition Update for Microsoft PowerPoint 2010 (KB2598240) 32-Bit Edition Update for Microsoft SharePoint Workspace 2010 (KB2589371) 32-Bit Edition Vegas Pro 10.0 Vegas Pro 11.0 VirtualDJ Home FREE Windows Live Communications Platform Windows Live Essentials Windows Live ID Sign-in Assistant Windows Live Installer Windows Live Movie Maker Windows Live Photo Common Windows Live Photo Gallery Windows Live PIMT Platform Windows Live SOXE Windows Live SOXE Definitions Windows Live UX Platform Windows Live UX Platform Language Pack WinRAR 4.01 (32-bit) WolfQuest World of Warcraft Trial YTD Toolbar v7.6 ZSMC USB PC Camera (ZS0211) . ==== Event Viewer Messages From Past Week ======== . 7.10.2013 г. 18:14:19, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 7.10.2013 г. 15:48:24, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 7.10.2013 г. 15:48:24, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 7.10.2013 г. 14:00:17, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 21:19:09, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 17:01:23, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 14:51:05, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 6.10.2013 г. 14:51:05, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 6.10.2013 г. 14:18:05, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 6.10.2013 г. 02:02:15, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 6.10.2013 г. 02:02:15, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 5.10.2013 г. 21:55:16, Error: volsnap [36]  - The shadow copies of volume C: were aborted because the shadow copy storage could not grow due to a user imposed limit. 5.10.2013 г. 21:29:31, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 5.10.2013 г. 20:07:11, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 5.10.2013 г. 20:07:11, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 5.10.2013 г. 18:58:06, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 5.10.2013 г. 14:12:14, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 5.10.2013 г. 12:45:09, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 4.10.2013 г. 22:51:38, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 4.10.2013 г. 19:20:14, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 4.10.2013 г. 19:20:14, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 4.10.2013 г. 17:06:51, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 4.10.2013 г. 17:06:51, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 4.10.2013 г. 16:37:10, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 4.10.2013 г. 16:37:09, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 4.10.2013 г. 15:27:47, Error: bowser [8003]  - The master browser has received a server announcement from the computer SKIOOOO-PC that believes that it is the master browser for the domain on transport NetBT_Tcpip_{86D84905-0331-4FB8-A5E0-AAB038C. The master browser is stopping or an election is being forced. 4.10.2013 г. 13:20:44, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 30.9.2013 г. 21:07:08, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 21:07:08, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 20:14:39, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 20:14:39, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 20:11:32, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 30.9.2013 г. 18:28:52, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 18:28:52, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 18:01:50, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 30.9.2013 г. 15:08:31, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 30.9.2013 г. 15:08:31, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 30.9.2013 г. 14:46:07, Error: bowser [8003]  - The master browser has received a server announcement from the computer SKIOOOO-PC that believes that it is the master browser for the domain on transport NetBT_Tcpip_{86D84905-0331-4FB8-A5E0-AAB038C. The master browser is stopping or an election is being forced. 30.9.2013 г. 14:43:25, Error: volsnap [36]  - The shadow copies of volume C: were aborted because the shadow copy storage could not grow due to a user imposed limit. 30.9.2013 г. 13:51:20, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 3.10.2013 г. 19:57:52, Error: bowser [8003]  - The master browser has received a server announcement from the computer SKIOOOO-PC that believes that it is the master browser for the domain on transport NetBT_Tcpip_{86D84905-0331-4FB8-A5E0-AAB038C. The master browser is stopping or an election is being forced. 3.10.2013 г. 15:14:42, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 3.10.2013 г. 15:14:42, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 3.10.2013 г. 14:56:51, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 3.10.2013 г. 14:56:51, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 3.10.2013 г. 14:18:33, Error: volsnap [36]  - The shadow copies of volume C: were aborted because the shadow copy storage could not grow due to a user imposed limit. 3.10.2013 г. 13:16:54, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 2.10.2013 г. 19:41:38, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 2.10.2013 г. 19:41:38, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 2.10.2013 г. 18:07:00, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга LogMeIn Hamachi Tunneling Engine да се свърже. 2.10.2013 г. 18:07:00, Error: Service Control Manager [7000]  - Услуга LogMeIn Hamachi Tunneling Engine не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 2.10.2013 г. 18:06:36, Error: Service Control Manager [7030]  - Услуга LogMeIn Hamachi Tunneling Engine е маркирана като интерактивна услуга. Обаче системата е конфигурирана да не допуска интерактивни услуги. Тази услуга може да не функционира правилно. 2.10.2013 г. 18:05:49, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 1.10.2013 г. 21:20:10, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 1.10.2013 г. 21:20:10, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 1.10.2013 г. 19:11:04, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 1.10.2013 г. 19:11:04, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 1.10.2013 г. 18:14:14, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. 1.10.2013 г. 16:14:45, Error: Service Control Manager [7009]  - Изтекъл период на изчакване (30000 милисекунди) при изчакване на услуга Steam Client Service да се свърже. 1.10.2013 г. 16:14:45, Error: Service Control Manager [7000]  - Услуга Steam Client Service не може да бъде стартирана поради следната грешка:  Услугата не отговори навреме на искане за стартиране или управление. 1.10.2013 г. 15:22:26, Error: Service Control Manager [7000]  - Услуга LSA Shell (Export Version) v5.2 . Microsoft Corporation. не може да бъде стартирана поради следната грешка:  Системата не може да намери указания път. . ==== End Of File ===========================  

Сподели този отговор

Линк към този отговор
Сподели в други сайтове





# AdwCleaner v3.006 - Report created 08/10/2013 at 14:17:20
# Updated 01/10/2013 by Xplode
# Operating System : Windows 7 Enterprise Service Pack 1 (32 bits)
# Username : User - HP
# Running from : C:UsersUserDownloadsadwcleaner.exe
# Option : Clean

***** [ Services ] *****

Service Deleted : Application Updater
Service Deleted : MyWebSearchService

***** [ Files / Folders ] *****

Folder Deleted : C:ProgramDataAVG Secure Search
Folder Deleted : C:ProgramDataBabylon
Folder Deleted : C:ProgramDataclsoft ltd
Folder Deleted : C:ProgramDataIminent
Folder Deleted : C:ProgramDataPremium
Folder Deleted : C:ProgramDataMaginiPPicc
Folder Deleted : C:ProgramDataMicrosoftWindowsStart MenuProgramsTheBflix
Folder Deleted : C:ProgramDataMicrosoftWindowsStart MenuProgramsMaginiPPicc
Folder Deleted : C:Program FilesApplication Updater
Folder Deleted : C:Program FilesAVG Secure Search
Folder Deleted : C:Program FilesIndustriya
Folder Deleted : C:Program FilesMagniPic
Folder Deleted : C:Program FilesMyWebSearch
Folder Deleted : C:Program FilesSimilarSites
Folder Deleted : C:Program FilesCommon FilesAVG Secure Search
Folder Deleted : C:Program FilesCommon Filesspigot
Folder Deleted : C:UsersUserAppDataLocalAVG Secure Search
Folder Deleted : C:UsersUserAppDataLocalBabylon
Folder Deleted : C:UsersUserAppDataLocalLowAVG Secure Search
Folder Deleted : C:UsersUserAppDataLocalLowFunWebProducts
Folder Deleted : C:UsersUserAppDataLocalLowIndustriya
Folder Deleted : C:UsersUserAppDataLocalLowMyWebSearch
Folder Deleted : C:UsersUserAppDataLocalLowSearch Settings
Folder Deleted : C:UsersUserAppDataLocalLowTheBflix
Folder Deleted : C:UsersUserAppDataLocalLowMaginiPPicc
Folder Deleted : C:UsersUserAppDataRoamingdvdvideosoftiehelpers
Folder Deleted : C:UsersUserAppDataRoamingIminent
Folder Deleted : C:UsersUserAppDataRoamingIndustriya
Folder Deleted : C:UsersUserAppDataRoamingSimilarSites
File Deleted : C:END
File Deleted : C:Program FilesMozilla Firefoxsearchpluginsavg-secure-search.xml
File Deleted : C:Program FilesMozilla FirefoxsearchpluginsBabylon.xml
File Deleted : C:UsersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultsearchpluginsSearchTheWeb.xml
File Deleted : C:UsersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultuser.js

***** [ Shortcuts ] *****

***** [ Registry ] *****

Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [{ACAA314B-EEBA-48E4-AD47-84E31C44796C}]
Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [Avg@toolbar]
Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [m3ffxtbr@mywebsearch.com]
Value Deleted : HKLMSOFTWAREMozillaFirefoxExtensions [webbooster@iminent.com]
Key Deleted : HKLMSOFTWAREGoogleChromeExtensionsigdhbblpcellaljokkpfhcjlagemhgjl
Key Deleted : HKLMSOFTWAREGoogleChromeExtensionsndibdjnfmopecpmkdieinmbadjfpblof
Key Deleted : HKLMSOFTWAREClassesAppIDescort.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDescortApp.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDescortEng.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDescorTlbr.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDesrv.EXE
Key Deleted : HKLMSOFTWAREClassesAppIDIminent.WebBooster.InternetExplorer.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDScriptHelper.EXE
Key Deleted : HKLMSOFTWAREClassesAppIDTbCommonUtils.DLL
Key Deleted : HKLMSOFTWAREClassesAppIDTbHelper.EXE
Key Deleted : HKLMSOFTWAREClassesAppIDViProtocol.DLL
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.BrowserWndAPI
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.BrowserWndAPI.1
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.PugiObj
Key Deleted : HKLMSOFTWAREClassesAVG Secure Search.PugiObj.1
Key Deleted : HKLMSOFTWAREClassesbhoclass.bho.bhoclass.bho
Key Deleted : HKLMSOFTWAREClassesescort.escortIEPane
Key Deleted : HKLMSOFTWAREClassesescort.escortIEPane.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.DataControl
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.DataControl.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistoryKillerScheduler
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistoryKillerScheduler.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistorySwatterControlBar
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HistorySwatterControlBar.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HTMLMenu
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HTMLMenu.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.HTMLMenu.2
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.IECookiesManager
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.IECookiesManager.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.KillerObjManager
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.KillerObjManager.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterBarButton
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterBarButton.1
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterSettingsControl
Key Deleted : HKLMSOFTWAREClassesFunWebProducts.PopSwatterSettingsControl.1
Key Deleted : HKLMSOFTWAREClassesIminent
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ChatSessionPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ChatSessionPlugin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.HTMLPanel
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.HTMLPanel.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.MultipleButton
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.MultipleButton.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.OutlookAddin
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.OutlookAddin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.PseudoTransparentPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.PseudoTransparentPlugin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ThirdPartyInstaller
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.ThirdPartyInstaller.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.UrlAlertButton
Key Deleted : HKLMSOFTWAREClassesMyWebSearch.UrlAlertButton.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.SettingsPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.SettingsPlugin.1
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.ToolbarPlugin
Key Deleted : HKLMSOFTWAREClassesMyWebSearchToolBar.ToolbarPlugin.1
Key Deleted : HKLMSOFTWAREClassesprivitize.privitizeHlpr
Key Deleted : HKLMSOFTWAREClassesprivitize.privitizeHlpr.1
Key Deleted : HKLMSOFTWAREClassesProd.cap
Key Deleted : HKLMSOFTWAREClassesprotocolshandlerviprotocol
Key Deleted : HKLMSOFTWAREClassesS
Key Deleted : HKLMSOFTWAREClassesScreenSaverControl.ScreenSaverInstaller
Key Deleted : HKLMSOFTWAREClassesScreenSaverControl.ScreenSaverInstaller.1
Key Deleted : HKLMSOFTWAREClassesScriptHelper.ScriptHelperApi
Key Deleted : HKLMSOFTWAREClassesScriptHelper.ScriptHelperApi.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbDownloadManager
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbDownloadManager.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbPropertyManager
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbPropertyManager.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbRequest
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbRequest.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbTask
Key Deleted : HKLMSOFTWAREClassesTbHelper.TbTask.1
Key Deleted : HKLMSOFTWAREClassesTbHelper.ToolbarHelper
Key Deleted : HKLMSOFTWAREClassesTbHelper.ToolbarHelper.1
Key Deleted : HKLMSOFTWAREClassesToolbar3.ContextMenuNotifier
Key Deleted : HKLMSOFTWAREClassesToolbar3.ContextMenuNotifier.1
Key Deleted : HKLMSOFTWAREClassesToolbar3.CustomInternetSecurityImpl
Key Deleted : HKLMSOFTWAREClassesToolbar3.CustomInternetSecurityImpl.1
Key Deleted : HKLMSOFTWAREClassesViProtocol.ViProtocolOLE
Key Deleted : HKLMSOFTWAREClassesViProtocol.ViProtocolOLE.1
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsRunDll32Policyf3ScrCtr.dll
Key Deleted : HKLMSOFTWAREMicrosoftMultimediaWMPlayerSchemesf3pss
Key Deleted : HKLMSOFTWAREMicrosoftOfficeOutlookAddinsMyWebSearch.OutlookAddin
Key Deleted : HKLMSOFTWAREMicrosoftOfficeWordAddinsMyWebSearch.OutlookAddin
Key Deleted : HKLMSOFTWAREMicrosoftShared ToolsMSConfigstartupregIminent
Key Deleted : HKLMSOFTWAREMicrosoftShared ToolsMSConfigstartupregIminentMessenger
Key Deleted : HKLMSOFTWAREMicrosoftTracingAskPIP_FF__RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingAskPIP_FF__RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingIminent_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingIminent_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingsoftonic_ggl_1_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingsoftonic_ggl_1_RASMANCS
Value Deleted : HKLMSOFTWAREMicrosoftWindows MediaWmsdkSources [F3PopularScreenSavers]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionInternet Settings5.0User AgentPost Platform [FunWebProducts]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionInternet SettingsUser Agentpost platform [FunWebProducts]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionRun [searchSettings]
Value Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionRun [vProt]
Key Deleted : HKLMSOFTWAREMozillaPlugins@avg.com/AVG SiteSafety plugin,version=,application/x-avg-sitesafety-plugin
Key Deleted : HKLMSOFTWAREMozillaPlugins@mywebsearch.com/Plugin
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstallSP_d8283021
Key Deleted : HKLMSOFTWAREClassesTBSB01620.IEToolbar
Key Deleted : HKLMSOFTWAREClassesTBSB01620.IEToolbar.1
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_brawl-busters_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_brawl-busters_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_c-medieval_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_c-medieval_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_camstudio_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_camstudio_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_everest_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_everest_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_flashget_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_flashget_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_format-factory_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_format-factory_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gravity-defied---trial-racing_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gravity-defied---trial-racing_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas(1)_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas(1)_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_gta-san-andreas_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hamachi_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hamachi_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_happy-wheels_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_happy-wheels_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hero-online_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_hero-online_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_league-of-legends_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_league-of-legends_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_microsoft-flight-simulator_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_microsoft-flight-simulator_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_san-andreas-multiplayer_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_san-andreas-multiplayer_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_second-life_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_second-life_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_sony-vegas-video_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_sony-vegas-video_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_tactical-ops-assault-on-terror_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_tactical-ops-assault-on-terror_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_talking-tom-cat_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_talking-tom-cat_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_virtual-families_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_virtual-families_RASMANCS
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_world-of-warcraft_RASAPI32
Key Deleted : HKLMSOFTWAREMicrosoftTracingSoftonicDownloader_for_world-of-warcraft_RASMANCS
Key Deleted : HKLMSOFTWAREClassesAppID{01994268-3C10-4044-A1EA-7A9C1B739A11}
Key Deleted : HKLMSOFTWAREClassesAppID{09C554C3-109B-483C-A06B-F14172F1A947}
Key Deleted : HKLMSOFTWAREClassesAppID{1FDFF5A2-7BB1-48E1-8081-7236812B12B2}
Key Deleted : HKLMSOFTWAREClassesAppID{4CE516A7-F7AC-4628-B411-8F886DC5733E}
Key Deleted : HKLMSOFTWAREClassesAppID{4E1E9D45-8BF9-4139-915C-9F83CC3D5921}
Key Deleted : HKLMSOFTWAREClassesAppID{628F3201-34D0-49C0-BB9A-82A26AEFB291}
Key Deleted : HKLMSOFTWAREClassesAppID{B12E99ED-69BD-437C-86BE-C862B9E5444D}
Key Deleted : HKLMSOFTWAREClassesAppID{BB711CB0-C70B-482E-9852-EC05EBD71DBB}
Key Deleted : HKLMSOFTWAREClassesAppID{D7EE8177-D51E-4F89-92B6-83EA2EC40800}
Key Deleted : HKLMSOFTWAREClassesCLSID{02054E11-5113-4BE3-8153-AA8DFB5D3761}
Key Deleted : HKLMSOFTWAREClassesCLSID{02C9C7B0-C7C8-4AAC-A9E4-55295BF60F8F}
Key Deleted : HKLMSOFTWAREClassesCLSID{0398B101-6DA7-473F-A290-17D2FBC88CC0}
Key Deleted : HKLMSOFTWAREClassesCLSID{08858AF6-42AD-4914-95D2-AC3AB0DC8E28}
Key Deleted : HKLMSOFTWAREClassesCLSID{0CC36196-8589-4B80-A771-D659411D7F90}
Key Deleted : HKLMSOFTWAREClassesCLSID{0F8ECF4F-3646-4C3A-8881-8E138FFCAF70}
Key Deleted : HKLMSOFTWAREClassesCLSID{143D96F9-EB64-48B3-B192-91C2C41A1F43}
Key Deleted : HKLMSOFTWAREClassesCLSID{147A976F-EEE1-4377-8EA7-4716E4CDD239}
Key Deleted : HKLMSOFTWAREClassesCLSID{14F7D91F-F669-45C9-9F42-BACBFDB86EAD}
Key Deleted : HKLMSOFTWAREClassesCLSID{187A6488-6E71-4A2A-B118-7BEFBFE58257}
Key Deleted : HKLMSOFTWAREClassesCLSID{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKLMSOFTWAREClassesCLSID{25560540-9571-4D7B-9389-0F166788785A}
Key Deleted : HKLMSOFTWAREClassesCLSID{2D065204-A024-4C39-8A38-EE7078EC7ACF}
Key Deleted : HKLMSOFTWAREClassesCLSID{30F5476C-677B-4DB0-B397-51F5BFD86840}
Key Deleted : HKLMSOFTWAREClassesCLSID{3223F2FB-D9B9-45FC-9D66-CD717FFA4EE5}
Key Deleted : HKLMSOFTWAREClassesCLSID{351798B1-C1D2-45AB-92B4-4D6C2D6AB5AF}
Key Deleted : HKLMSOFTWAREClassesCLSID{35B8892D-C3FB-4D88-990D-31DB2EBD72BD}
Key Deleted : HKLMSOFTWAREClassesCLSID{3AEA1BEF-6195-46F4-ACA2-0ED14F7EFA1B}
Key Deleted : HKLMSOFTWAREClassesCLSID{3D7F9AC3-BAC3-4E51-81D7-D121D79E550A}
Key Deleted : HKLMSOFTWAREClassesCLSID{3DC201FB-E9C9-499C-A11F-23C360D7C3F8}
Key Deleted : HKLMSOFTWAREClassesCLSID{3E720452-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesCLSID{4498C5E9-93C6-4142-B6BE-F0C6DC48B77A}
Key Deleted : HKLMSOFTWAREClassesCLSID{479BF2D6-E362-4A99-B1AB-BC764D7B97AE}
Key Deleted : HKLMSOFTWAREClassesCLSID{492A108F-51D0-4BD8-899D-AD4AB2893064}
Key Deleted : HKLMSOFTWAREClassesCLSID{4B6D6E60-FBD2-4E79-BF4B-886BC98F1797}
Key Deleted : HKLMSOFTWAREClassesCLSID{4E92DB5F-AAD9-49D3-8EAB-B40CBE5B1FF7}
Key Deleted : HKLMSOFTWAREClassesCLSID{60893E02-2E5B-43F9-A93A-BAD60C2DF6EF}
Key Deleted : HKLMSOFTWAREClassesCLSID{63D0ED2C-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREClassesCLSID{67FA02C4-AB30-4E77-A640-78EE8EC8673B}
Key Deleted : HKLMSOFTWAREClassesCLSID{6D39931F-451E-4BDD-BAF4-37FB96DBBA5D}
Key Deleted : HKLMSOFTWAREClassesCLSID{7473D292-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{7473D294-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{7473D296-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{76C684D2-C35D-4284-976A-D862F53ADB81}
Key Deleted : HKLMSOFTWAREClassesCLSID{796D822A-C3F9-4A97-BAAB-42FE7628EA63}
Key Deleted : HKLMSOFTWAREClassesCLSID{799391D3-EB86-4BAC-9BD3-CBFEA58A0E15}
Key Deleted : HKLMSOFTWAREClassesCLSID{79EF3691-EC1A-4705-A01A-D2E36EC11758}
Key Deleted : HKLMSOFTWAREClassesCLSID{819FFE22-35C7-4925-8CDA-4E0E2DB94302}
Key Deleted : HKLMSOFTWAREClassesCLSID{82F41418-8E64-47EB-A7F1-4702A974D289}
Key Deleted : HKLMSOFTWAREClassesCLSID{84DA4FDF-A1CF-4195-8688-3E961F505983}
Key Deleted : HKLMSOFTWAREClassesCLSID{85D920CE-63A7-46DC-8992-41D1D2E07FAD}
Key Deleted : HKLMSOFTWAREClassesCLSID{895ED5E8-ABB4-40C3-A0CA-2571964268E2}
Key Deleted : HKLMSOFTWAREClassesCLSID{898EA8C8-E7FF-479B-8935-AEC46303B9E5}
Key Deleted : HKLMSOFTWAREClassesCLSID{8AAC123A-1959-4A45-BFC5-E2D50783098A}
Key Deleted : HKLMSOFTWAREClassesCLSID{8E6F1832-9607-4440-8530-13BE7C4B1D14}
Key Deleted : HKLMSOFTWAREClassesCLSID{933B95E2-E7B7-4AD9-B952-7AC336682AE3}
Key Deleted : HKLMSOFTWAREClassesCLSID{938AA51A-996C-4884-98CE-80DD16A5C9DA}
Key Deleted : HKLMSOFTWAREClassesCLSID{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKLMSOFTWAREClassesCLSID{98D9753D-D73B-42D5-8C85-4469CDA897AB}
Key Deleted : HKLMSOFTWAREClassesCLSID{9AFB8248-617F-460D-9366-D71CDEDA3179}
Key Deleted : HKLMSOFTWAREClassesCLSID{9FF05104-B030-46FC-94B8-81276E4E27DF}
Key Deleted : HKLMSOFTWAREClassesCLSID{A07956CD-81F8-4A03-B524-5D87E690DC83}
Key Deleted : HKLMSOFTWAREClassesCLSID{A4730EBE-43A6-443E-9776-36915D323AD3}
Key Deleted : HKLMSOFTWAREClassesCLSID{A9571378-68A1-443D-B082-284F960C6D17}
Key Deleted : HKLMSOFTWAREClassesCLSID{ADB01E81-3C79-4272-A0F1-7B2BE7A782DC}
Key Deleted : HKLMSOFTWAREClassesCLSID{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKLMSOFTWAREClassesCLSID{B25AEDC4-8086-41E3-8349-328223FA9FCB}
Key Deleted : HKLMSOFTWAREClassesCLSID{B5E3B26B-6E5C-4865-A63D-58D04B10E245}
Key Deleted : HKLMSOFTWAREClassesCLSID{B658800C-F66E-4EF3-AB85-6C0C227862A9}
Key Deleted : HKLMSOFTWAREClassesCLSID{B813095C-81C0-4E40-AA14-67520372B987}
Key Deleted : HKLMSOFTWAREClassesCLSID{B84D2DC5-42B2-4E5E-BF61-7B48152FF8EF}
Key Deleted : HKLMSOFTWAREClassesCLSID{B89D5309-0367-4494-A92F-3D4C94F88307}
Key Deleted : HKLMSOFTWAREClassesCLSID{C014EBF8-8854-448B-B5A4-557C4090EDCE}
Key Deleted : HKLMSOFTWAREClassesCLSID{C31191DB-2F64-464C-B97C-6AC81ACB7AAC}
Key Deleted : HKLMSOFTWAREClassesCLSID{C342C7A7-F622-4EF3-8B7F-ABB9FBE73F14}
Key Deleted : HKLMSOFTWAREClassesCLSID{C4765B07-BC2F-477B-925C-B2BF24887823}
Key Deleted : HKLMSOFTWAREClassesCLSID{C875C0A1-09E3-48D5-9F8E-BD337796FD14}
Key Deleted : HKLMSOFTWAREClassesCLSID{C9D7BE3E-141A-4C85-8CD6-32461F3DF2C7}
Key Deleted : HKLMSOFTWAREClassesCLSID{CD126DA6-FF5B-4181-AC13-54A62240D2FA}
Key Deleted : HKLMSOFTWAREClassesCLSID{CFF4CE82-3AA2-451F-9B77-7165605FB835}
Key Deleted : HKLMSOFTWAREClassesCLSID{D858DAFC-9573-4811-B323-7011A3AA7E61}
Key Deleted : HKLMSOFTWAREClassesCLSID{D9FFFB27-D62A-4D64-8CEC-1FF006528805}
Key Deleted : HKLMSOFTWAREClassesCLSID{DD438708-AAB4-422D-A322-B619589F5680}
Key Deleted : HKLMSOFTWAREClassesCLSID{DE9028D0-5FFA-4E69-94E3-89EE8741F468}
Key Deleted : HKLMSOFTWAREClassesCLSID{E79DFBCA-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesCLSID{E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39}
Key Deleted : HKLMSOFTWAREClassesCLSID{E812AE43-7799-4E67-8CF8-4104297A2D16}
Key Deleted : HKLMSOFTWAREClassesCLSID{F0BAAEC7-9AE0-49FF-9C4B-86E774FF397F}
Key Deleted : HKLMSOFTWAREClassesCLSID{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKLMSOFTWAREClassesCLSID{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKLMSOFTWAREClassesCLSID{F92193FD-2243-4401-9ACC-49FF30885898}
Key Deleted : HKLMSOFTWAREClassesCLSID{FD21B8A2-910B-45AC-9C10-45E6A8B84984}
Key Deleted : HKLMSOFTWAREClassesInterface{01947140-417F-46B6-8751-A3A2B8345E1A}
Key Deleted : HKLMSOFTWAREClassesInterface{021B4049-F57D-4565-A693-FD3B04786BFA}
Key Deleted : HKLMSOFTWAREClassesInterface{0362AA09-808D-48E9-B360-FB51A8CBCE09}
Key Deleted : HKLMSOFTWAREClassesInterface{03E2A1F3-4402-4121-8B35-733216D61217}
Key Deleted : HKLMSOFTWAREClassesInterface{06844020-CD0B-3D3D-A7FE-371153013E49}
Key Deleted : HKLMSOFTWAREClassesInterface{07B18EAC-A523-4961-B6BB-170DE4475CCA}
Key Deleted : HKLMSOFTWAREClassesInterface{0ADC01BB-303B-3F8E-93DA-12C140E85460}
Key Deleted : HKLMSOFTWAREClassesInterface{1093995A-BA37-41D2-836E-091067C4AD17}
Key Deleted : HKLMSOFTWAREClassesInterface{10D3722F-23E6-3901-B6C1-FF6567121920}
Key Deleted : HKLMSOFTWAREClassesInterface{120927BF-1700-43BC-810F-FAB92549B390}
Key Deleted : HKLMSOFTWAREClassesInterface{1675E62B-F911-3B7B-A046-EB57261212F3}
Key Deleted : HKLMSOFTWAREClassesInterface{17DE5E5E-BFE3-4E83-8E1F-8755795359EC}
Key Deleted : HKLMSOFTWAREClassesInterface{192929F2-9273-3894-91B0-F54671C4C861}
Key Deleted : HKLMSOFTWAREClassesInterface{1F52A5FA-A705-4415-B975-88503B291728}
Key Deleted : HKLMSOFTWAREClassesInterface{247A115F-06C2-4FB3-967D-2D62D3CF4F0A}
Key Deleted : HKLMSOFTWAREClassesInterface{2932897E-3036-43D9-8A64-B06447992065}
Key Deleted : HKLMSOFTWAREClassesInterface{2DE92D29-A042-3C37-BFF8-07C7D8893EFA}
Key Deleted : HKLMSOFTWAREClassesInterface{2E3537FC-CF2F-4F56-AF54-5A6A3DD375CC}
Key Deleted : HKLMSOFTWAREClassesInterface{2E9937FC-CF2F-4F56-AF54-5A6A3DD375CC}
Key Deleted : HKLMSOFTWAREClassesInterface{31E3BC75-2A09-4CFF-9C92-8D0ED8D1DC0F}
Key Deleted : HKLMSOFTWAREClassesInterface{32B80AD6-1214-45F4-994E-78A5D482C000}
Key Deleted : HKLMSOFTWAREClassesInterface{3A8E103F-B2B7-3BEF-B3B0-88E29B2420E4}
Key Deleted : HKLMSOFTWAREClassesInterface{3E1656ED-F60E-4597-B6AA-B6A58E171495}
Key Deleted : HKLMSOFTWAREClassesInterface{3E53E2CB-86DB-4A4A-8BD9-FFEB7A64DF82}
Key Deleted : HKLMSOFTWAREClassesInterface{3E720451-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesInterface{3E720453-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesInterface{3F607E46-0D3C-4442-B1DE-DE7FA4768F5C}
Key Deleted : HKLMSOFTWAREClassesInterface{478CE5D3-D38E-3FFE-8DBE-8C4A0F1C4D8D}
Key Deleted : HKLMSOFTWAREClassesInterface{48B7DA4E-69ED-39E3-BAD5-3E3EFF22CFB0}
Key Deleted : HKLMSOFTWAREClassesInterface{4E92DB5F-AAD9-49D3-8EAB-B40CBE5B1FF7}
Key Deleted : HKLMSOFTWAREClassesInterface{5982F405-44E4-3BBB-BAC4-CF8141CBBC5C}
Key Deleted : HKLMSOFTWAREClassesInterface{5D8C3CC3-3C05-38A1-B244-924A23115FE9}
Key Deleted : HKLMSOFTWAREClassesInterface{63D0ED2B-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREClassesInterface{63D0ED2D-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREClassesInterface{641593AF-D9FD-30F7-B783-36E16F7A2E08}
Key Deleted : HKLMSOFTWAREClassesInterface{6E74766C-4D93-4CC0-96D1-47B8E07FF9CA}
Key Deleted : HKLMSOFTWAREClassesInterface{711FC48A-1356-3932-94D8-A8B733DBC7E4}
Key Deleted : HKLMSOFTWAREClassesInterface{72227B7F-1F02-3560-95F5-592E68BACC0C}
Key Deleted : HKLMSOFTWAREClassesInterface{72EE7F04-15BD-4845-A005-D6711144D86A}
Key Deleted : HKLMSOFTWAREClassesInterface{741DE825-A6F0-4497-9AA6-8023CF9B0FFF}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D291-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D293-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D295-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{7473D297-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesInterface{79FB5FC8-44B9-4AF5-BADD-CCE547F953E5}
Key Deleted : HKLMSOFTWAREClassesInterface{7B5E8CE3-4722-4C0E-A236-A6FF731BEF37}
Key Deleted : HKLMSOFTWAREClassesInterface{819FFE21-35C7-4925-8CDA-4E0E2DB94302}
Key Deleted : HKLMSOFTWAREClassesInterface{890D4F59-5ED0-3CB4-8E0E-74A5A86E7ED0}
Key Deleted : HKLMSOFTWAREClassesInterface{8C68913C-AC3C-4494-8B9C-984D87C85003}
Key Deleted : HKLMSOFTWAREClassesInterface{8D019513-083F-4AA5-933F-7D43A6DA82C4}
Key Deleted : HKLMSOFTWAREClassesInterface{90449521-D834-4703-BB4E-D3AA44042FF8}
Key Deleted : HKLMSOFTWAREClassesInterface{923F6FB8-A390-370E-A0D2-DD505432481D}
Key Deleted : HKLMSOFTWAREClassesInterface{991AAC62-B100-47CE-8B75-253965244F69}
Key Deleted : HKLMSOFTWAREClassesInterface{9BBB26EF-B178-35D6-9D3D-B485F4279FE5}
Key Deleted : HKLMSOFTWAREClassesInterface{9E3B11F6-4179-4603-A71B-A55F4BCB0BEC}
Key Deleted : HKLMSOFTWAREClassesInterface{A626CDBD-3D13-4F78-B819-440A28D7E8FC}
Key Deleted : HKLMSOFTWAREClassesInterface{A62DDBE0-8D2A-339A-B089-8CBCC5CD322A}
Key Deleted : HKLMSOFTWAREClassesInterface{A82AD04D-0B8E-3A49-947B-6A69A8A9C96D}
Key Deleted : HKLMSOFTWAREClassesInterface{ADEB3CC9-A05D-4FCC-BD09-9025456AA3EA}
Key Deleted : HKLMSOFTWAREClassesInterface{B06D4521-D09C-3F41-8E39-9D784CCA2A75}
Key Deleted : HKLMSOFTWAREClassesInterface{BBABDC90-F3D5-4801-863A-EE6AE529862D}
Key Deleted : HKLMSOFTWAREClassesInterface{BF921DD3-732A-4A11-933B-A5EA49F2FD2C}
Key Deleted : HKLMSOFTWAREClassesInterface{C06DAD42-6F39-4CE1-83CC-9A8B9105E556}
Key Deleted : HKLMSOFTWAREClassesInterface{C2E799D0-43A5-3477-8A98-FC5F3677F35C}
Key Deleted : HKLMSOFTWAREClassesInterface{C401D2CE-DC27-45C7-BC0C-8E6EA7F085D6}
Key Deleted : HKLMSOFTWAREClassesInterface{CF54BE1C-9359-4395-8533-1657CF209CFE}
Key Deleted : HKLMSOFTWAREClassesInterface{D16107CD-2AD5-46A8-BA59-303B7C32C500}
Key Deleted : HKLMSOFTWAREClassesInterface{D25B101F-8188-3B43-9D85-201F372BC205}
Key Deleted : HKLMSOFTWAREClassesInterface{D2BA7595-5E44-3F1E-880F-03B3139FA5ED}
Key Deleted : HKLMSOFTWAREClassesInterface{D35F5C81-17D9-3E1C-A1FC-4472542E1D25}
Key Deleted : HKLMSOFTWAREClassesInterface{D6FF3684-AD3B-48EB-BBB4-B9E6C5A355C1}
Key Deleted : HKLMSOFTWAREClassesInterface{D83B296A-2FA6-425B-8AE8-A1F33D99FBD6}
Key Deleted : HKLMSOFTWAREClassesInterface{D8FA96CA-B250-312C-AF34-4FF1DD72589D}
Key Deleted : HKLMSOFTWAREClassesInterface{DAFC1E63-3359-416D-9BC2-E7DCA6F7B0F3}
Key Deleted : HKLMSOFTWAREClassesInterface{DC5E5C44-80FD-3697-9E65-9F286D92F3E7}
Key Deleted : HKLMSOFTWAREClassesInterface{DE38C398-B328-4F4C-A3AD-1B5E4ED93477}
Key Deleted : HKLMSOFTWAREClassesInterface{E1B4C9DE-D741-385F-981E-6745FACE6F01}
Key Deleted : HKLMSOFTWAREClassesInterface{E342AF55-B78A-4CD0-A2BB-DA7F52D9D25E}
Key Deleted : HKLMSOFTWAREClassesInterface{E342AF55-B78A-4CD0-A2BB-DA7F52D9D25F}
Key Deleted : HKLMSOFTWAREClassesInterface{E79DFBC9-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesInterface{E79DFBCB-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesInterface{E7B623F5-9715-3F9F-A671-D1485A39F8A2}
Key Deleted : HKLMSOFTWAREClassesInterface{EB9E5C1C-B1F9-4C2B-BE8A-27D6446FDAF8}
Key Deleted : HKLMSOFTWAREClassesInterface{ED916A7B-7C68-3198-B87D-2DABC30A5587}
Key Deleted : HKLMSOFTWAREClassesInterface{EFA1BDB2-BB3D-3D9A-8EB5-D0D22E0F64F4}
Key Deleted : HKLMSOFTWAREClassesInterface{F4CBF4DD-F8FE-35BA-BB7E-68304DAAB70B}
Key Deleted : HKLMSOFTWAREClassesInterface{FC32005D-E27C-32E0-ADFA-152F598B75E7}
Key Deleted : HKLMSOFTWAREClassesInterface{FE0273D1-99DF-4AC0-87D5-1371C6271785}
Key Deleted : HKLMSOFTWAREClassesTypeLib{0D26BC71-A633-4E71-AD31-EADC3A1B6A3A}
Key Deleted : HKLMSOFTWAREClassesTypeLib{13ABD093-D46F-40DF-A608-47E162EC799D}
Key Deleted : HKLMSOFTWAREClassesTypeLib{29D67D3C-509A-4544-903F-C8C1B8236554}
Key Deleted : HKLMSOFTWAREClassesTypeLib{2BF2028E-3F3C-4C05-AB45-B2F1DCFE0759}
Key Deleted : HKLMSOFTWAREClassesTypeLib{3E720450-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREClassesTypeLib{4E1E9D45-8BF9-4139-915C-9F83CC3D5921}
Key Deleted : HKLMSOFTWAREClassesTypeLib{7473D290-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREClassesTypeLib{74FB6AFD-DD77-4CEB-83BD-AB2B63E63C93}
Key Deleted : HKLMSOFTWAREClassesTypeLib{819FFE20-35C7-4925-8CDA-4E0E2DB94302}
Key Deleted : HKLMSOFTWAREClassesTypeLib{8CA01F0E-987C-49C3-B852-2F1AC4A7094C}
Key Deleted : HKLMSOFTWAREClassesTypeLib{8E6F1830-9607-4440-8530-13BE7C4B1D14}
Key Deleted : HKLMSOFTWAREClassesTypeLib{8FFDF636-0D87-4B33-B9E9-79A53F6E1DAE}
Key Deleted : HKLMSOFTWAREClassesTypeLib{93E3D79C-0786-48FF-9329-93BC9F6DC2B3}
Key Deleted : HKLMSOFTWAREClassesTypeLib{9C049BA6-EA47-4AC3-AED6-A66D8DC9E1D8}
Key Deleted : HKLMSOFTWAREClassesTypeLib{C2AC8A0E-E48E-484B-A71C-C7A937FAAB94}
Key Deleted : HKLMSOFTWAREClassesTypeLib{C8CECDE3-1AE1-4C4A-AD82-6D5B00212144}
Key Deleted : HKLMSOFTWAREClassesTypeLib{D518921A-4A03-425E-9873-B9A71756821E}
Key Deleted : HKLMSOFTWAREClassesTypeLib{D7EE8177-D51E-4F89-92B6-83EA2EC40800}
Key Deleted : HKLMSOFTWAREClassesTypeLib{DB538320-D3C5-433C-BCA9-C4081A054FCF}
Key Deleted : HKLMSOFTWAREClassesTypeLib{E2343056-CC08-46AC-B898-BFC7ACF4E755}
Key Deleted : HKLMSOFTWAREClassesTypeLib{E47CAEE0-DEEA-464A-9326-3F2801535A4D}
Key Deleted : HKLMSOFTWAREClassesTypeLib{E79DFBC0-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREClassesTypeLib{F42228FB-E84E-479E-B922-FBBD096E792C}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExplorerBrowser Helper Objects{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{07B18EAB-A523-4961-B6BB-170DE4475CCA}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{116BA71C-8187-4F15-9A1F-C9D6289155D1}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{2974C985-8151-4DE5-B23C-B875F0A8522F}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtStats{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{1ACB5ABE-4890-4747-952C-F13BDB93FB75}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{95B7759C-8C7F-4BF1-B163-73684A933233}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{AE805869-2E5C-4ED4-8F7B-F1F7851A4497}
Key Deleted : HKCUSoftwareMicrosoftWindowsCurrentVersionExtSettings{F3FEE66E-E034-436A-86E4-9690573BEE8A}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{07B18EAB-A523-4961-B6BB-170DE4475CCA}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{08858AF6-42AD-4914-95D2-AC3AB0DC8E28}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{25560540-9571-4D7B-9389-0F166788785A}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{3DC201FB-E9C9-499C-A11F-23C360D7C3F8}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{3E720452-B472-4954-B7AA-33069EB53906}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{63D0ED2C-B45B-4458-8B3B-60C69BBBD83C}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{7473D294-B7BB-4F24-AE82-7E2CE94BB6A9}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{98D9753D-D73B-42D5-8C85-4469CDA897AB}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{9FF05104-B030-46FC-94B8-81276E4E27DF}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{C6FDD0C3-266A-4DC3-B459-28C697C44CDC}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{E79DFBCA-5697-4FBD-94E5-5B2A9C7C1612}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionExtPreApproved{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerExtensions{898EA8C8-E7FF-479B-8935-AEC46303B9E5}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{59C7FC09-1C83-4648-B3E6-003D2BBC7481}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{628F3201-34D0-49C0-BB9A-82A26AEFB291}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{68AF847F-6E91-45DD-9B68-D6A12C30E5D7}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{9170B96C-28D4-4626-8358-27E6CAEEF907}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{D1A71FA0-FF48-48DD-9B6D-7A13A3E42127}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{DDB1968E-EAD6-40FD-8DAE-FF14757F60C7}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{F138D901-86F0-4383-99B6-9CDD406036DA}
Key Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerLow RightsElevationPolicy{F25AF245-4A81-40DC-92F9-E9021F207706}
Key Deleted : HKCUSoftwareMicrosoftInternet ExplorerSearchScopes{0ECDF796-C2DC-4D79-A620-CCE0C0A66CC9}
Key Deleted : HKCUSoftwareMicrosoftInternet ExplorerSearchScopes{70D46D94-BF1E-45ED-B567-48701376298E}
Key Deleted : HKCUSoftwareMicrosoftInternet ExplorerSearchScopes{95B7759C-8C7F-4BF1-B163-73684A933233}
Value Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerToolbar [{07B18EA9-A523-4961-B6BB-170DE4475CCA}]
Value Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerToolbar [{95B7759C-8C7F-4BF1-B163-73684A933233}]
Value Deleted : HKLMSOFTWAREMicrosoftInternet ExplorerToolbar [{F3FEE66E-E034-436A-86E4-9690573BEE8A}]
Value Deleted : HKCUSoftwareMicrosoftInternet ExplorerToolbarWebBrowser [{E7DF6BFF-55A5-4EB7-A673-4ED3E9456D39}]
Value Deleted : HKCUSoftwareMicrosoftInternet ExplorerURLSearchHooks [{00A6FAF6-072E-44CF-8957-5838F569A31D}]
Value Deleted : HKCUSoftwareMicrosoftInternet ExplorerURLSearchHooks [{F3FEE66E-E034-436A-86E4-9690573BEE8A}]
Key Deleted : HKCUSoftwareAPN PIP
Key Deleted : HKCUSoftwareAVG Secure Search
Key Deleted : HKCUSoftwareIGearSettings
Key Deleted : HKCUSoftwareMyWebSearch
Key Deleted : HKCUSoftwarePIP
Key Deleted : HKCUSoftwarePrivitizeVPNInstallDates
Key Deleted : HKCUSoftwareSearch Settings
Key Deleted : HKCUSoftwareSoftonic
Key Deleted : HKCUSoftwareStartSearch
Key Deleted : HKCUSoftwareAppDataLowSoftwareFun Web Products
Key Deleted : HKCUSoftwareAppDataLowSoftwareFunWebProducts
Key Deleted : HKCUSoftwareAppDataLowSoftwareMyWebSearch
Key Deleted : HKCUSoftwareAppDataLowSoftwareSearch Settings
Key Deleted : HKLMSoftwareApplication Updater
Key Deleted : HKLMSoftwareAVG Secure Search
Key Deleted : HKLMSoftwareAVG Security Toolbar
Key Deleted : HKLMSoftwareBabylon
Key Deleted : HKLMSoftwareFocusInteractive
Key Deleted : HKLMSoftwareFun Web Products
Key Deleted : HKLMSoftwareIminent
Key Deleted : HKLMSoftwareMyWebSearch
Key Deleted : HKLMSoftwarePIP
Key Deleted : HKLMSoftwareSearch Settings
Key Deleted : HKLMSoftwareSP Global
Key Deleted : HKLMSoftwareSProtector
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstall{A76AA284-E52D-47E6-9E4F-B85DBF8E35C3}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstall{A92DAB39-4E2C-4304-9AB6-BC44E68B55E2}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstall{F7CF0E9A-D48B-4942-9537-259ED0568DF4}
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstallmywebsearch bar uninstall
Key Deleted : HKLMSOFTWAREMicrosoftWindowsCurrentVersionUninstallSearchTheWebARP
Data Deleted : HKLMSOFTWAREMicrosoftWindows NTCurrentVersionWindows [AppInit_DLLs] - c:progra~1magnipicsprote~1.dll
Product Deleted : IMinent Toolbar

***** [ Browsers ] *****

- Internet Explorer v10.0.9200.16686

Setting Restored : HKCUSoftwareMicrosoftInternet ExplorerMain [start Page]

- Mozilla Firefox v24.0 (bg)

[ File : C:UsersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultprefs.js ]

Line Deleted : user_pref("aol_toolbar.default.homepage.check", false);
Line Deleted : user_pref("aol_toolbar.default.search.check", false);
Line Deleted : user_pref("browser.babylon.HPOnNewTab", "search.babylon.com");
Line Deleted : user_pref("browser.search.defaultenginename", "Search The Web (privitize)");
Line Deleted : user_pref("browser.search.order.1", "Search The Web (privitize)");
Line Deleted : user_pref("browser.search.selectedEngine", "Search The Web (privitize)");
Line Deleted : user_pref("dom.ipc.plugins.enabled.npmywebs.dll", false);
Line Deleted : user_pref("extensions.5159a25736caa.scode", "(function(){try{if('aol.com,mail.google.com,premiumreports.info,search.babylon.com,search.gboxapp.com'.indexOf(window.self.location.hostname)>-1) return;}c[...]
Line Deleted : user_pref("extensions.BabylonToolbar.prtkDS", 0);
Line Deleted : user_pref("extensions.BabylonToolbar.prtkHmpg", 0);
Line Deleted : user_pref("extensions.BabylonToolbar_i.newTab", true);

Line Deleted : user_pref("extensions.privitize.srchPrvdr", "Search The Web (privitize)");
Line Deleted : user_pref("extensions.softonic.admin", false);
Line Deleted : user_pref("extensions.softonic.aflt", "orgnl");
Line Deleted : user_pref("extensions.softonic.dfltLng", "");
Line Deleted : user_pref("extensions.softonic.dfltSrch", false);
Line Deleted : user_pref("extensions.softonic.excTlbr", false);
Line Deleted : user_pref("extensions.softonic.hmpg", false);
Line Deleted : user_pref("extensions.softonic.id", "d65288460000000000002c27d72d77db");
Line Deleted : user_pref("extensions.softonic.instlDay", "15401");
Line Deleted : user_pref("extensions.softonic.instlRef", "MON00001");
Line Deleted : user_pref("extensions.softonic.lastVrsnTs", "");
Line Deleted : user_pref("extensions.softonic.newTab", false);
Line Deleted : user_pref("extensions.softonic.noFFXTlbr", false);
Line Deleted : user_pref("extensions.softonic.prdct", "softonic");
Line Deleted : user_pref("extensions.softonic.prtnrId", "softonic");
Line Deleted : user_pref("extensions.softonic.smplGrp", "eng7");
Line Deleted : user_pref("extensions.softonic.tlbrId", "eng7");

Line Deleted : user_pref("extensions.softonic.vrsn", "");
Line Deleted : user_pref("extensions.softonic.vrsnTs", "");
Line Deleted : user_pref("extensions.softonic.vrsni", "");
Line Deleted : user_pref("extensions.softonic_i.aflt", "orgnl");
Line Deleted : user_pref("extensions.softonic_i.dfltLng", "");
Line Deleted : user_pref("extensions.softonic_i.excTlbr", false);
Line Deleted : user_pref("extensions.softonic_i.id", "d65288460000000000002c27d72d77db");
Line Deleted : user_pref("extensions.softonic_i.instlDay", "15401");
Line Deleted : user_pref("extensions.softonic_i.instlRef", "MON00001");
Line Deleted : user_pref("extensions.softonic_i.newTab", false);
Line Deleted : user_pref("extensions.softonic_i.prdct", "softonic");
Line Deleted : user_pref("extensions.softonic_i.prtnrId", "softonic");
Line Deleted : user_pref("extensions.softonic_i.smplGrp", "eng7");
Line Deleted : user_pref("extensions.softonic_i.tlbrId", "eng7");

Line Deleted : user_pref("extensions.softonic_i.vrsn", "");
Line Deleted : user_pref("extensions.softonic_i.vrsnTs", "");
Line Deleted : user_pref("extensions.softonic_i.vrsni", "");
Line Deleted : user_pref("sweetim.toolbar.previous.browser.search.defaultenginename", "");
Line Deleted : user_pref("sweetim.toolbar.previous.browser.search.selectedEngine", "");
Line Deleted : user_pref("sweetim.toolbar.previous.browser.startup.homepage", "");
Line Deleted : user_pref("sweetim.toolbar.previous.keyword.URL", "");
Line Deleted : user_pref("sweetim.toolbar.scripts.1.domain-blacklist", "");
Line Deleted : user_pref("sweetim.toolbar.searchguard.UserRejectedGuard_DS", "");
Line Deleted : user_pref("sweetim.toolbar.searchguard.UserRejectedGuard_HP", "");
Line Deleted : user_pref("sweetim.toolbar.searchguard.enable", "");

- Google Chrome v30.0.1599.69

[ File : C:UsersUserAppDataLocalGoogleChromeUser DataDefaultpreferences ]


AdwCleaner[R0].txt - [42354 octets] - [08/10/2013 14:16:42]
AdwCleaner[s0].txt - [43150 octets] - [08/10/2013 14:17:20]

########## EOF - C:AdwCleanerAdwCleaner[s0].txt - [43211 octets] ##########







Junkware Removal Tool (JRT) by Thisisu
Version: 6.0.4 (10.06.2013:1)
OS: Windows 7 Enterprise x86
Ran by User on ўв 08.10.2013 Ј. at 14:21:51,90

~~~ Services

~~~ Registry Values

Successfully deleted: [Registry Value] HKEY_LOCAL_MACHINESoftwareMicrosoftWindowsCurrentVersionRundriver genius
Successfully deleted: [Registry Value] HKEY_LOCAL_MACHINESoftwareMicrosoftInternet ExplorerToolbar{1C46A0DD-D53E-46C4-A435-CA11103E255E}
Successfully repaired: [Registry Value] HKEY_LOCAL_MACHINESoftwareMicrosoftInternet ExplorerAboutURLsTabs

~~~ Registry Keys

Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_1_rasapi32
Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_1_rasmancs
Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_rasapi32
Successfully deleted: [Registry Key] HKEY_LOCAL_MACHINESoftwareMicrosoftTracingprivitizevpn_rasmancs
Successfully deleted: [Registry Key] HKEY_CURRENT_USERSoftwareMicrosoftInternet ExplorerSearchScopes{C0A82207-8344-41F1-A040-BEBAA81FEE54}

~~~ Files

Successfully deleted: [File] C:Windowssystem32RENA6DE.tmp
Successfully deleted: [File] C:Windowssystem32RENA6DF.tmp

~~~ Folders

Successfully deleted: [Folder] "C:UsersUserappdatalocallowytd"
Successfully deleted: [Folder] "C:Windowssystem32ai_recyclebin"
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{1CFCDD62-6187-4378-8E2D-24833D1CCB5B}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{3DB399A4-5370-40A7-83EF-75CA91C3AFCE}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{7D560449-D69C-4CCA-9FFC-D1E3CE3CC7F6}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{A18883CF-114E-49F7-9963-DAE6FDDEFEE9}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{CDCD390C-BDB3-40B6-BF5C-0EE64591247B}
Successfully deleted: [Empty Folder] C:UsersUserappdatalocal{DBCD12A3-7171-4FA6-AD55-4E2088D6EB5B}

~~~ FireFox

Successfully deleted: [File] C:UsersUserAppDataRoamingmozillafirefoxprofilesptoklpuh.defaultsearchpluginsprivitize.xml
Successfully deleted the following from C:UsersUserAppDataRoamingmozillafirefoxprofilesptoklpuh.defaultprefs.js

user_pref("extensions.privitize.admin", false);
user_pref("extensions.privitize.aflt", "5");
user_pref("extensions.privitize.appId", "{301966DF-A84B-4255-AAB9-574B5CE237E4}");
user_pref("extensions.privitize.autoRvrt", "false");
user_pref("extensions.privitize.dfltLng", "");
user_pref("extensions.privitize.dfltSrch", true);
user_pref("extensions.privitize.dnsErr", true);
user_pref("extensions.privitize.excTlbr", false);
user_pref("extensions.privitize.ffxUnstlRst", false);
user_pref("extensions.privitize.hmpg", true);

user_pref("extensions.privitize.id", "d65288460000000000002c27d72d77db");
user_pref("extensions.privitize.instlDay", "15876");
user_pref("extensions.privitize.instlRef", "");

user_pref("extensions.privitize.newTab", true);

user_pref("extensions.privitize.prdct", "privitize");
user_pref("extensions.privitize.prtnrId", "privitize");
user_pref("extensions.privitize.rvrt", "false");
user_pref("extensions.privitize.smplGrp", "none");
user_pref("extensions.privitize.tlbrId", "base");

user_pref("extensions.privitize.vrsn", "");
user_pref("extensions.privitize.vrsnTs", "");
user_pref("extensions.privitize.vrsni", "");

Emptied folder: C:UsersUserAppDataRoamingmozillafirefoxprofilesptoklpuh.defaultminidumps [1016 files]

~~~ Event Viewer Logs were cleared

Scan was completed on ўв 08.10.2013 Ј. at 14:24:01,13
End of JRT log



Malwarebytes Anti-Malware





Malwarebytes Anti-Malware

Database version: v2013.10.08.04

Windows 7 Service Pack 1 x86 NTFS
Internet Explorer 10.0.9200.16686
User :: HP [administrator]

8.10.2013 г. 14:30:19 ч.
MBAM-log-2013-10-08 (15-53-04).txt

Scan type: Full scan (C:|D:|)
Scan options enabled: Memory | Startup | Registry | File System | Heuristics/Extra | Heuristics/Shuriken | PUP | PUM
Scan options disabled: P2P
Objects scanned: 377679
Time elapsed: 1 hour(s), 20 minute(s), 49 second(s)

Memory Processes Detected: 0
(No malicious items detected)

Memory Modules Detected: 0
(No malicious items detected)

Registry Keys Detected: 0
(No malicious items detected)

Registry Values Detected: 0
(No malicious items detected)

Registry Data Items Detected: 0
(No malicious items detected)

Folders Detected: 0
(No malicious items detected)

Files Detected: 6
C:UsersUserAppDataLocalTempfUgRjIO1.zip.part (Trojan.Agent.HE) -> No action taken.
C:UsersUserDesktopНова папкаCDHackcdhack.dll (Trojan.Agent.H) -> No action taken.
D:DownloadsmarketSoftonicDownloader_for_tactical-ops-assault-on-terror.exe (PUP.Optional.Softonic.A) -> No action taken.
D:DownloadstalismanMedal.of.Honor.2010.Multi3.RU.RepackAutorun.exe (Trojan.Agent) -> No action taken.
D:DownloadstalismanMedal.of.Honor.2010.Multi3.RU.RepackMedal of HonorBinariesloader.dll (Riskware.Tool.CK) -> No action taken.
D:LFSLFSip-patch.exe (Backdoor.Bifrose) -> No action taken.


Редактирано от hippnozis (преглед на промените)

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Сканирайте отново с Malwarebytes Anti-Malware но този път маркирайте всички намерени обекти и натиснете Публикувано изображение .
..след това..:


Публикувано изображение Изтеглете ComboFix Публикувано изображение от тук и го запазете на десктопа си
Изключете вашата антивирусна и антишпионска програма, обикновено това става чрез натискане на десния бутон на мишката върху иконата на програма в системния трей.
Бележка: Ако не можете я спрете или не сте сигурни коя програма да изключите, моля прегледайте информацията от този линк: How to disable your security applications by amateur

Стартирайте Combo-Fix.com Публикувано изображение и следвайте инструкциите.
Бележка: ComboFix ще се стартира без инсталирана Recovery Console.
Като част от неговата работа, ComboFix ще провери дали Microsoft Windows Recovery Console е инсталирана. Предвид бързо развиващия се зловреден софтуер е силно препоръчително да бъде инсталирана преди премахването на зловредния софтуер. Това ще Ви позволи да влезете в специален recovery/repai режим, който ще ни позволи по-лесно да решите проблем, който би могъл да възникне при премахване на зловредния софтуер.

  • [*]Следвайте инструкциите, за да позволите на
ComboFix да изтегли и инсталира Microsoft Windows Recovery Console.В един момент ще бъдете попитани дали сте съгласни с лицензното споразумение. Необходимо е да потвърдите, че сте съгласни, за да инсталирате Microsoft Windows Recovery Console.

** Забележете: Ако Microsoft Windows Recovery Console е вече инсталирана, ComboFix ще продължи към процеса по премахване на зловредния софтуер.
Публикувано изображение
След като Microsoft Windows Recovery Console е инсталирана, използвайки ComboFix, Вие ще видите следното съобщение:
Публикувано изображение


Изберете Yes, за да продължи сканирането за зловреден софтуер.

Когато процесът приключи успешно, инструментът ще създаде лог файл. Моля, включете съдържанието на C:ComboFix.txt в следващия Ви коментар в тази тема.
Публикувано изображение Моля, не прикачвайте лог файла/овете от програмата, а го/ги копирайте и поставете в следващия Ви коментар в тази тема.

  • Харесва ми 2

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Malwarebytes Anti-Malware го оправих но не ми са създаде лог :no-no:

ако може да ми обясните пораженията по системата .. :)

ето лога от  ComboFix


ComboFix 13-10-08.01 - User 10.2013 г.  16:26:31.1.2 - x86
Microsoft Windows 7 Enterprise 6.1.7601.1.1251.359.1026.18.1917.1251 [GMT 3:00]
Running from: c:usersUserDownloadsComboFix.exe
AV: Microsoft Security Essentials *Disabled/Updated* {641105E6-77ED-3F35-A304-765193BCB75F}
SP: Microsoft Security Essentials *Disabled/Updated* {DF70E402-51D7-30BB-99B4-4D23E83BFDE2}
SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
 * Created a new restore point
((((((((((((((((((((((((((((((((((((((( Other Deletions )))))))))))))))))))))))))))))))))))))))))))))))))
c:usersUserAppDataLocalGoogleChromeUser DataDefaultPreferences
((((((((((((((((((((((((((((((((((((((( Drivers/Services )))))))))))))))))))))))))))))))))))))))))))))))))
((((((((((((((((((((((((( Files Created from 2013-09-09 to 2013-10-09  )))))))))))))))))))))))))))))))
2013-10-08 11:29 . 2013-10-08 11:29  --------  d-----w-  c:program filesMalwarebytes' Anti-Malware
2013-10-08 11:29 . 2013-04-04 11:50  22856  ----a-w-  c:windowssystem32driversmbam.sys
2013-10-08 11:21 . 2013-10-08 11:21  --------  d-----w-  c:windowsERUNT
2013-10-08 11:14 . 2013-10-08 11:17  --------  d-----w-  C:AdwCleaner
2013-10-05 17:39 . 2013-10-08 18:07  --------  d-----w-  c:usersUserAppDataRoaming.minecraft
2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:usersUserAppDataLocalLogMeIn
2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:programdataLogMeIn
2013-09-30 17:52 . 2013-09-30 17:52  --------  d-----w-  c:program filesAcclaim Entertainment
2013-09-11 17:49 . 2013-09-11 17:49  --------  d-----w-  c:programdataNexon
2013-09-11 16:49 . 2013-09-11 16:50  --------  d-----w-  c:usersUserAppDataLocalAkamai
2013-09-09 17:09 . 2013-09-09 17:09  --------  d--h--w-  c:program filesTemp
(((((((((((((((((((((((((((((((((((((((( Find3M Report ))))))))))))))))))))))))))))))))))))))))))))))))))))
2013-10-09 13:23 . 2013-10-09 13:23  40392  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{2757D113-8F0B-4D07-B3E8-681947E139C5}MpKsl70dd4d28.sys
2013-10-09 13:08 . 2012-03-30 11:00  692616  ----a-w-  c:windowssystem32FlashPlayerApp.exe
2013-10-09 13:08 . 2011-08-07 14:11  71048  ----a-w-  c:windowssystem32FlashPlayerCPLApp.cpl
2013-10-02 15:06 . 2012-07-21 23:29  37664  ----a-w-  c:windowssystem32driversavgtpx86.sys
2013-09-06 17:07 . 2013-09-06 17:07  718712  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{A791E496-9C9C-4EC1-BCB5-B6B12246FAC6}gapaengine.dll
2013-09-05 05:02 . 2013-10-09 11:31  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{2757D113-8F0B-4D07-B3E8-681947E139C5}mpengine.dll
2013-09-05 05:02 . 2013-10-08 11:31  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesBackupmpengine.dll
2013-08-22 18:02 . 2011-08-11 08:57  697992  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesNISBackupgapaengine.dll
2013-07-25 08:57 . 2013-08-14 11:25  1620992  ----a-w-  c:windowssystem32WMVDECOD.DLL
2013-07-19 01:41 . 2013-08-14 11:25  2048  ----a-w-  c:windowssystem32tzres.dll
2011-09-10 00:24 . 2013-10-01 15:48  119808  ----a-w-  c:program filesmozilla firefoxcomponentsGoogleDesktopMozilla.dll
((((((((((((((((((((((((((((((((((((( Reg Loading Points ))))))))))))))))))))))))))))))))))))))))))))))))))
*Note* empty entries & legit default entries are not shown
"DAEMON Tools Lite"="c:program filesDAEMON Tools LiteDTLite.exe" [2011-08-02 4910912]
"Sidebar"="c:program filesWindows Sidebarsidebar.exe" [2010-11-20 1174016]
"Skype"="c:program filesSkypePhoneSkype.exe" [2013-07-25 20684656]
"Akamai NetSession Interface"="c:usersUserAppDataLocalAkamainetsession_win.exe" [2013-06-04 4489472]
"BCSSync"="c:program filesMicrosoft OfficeOffice14BCSSync.exe" [2010-03-13 91520]
"ZSSnp211"="c:windowsZSSnp211.exe" [2007-04-06 57344]
"Google Desktop Search"="c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe" [2011-09-10 30192]
"MSC"="c:program filesMicrosoft Security Clientmsseces.exe" [2013-06-20 995176]
"IgfxTray"="c:windowssystem32igfxtray.exe" [2012-11-13 138784]
"HotKeysCmds"="c:windowssystem32hkcmd.exe" [2012-11-13 172064]
"Persistence"="c:windowssystem32igfxpers.exe" [2012-11-13 173600]
"SunJavaUpdateSched"="c:program filesCommon FilesJavaJava Updatejusched.exe" [2013-03-12 253816]
"LogMeIn Hamachi Ui"="d:downloadsmyНова папкаhamachi-2-ui.exe" [2013-10-01 2345296]
"ConsentPromptBehaviorUser"= 3 (0x3)
"EnableUIADesktopToggle"= 0 (0x0)
[HKEY_LOCAL_MACHINEsoftwaremicrosoftwindows ntcurrentversionwindows]
[HKLM~startupfolderC:^Users^User^AppData^Roaming^Microsoft^Windows^Start Menu^Programs^Startup^GamersFirst LIVE!.lnk]
path=c:usersUserAppDataRoamingMicrosoftWindowsStart MenuProgramsStartupGamersFirst LIVE!.lnk
backup=c:windowspssGamersFirst LIVE!.lnk.Startup
[HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregDomino]
2006-08-18 13:58  49152  ----a-w-  c:windowsDomino.exe
[HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregFacebook Update]
2012-07-11 20:44  138096  ----atw-  c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe
R2 SkypeUpdate;Skype Updater;c:program filesSkypeUpdaterUpdater.exe [2013-07-25 162672]
R2 vToolbarUpdater17.0.12;vToolbarUpdater17.0.12;c:program filesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exe [x]
R3 dmvsc;dmvsc;c:windowssystem32driversdmvsc.sys [2010-11-20 62464]
R3 EagleXNt;EagleXNt;c:windowssystem32driversEagleXNt.sys [x]
R3 FairplayKD;FairplayKD;c:programdataMTA San Andreas All1.3tempFairplayKD.sys [x]
R3 GoogleDesktopManager-051210-111108;Диспечер на Google Desktop 5.9.1005.12335;c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe [2011-09-10 30192]
R3 NisDrv;Microsoft Network Inspection System;c:windowssystem32DRIVERSNisDrvWFP.sys [2013-06-18 107392]
R3 NisSrv;Мрежова проверка на Microsoft;c:program filesMicrosoft Security ClientNisSrv.exe [2013-06-20 295376]
R3 RdpVideoMiniport;Remote Desktop Video Miniport Driver;c:windowssystem32driversrdpvideominiport.sys [2010-11-20 15872]
R3 Synth3dVsc;Synth3dVsc;c:windowssystem32driverssynth3dvsc.sys [2010-11-20 77184]
R3 terminpt;Microsoft Remote Desktop Input Driver;c:windowssystem32driversterminpt.sys [2010-11-20 25600]
R3 TsUsbFlt;TsUsbFlt;c:windowssystem32driverstsusbflt.sys [2010-11-20 52224]
R3 TsUsbGD;Remote Desktop Generic USB Device;c:windowssystem32driversTsUsbGD.sys [2010-11-20 27264]
R3 tsusbhub;tsusbhub;c:windowssystem32driverstsusbhub.sys [2010-11-20 112640]
R3 VGPU;VGPU;c:windowssystem32driversrdvgkmd.sys [x]
R3 vvftav211;vvftav211;c:windowssystem32driversvvftav211.sys [2007-12-10 480128]
R3 WatAdminSvc;Услуга на технологиите за активиране на Windows;c:windowssystem32WatWatAdminSvc.exe [2011-08-05 1343400]
R3 WinRing0_1_2_0;WinRing0_1_2_0;d:mcRazer Game BoosterDriverWinRing0.sys [x]
R3 XDva394;XDva394;c:windowssystem32XDva394.sys [x]
R3 XDva397;XDva397;c:windowssystem32XDva397.sys [x]
R3 XDva399;XDva399;c:windowssystem32XDva399.sys [x]
R3 XDva401;XDva401;c:windowssystem32XDva401.sys [x]
R3 ZSMC30x;USB PC Camera Service ZSMC30x;c:windowssystem32DriversZS211.sys [2007-12-05 1537024]
S1 avgtp;avgtp;c:windowssystem32driversavgtpx86.sys [2013-10-02 37664]
S1 dtsoftbus01;DAEMON Tools Virtual Bus Driver;c:windowssystem32DRIVERSdtsoftbus01.sys [2011-08-05 232512]
S1 MpKsl70dd4d28;MpKsl70dd4d28;c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{2757D113-8F0B-4D07-B3E8-681947E139C5}MpKsl70dd4d28.sys [2013-10-09 40392]
S2 Hamachi2Svc;LogMeIn Hamachi Tunneling Engine;d:downloadsmyНова папкаhamachi-2.exe [2013-10-01 1612112]
S2 RzKLService;RzKLService;d:mcRazer Game BoosterRzKLService.exe [2013-09-18 106472]
S2 Skype C2C Service;Skype C2C Service;c:programdataSkypeToolbarsSkype C2C Servicec2c_service.exe [2013-09-16 3273088]
S2 TeamViewer8;TeamViewer 8;c:program filesTeamViewerVersion8TeamViewer_Service.exe [2013-08-07 4308320]
S3 RTL8167;Realtek 8167 NT Driver;c:windowssystem32DRIVERSRt86win7.sys [2009-03-01 139776]
--- Other Services/Drivers In Memory ---
*NewlyCreated* - WS2IFSL
[HKEY_LOCAL_MACHINEsoftwaremicrosoftactive setupinstalled components{8A69D345-D564-463c-AFF1-A69D9E530F96}]
2013-10-06 11:22  1185744  ----a-w-  c:program filesGoogleChromeApplication30.0.1599.69Installerchrmstp.exe
Contents of the 'Scheduled Tasks' folder
2013-10-09 c:windowsTasksAdobe Flash Player Updater.job
- c:windowssystem32MacromedFlashFlashPlayerUpdateService.exe [2012-03-30 13:08]
2013-10-05 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000Core.job
- c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44]
2013-10-09 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000UA.job
- c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44]
2013-10-09 c:windowsTasksGoogleUpdateTaskMachineCore.job
- c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14]
2013-10-09 c:windowsTasksGoogleUpdateTaskMachineUA.job
- c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14]
------- Supplementary Scan -------

uInternet Settings,ProxyOverride = <local>
IE: Download all by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm
IE: Download by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm
IE: E&xport to Microsoft Excel - c:progra~1MICROS~2Office14EXCEL.EXE/3000
IE: Free YouTube Download - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeytvdownloader.htm
IE: Free YouTube to MP3 Converter - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeyoutubetomp3converter.htm
IE: Se&nd to OneNote - c:progra~1MICROS~2Office14ONBttnIE.dll/105
IE: ????3?? - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm
IE: ????3?????? - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm
Trusted Zone: clonewarsadventures.com
Trusted Zone: freerealms.com
Trusted Zone: soe.com
Trusted Zone: sony.com
FF - ProfilePath - c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.default
FF - prefs.js: browser.search.defaulturl -

FF - ExtSQL: 2013-09-30 19:10; WebSiteRecommendation@weliketheweb.com; c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultextensionsWebSiteRecommendation@weliketheweb.com
- - - - ORPHANS REMOVED - - - -
HKCU-Run-Clownfish - c:program filesClownfishClownfish.exe
MSConfigStartUp-Clownfish - c:program filesClownfishClownfish.exe
MSConfigStartUp-Steam - c:program filesSteamSteam.exe
AddRemove-Clownfish - c:program filesClownfishuninstall.exe
AddRemove-Driver Genius Professional Edition_is1 - d:downloadskamioniDriverGeniusunins000.exe
AddRemove-Minecraft 1.6.2 - c:usersUserAppDataRoaming.minecraftUninstal.exe
AddRemove-Minecraft1.6.2 - c:usersUserAppDataRoaming.minecraftminecraft launcherUninstall.exe
AddRemove-privitize - c:program filesIndustriyaprivitize1.8.21.6uninstall.exe
AddRemove-BeamNG-Techdemo-0.3 - d:mda eBeamNG-Techdemo-0.3uninst-BeamNG-Techdemo-0.3.exe
AddRemove-Counter-Strike 1.6 Escom 3d!7!0n - by AmaRelle v1.0 - d:downloadsskiiUninstal.exe
AddRemove-GamersFirst LIVE! - c:usersUserAppDataLocalGamersFirstLIVE!uninstall.exe
AddRemove-SOE-Magic The Gathering Tactics - d:downloadsНова папкаUninstaller.exe
AddRemove-World of Warcraft Trial - c:usersPublicDocumentsBlizzard EntertainmentWorld of Warcraft Trial (2)Uninstall.exe
--------------------- LOCKED REGISTRY KEYS ---------------------
[HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}Џ]
@Allowed: (Read) (RestrictedCode)
@="c:Program FilesFlashGet NetworkFlashGet 3GetUrl.htm"
[HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}ЏhQиђю”Ґc]
@Allowed: (Read) (RestrictedCode)
@="c:Program FilesFlashGet NetworkFlashGet 3GetAllUrl.htm"
@Denied: (A) (Users)
@Denied: (A) (Everyone)
@Allowed: (B 1 2 3 4 5) (S-1-5-20)
@Denied: (Full) (Everyone)
------------------------ Other Running Processes ------------------------
c:program filesMicrosoft Security ClientMsMpEng.exe
c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSVC.EXE
c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSvcM.exe
c:program filesWindows Media Playerwmpnetwk.exe
Completion time: 2013-10-09  16:37:58 - machine was rebooted
ComboFix-quarantined-files.txt  2013-10-09 13:37
Pre-Run: 19 964 141 568 bytes free
Post-Run: 19 761 917 952 bytes free
- - End Of File - - B349F3FA563916209B179A5B0B6BCCD9

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Копирайте текста в карето на notepad и го запазвате с име CFScript.txt на десктопа си:

KILLALL::ClearJavaCache::File::c:windowssystem32driversavgtpx86.sysc:program filesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exeFolder::c:usersUserAppDataRoaming.minecraftDriver::vToolbarUpdater17.0.12avgtpDDS::Trusted Zone: clonewarsadventures.comTrusted Zone: freerealms.comTrusted Zone: soe.comTrusted Zone: sony.com

След съхранението преместете  CFScript.txt на иконата на ComboFix.exe

Публикувано изображение

Генерирания рапорт копирайте  и го поставете в следващия си коментар...!

  • Харесва ми 1

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Ето лога






ComboFix 13-10-08.01 - User 10.2013 г.  16:48:42.2.2 - x86 Microsoft Windows 7 Enterprise 6.1.7601.1.1251.359.1026.18.1917.1130 [GMT 3:00] Running from: c:usersUserDownloadsComboFix.exe Command switches used :: c:usersUserDownloadsCFScript.txt.txt AV: Microsoft Security Essentials *Disabled/Updated* {641105E6-77ED-3F35-A304-765193BCB75F} SP: Microsoft Security Essentials *Disabled/Updated* {DF70E402-51D7-30BB-99B4-4D23E83BFDE2} SP: Windows Defender *Disabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}  * Created a new restore point . FILE :: "c:program filesCommon FilesAVG Secure SearchvToolbarUpdater17.0.12ToolbarUpdater.exe" "c:windowssystem32driversavgtpx86.sys" . . ((((((((((((((((((((((((((((((((((((((( Other Deletions ))))))))))))))))))))))))))))))))))))))))))))))))) . . c:usersUserAppDataLocalGoogleChromeUser DataDefaultPreferences c:usersUserAppDataRoaming.minecraft c:usersUserAppDataRoaming.minecraftassetsiconsicon_16x16.png c:usersUserAppDataRoaming.minecraftassetsiconsicon_32x32.png c:usersUserAppDataRoaming.minecraftassetsiconsminecraft.icns c:usersUserAppDataRoaming.minecraftassetslangaf_ZA.lang c:usersUserAppDataRoaming.minecraftassetslangar_SA.lang c:usersUserAppDataRoaming.minecraftassetslangbg_BG.lang c:usersUserAppDataRoaming.minecraftassetslangca_ES.lang c:usersUserAppDataRoaming.minecraftassetslangcs_CZ.lang c:usersUserAppDataRoaming.minecraftassetslangcy_GB.lang c:usersUserAppDataRoaming.minecraftassetslangda_DK.lang c:usersUserAppDataRoaming.minecraftassetslangde_DE.lang c:usersUserAppDataRoaming.minecraftassetslangel_GR.lang c:usersUserAppDataRoaming.minecraftassetslangen_AU.lang c:usersUserAppDataRoaming.minecraftassetslangen_CA.lang c:usersUserAppDataRoaming.minecraftassetslangen_GB.lang c:usersUserAppDataRoaming.minecraftassetslangen_PT.lang c:usersUserAppDataRoaming.minecraftassetslangeo_UY.lang c:usersUserAppDataRoaming.minecraftassetslanges_AR.lang c:usersUserAppDataRoaming.minecraftassetslanges_ES.lang c:usersUserAppDataRoaming.minecraftassetslanges_MX.lang c:usersUserAppDataRoaming.minecraftassetslanges_UY.lang c:usersUserAppDataRoaming.minecraftassetslanges_VE.lang c:usersUserAppDataRoaming.minecraftassetslanget_EE.lang c:usersUserAppDataRoaming.minecraftassetslangeu_ES.lang c:usersUserAppDataRoaming.minecraftassetslangfi_FI.lang c:usersUserAppDataRoaming.minecraftassetslangfr_CA.lang c:usersUserAppDataRoaming.minecraftassetslangfr_FR.lang c:usersUserAppDataRoaming.minecraftassetslangga_IE.lang c:usersUserAppDataRoaming.minecraftassetslanggl_ES.lang c:usersUserAppDataRoaming.minecraftassetslanghe_IL.lang c:usersUserAppDataRoaming.minecraftassetslanghi_IN.lang c:usersUserAppDataRoaming.minecraftassetslanghr_HR.lang c:usersUserAppDataRoaming.minecraftassetslanghu_HU.lang c:usersUserAppDataRoaming.minecraftassetslanghy_AM.lang c:usersUserAppDataRoaming.minecraftassetslangid_ID.lang c:usersUserAppDataRoaming.minecraftassetslangis_IS.lang c:usersUserAppDataRoaming.minecraftassetslangit_IT.lang c:usersUserAppDataRoaming.minecraftassetslangja_JP.lang c:usersUserAppDataRoaming.minecraftassetslangka_GE.lang c:usersUserAppDataRoaming.minecraftassetslangko_KR.lang c:usersUserAppDataRoaming.minecraftassetslangkw_GB.lang c:usersUserAppDataRoaming.minecraftassetslangky_KG.lang c:usersUserAppDataRoaming.minecraftassetslangla_LA.lang c:usersUserAppDataRoaming.minecraftassetslanglt_LT.lang c:usersUserAppDataRoaming.minecraftassetslanglv_LV.lang c:usersUserAppDataRoaming.minecraftassetslangmi_NZ.lang c:usersUserAppDataRoaming.minecraftassetslangms_MY.lang c:usersUserAppDataRoaming.minecraftassetslangmt_MT.lang c:usersUserAppDataRoaming.minecraftassetslangnb_NO.lang c:usersUserAppDataRoaming.minecraftassetslangnl_NL.lang c:usersUserAppDataRoaming.minecraftassetslangnn_NO.lang c:usersUserAppDataRoaming.minecraftassetslangno_NO.lang c:usersUserAppDataRoaming.minecraftassetslangoc_FR.lang c:usersUserAppDataRoaming.minecraftassetslangpl_PL.lang c:usersUserAppDataRoaming.minecraftassetslangpt_BR.lang c:usersUserAppDataRoaming.minecraftassetslangpt_PT.lang c:usersUserAppDataRoaming.minecraftassetslangqya_AA.lang c:usersUserAppDataRoaming.minecraftassetslangro_RO.lang c:usersUserAppDataRoaming.minecraftassetslangru_RU.lang c:usersUserAppDataRoaming.minecraftassetslangsk_SK.lang c:usersUserAppDataRoaming.minecraftassetslangsl_SI.lang c:usersUserAppDataRoaming.minecraftassetslangsr_SP.lang c:usersUserAppDataRoaming.minecraftassetslangsv_SE.lang c:usersUserAppDataRoaming.minecraftassetslangth_TH.lang c:usersUserAppDataRoaming.minecraftassetslangtlh_AA.lang c:usersUserAppDataRoaming.minecraftassetslangtr_TR.lang c:usersUserAppDataRoaming.minecraftassetslanguk_UA.lang c:usersUserAppDataRoaming.minecraftassetslangvi_VN.lang c:usersUserAppDataRoaming.minecraftassetslangzh_CN.lang c:usersUserAppDataRoaming.minecraftassetslangzh_TW.lang c:usersUserAppDataRoaming.minecraftassetsmusiccalm1.ogg c:usersUserAppDataRoaming.minecraftassetsmusiccalm2.ogg c:usersUserAppDataRoaming.minecraftassetsmusiccalm3.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal1.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal2.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal3.ogg c:usersUserAppDataRoaming.minecraftassetsmusichal4.ogg c:usersUserAppDataRoaming.minecraftassetsmusicnuance1.ogg c:usersUserAppDataRoaming.minecraftassetsmusicnuance2..ogg c:usersUserAppDataRoaming.minecraftassetsmusicnuance2.ogg c:usersUserAppDataRoaming.minecraftassetsmusicpiano1.ogg c:usersUserAppDataRoaming.minecraftassetsmusicpiano2.ogg c:usersUserAppDataRoaming.minecraftassetsmusicpiano3.ogg c:usersUserAppDataRoaming.minecraftassetspack.mcmeta c:usersUserAppDataRoaming.minecraftassetsREAD_ME_I_AM_VERY_IMPORTANT c:usersUserAppDataRoaming.minecraftassetsrecords11.ogg c:usersUserAppDataRoaming.minecraftassetsrecords13.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsblocks.ogg c:usersUserAppDataRoaming.minecraftassetsrecordscat.ogg c:usersUserAppDataRoaming.minecraftassetsrecordschirp.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsfar.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsmall.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsmellohi.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsstal.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsstrad.ogg c:usersUserAppDataRoaming.minecraftassetsrecordswait.ogg c:usersUserAppDataRoaming.minecraftassetsrecordsward.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave1.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave10.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave11.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave12.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave13.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave2.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave3.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave4.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave5.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave6.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave7.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave8.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientcavecave9.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain1.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain2.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain3.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherrain4.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherthunder1.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherthunder2.ogg c:usersUserAppDataRoaming.minecraftassetssoundambientweatherthunder3.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagefallbig.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagefallsmall.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagehit1.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagehit2.ogg c:usersUserAppDataRoaming.minecraftassetssounddamagehit3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigcloth4.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass1.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass2.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass3.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggrass4.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel1.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel2.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel3.ogg c:usersUserAppDataRoaming.minecraftassetssounddiggravel4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsand4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigsnow4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigstone4.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood1.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood2.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood3.ogg c:usersUserAppDataRoaming.minecraftassetssounddigwood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundfirefire.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireignite.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworksblast_far1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworksblast1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkslargeBlast_far1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkslargeBlast1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkslaunch1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkstwinkle_far1.ogg c:usersUserAppDataRoaming.minecraftassetssoundfireworkstwinkle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidlava.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidlavapop.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidsplash.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidsplash2.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim1.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim2.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim3.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidswim4.ogg c:usersUserAppDataRoaming.minecraftassetssoundliquidwater.ogg c:usersUserAppDataRoaming.minecraftassetssoundminecartbase.ogg c:usersUserAppDataRoaming.minecraftassetssoundminecartinside.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbathurt4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatidle4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbatloop.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobbattakeoff.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazebreathe4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobblazehit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathiss1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathiss2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathiss3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathitt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathitt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcathitt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatmeow4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurr1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurr2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurr3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurreow1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcatpurreow2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenplop.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickensay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickensay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickensay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobchickenstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowsay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcowstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreeperdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobcreepersay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonend.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragongrowl4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobenderdragonwings6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermendeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenidle5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenportal.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenportal2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenscream4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobendermenstare.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastaffectionate_scream.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastcharge.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastfireball4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastmoan7.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobghastscream5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseangry1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsearmor.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsebreathe1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsebreathe2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsebreathe3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyangry1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyangry2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeydeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsedonkeyidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsegallop4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsehit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsejump.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseland.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseleather.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletondeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorseskeletonidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsesoft6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsewood6.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombiehit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombieidle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombieidle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobhorsezombieidle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemthrow.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobirongolemwalk4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubebig4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubejump4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobmagmacubesmall5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobpigstep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepshear.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsheepstep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishkill.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishsay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobsilverfishstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletondeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonhurt4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonsay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonsay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonsay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobskeletonstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimeattack1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimeattack2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimebig4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobslimesmall5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspidersay4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobspiderstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhaggle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhaggle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhaggle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageridle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageridle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageridle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerno1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerno2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillagerno3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageryes1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageryes2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobvillageryes3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherhurt4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitheridle4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwithershoot.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwitherspawn.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfbark1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfbark2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfbark3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfgrowl1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfgrowl2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfgrowl3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhowl1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhowl2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfhurt3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfpanting.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfshake.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfstep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobwolfwhine.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiedeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiehurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiehurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombieinfect.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiemetal1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiemetal2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiemetal3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombieremedy.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiesay1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiesay2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiesay3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiestep5.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombieunfect.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiewoodbreak.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpig4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry2.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry3.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigangry4.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpigdeath.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpighurt1.ogg c:usersUserAppDataRoaming.minecraftassetssoundmobzombiepigzpighurt2.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotebass.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotebassattack.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotebd.ogg c:usersUserAppDataRoaming.minecraftassetssoundnoteharp.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotehat.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotepling.ogg c:usersUserAppDataRoaming.minecraftassetssoundnotesnare.ogg c:usersUserAppDataRoaming.minecraftassetssoundportalportal.ogg c:usersUserAppDataRoaming.minecraftassetssoundportaltravel.ogg c:usersUserAppDataRoaming.minecraftassetssoundportaltrigger.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomanvil_break.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomanvil_land.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomanvil_use.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombow.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombowhit4.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombreak.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandombreath.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomburp.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomchestclosed.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomchestopen.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomclassic_hurt.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomclick.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomdoor_close.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomdoor_open.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomdrink.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomeat1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomeat2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomeat3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomexplode4.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomfizz.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomfuse.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomglass1.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomglass2.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomglass3.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomlevelup.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomorb.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandompop.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomsplash.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomsuccessful_hit.ogg c:usersUserAppDataRoaming.minecraftassetssoundrandomwood_click.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepcloth4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgrass6.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepgravel4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepladder5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsand5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepsnow4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepstone6.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood1.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood2.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood3.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood4.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood5.ogg c:usersUserAppDataRoaming.minecraftassetssoundstepwood6.ogg c:usersUserAppDataRoaming.minecraftassetssoundtilepistonin.ogg c:usersUserAppDataRoaming.minecraftassetssoundtilepistonout.ogg c:usersUserAppDataRoaming.minecraftgamefiles.zip c:usersUserAppDataRoaming.minecrafths_err_pid1008.log c:usersUserAppDataRoaming.minecrafths_err_pid3184.log c:usersUserAppDataRoaming.minecrafths_err_pid4160.log c:usersUserAppDataRoaming.minecraftlauncheroptions.txt c:usersUserAppDataRoaming.minecraftlibrariesargo-2.25_fixed.jar c:usersUserAppDataRoaming.minecraftlibrariesasm-all-4.1.jar c:usersUserAppDataRoaming.minecraftlibrariesbcprov-jdk15on-1.47.jar c:usersUserAppDataRoaming.minecraftlibrariescodecjorbis-20101023.jar c:usersUserAppDataRoaming.minecraftlibrariescodecwav-20101023.jar c:usersUserAppDataRoaming.minecraftlibrariescommons-io-2.4.jar c:usersUserAppDataRoaming.minecraftlibrariescommons-lang3-3.1.jar c:usersUserAppDataRoaming.minecraftlibrariesgson-2.2.2.jar c:usersUserAppDataRoaming.minecraftlibrariesguava-14.0.jar c:usersUserAppDataRoaming.minecraftlibrariesjinput-2.0.5.jar c:usersUserAppDataRoaming.minecraftlibrariesjinput-platform-2.0.5-natives-windows.jar c:usersUserAppDataRoaming.minecraftlibrariesjopt-simple-4.5.jar c:usersUserAppDataRoaming.minecraftlibrariesjutils-1.0.0.jar c:usersUserAppDataRoaming.minecraftlibrarieslibraryjavasound-20101123.jar c:usersUserAppDataRoaming.minecraftlibrarieslibrarylwjglopenal-20100824.jar c:usersUserAppDataRoaming.minecraftlibrarieslwjgl-2.9.0.jar c:usersUserAppDataRoaming.minecraftlibrarieslwjgl-platform-2.9.0-natives-windows.jar c:usersUserAppDataRoaming.minecraftlibrarieslwjgl_util-2.9.0.jar c:usersUserAppDataRoaming.minecraftlibrarieslzma-0.0.1.jar c:usersUserAppDataRoaming.minecraftlibrariessoundsystem-20120107.jar c:usersUserAppDataRoaming.minecraftMinecraft.exe c:usersUserAppDataRoaming.minecraftoptions.txt c:usersUserAppDataRoaming.minecraftoptionsof.txt c:usersUserAppDataRoaming.minecraftoutput-client.log c:usersUserAppDataRoaming.minecraftoutput-client.log.1 c:usersUserAppDataRoaming.minecraftoutput-client.log.2 c:usersUserAppDataRoaming.minecraftoutput-client.log.3 c:usersUserAppDataRoaming.minecraftoutput-server.log c:usersUserAppDataRoaming.minecraftoutput-server.log.1 c:usersUserAppDataRoaming.minecraftoutput-server.log.1.lck c:usersUserAppDataRoaming.minecraftoutput-server.log.2 c:usersUserAppDataRoaming.minecraftresourcepacks1.6_Flows_HD_128x_beta.zip c:usersUserAppDataRoaming.minecraftsavesasddataMineshaft.dat c:usersUserAppDataRoaming.minecraftsavesasddatavillages.dat c:usersUserAppDataRoaming.minecraftsavesasdlevel.dat c:usersUserAppDataRoaming.minecraftsavesasdlevel.dat_mcr c:usersUserAppDataRoaming.minecraftsavesasdlevel.dat_old c:usersUserAppDataRoaming.minecraftsavesasdplayershippnozis.dat c:usersUserAppDataRoaming.minecraftsavesasdregionr.-1.-1.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.-1.0.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.-2.-1.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.-2.0.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.0.-1.mca c:usersUserAppDataRoaming.minecraftsavesasdregionr.0.0.mca c:usersUserAppDataRoaming.minecraftsavesasdsession.lock c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISdataMineshaft.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISdatavillages.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISlevel.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISlevel.dat_mcr c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISlevel.dat_old c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISplayershippnozis.dat c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.-1.-1.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.-1.0.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.0.-1.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISregionr.0.0.mca c:usersUserAppDataRoaming.minecraftsavesHIPPNOZISsession.lock c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdataMineshaft.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdataStronghold.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdataTemple.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGdatavillages.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGlevel.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGlevel.dat_mcr c:usersUserAppDataRoaming.minecraftsaveshippnozisBGlevel.dat_old c:usersUserAppDataRoaming.minecraftsaveshippnozisBGplayershippnozis.dat c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-1.-1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-1.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-2.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-2.1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-2.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-3.3.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-4.1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-4.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-4.3.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-5.2.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.-5.3.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.0.-1.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGregionr.0.0.mca c:usersUserAppDataRoaming.minecraftsaveshippnozisBGsession.lock c:usersUserAppDataRoaming.minecraftscreenshots2013-10-05_20.44.58.png c:usersUserAppDataRoaming.minecraftscreenshots2013-10-05_20.59.59.png c:usersUserAppDataRoaming.minecraftstatsstats_hippnozis_unsent.dat c:usersUserAppDataRoaming.minecraftstatsstats_hippnozis_unsent.old c:usersUserAppDataRoaming.minecraftversions1. c:usersUserAppDataRoaming.minecraftversions1.6.4Optifine1.6.4Optifine.jar c:usersUserAppDataRoaming.minecraftversionsnativesjinput-dx8.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-dx8_64.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-raw.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-raw_64.dll c:usersUserAppDataRoaming.minecraftversionsnativesjinput-wintab.dll c:usersUserAppDataRoaming.minecraftversionsnativeslwjgl.dll c:usersUserAppDataRoaming.minecraftversionsnativeslwjgl64.dll c:usersUserAppDataRoaming.minecraftversionsnativesOpenAL32.dll c:usersUserAppDataRoaming.minecraftversionsnativesOpenAL64.dll c:windowssystem32driversavgtpx86.sys c:windowssystem32frapsvid.dll . . ((((((((((((((((((((((((((((((((((((((( Drivers/Services ))))))))))))))))))))))))))))))))))))))))))))))))) . . -------Legacy_AVGTP -------Service_avgtp . . ((((((((((((((((((((((((( Files Created from 2013-09-10 to 2013-10-10  ))))))))))))))))))))))))))))))) . . 2013-10-08 11:29 . 2013-10-08 11:29  --------  d-----w-  c:program filesMalwarebytes' Anti-Malware 2013-10-08 11:29 . 2013-04-04 11:50  22856  ----a-w-  c:windowssystem32driversmbam.sys 2013-10-08 11:21 . 2013-10-08 11:21  --------  d-----w-  c:windowsERUNT 2013-10-08 11:14 . 2013-10-08 11:17  --------  d-----w-  C:AdwCleaner 2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:usersUserAppDataLocalLogMeIn 2013-10-03 10:17 . 2013-10-03 10:17  --------  d-----w-  c:programdataLogMeIn 2013-09-30 17:52 . 2013-09-30 17:52  --------  d-----w-  c:program filesAcclaim Entertainment 2013-09-11 17:49 . 2013-09-11 17:49  --------  d-----w-  c:programdataNexon 2013-09-11 16:49 . 2013-09-11 16:50  --------  d-----w-  c:usersUserAppDataLocalAkamai . . . (((((((((((((((((((((((((((((((((((((((( Find3M Report )))))))))))))))))))))))))))))))))))))))))))))))))))) . 2013-10-10 13:45 . 2013-10-10 13:45  40392  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{22508C58-C50A-41F9-89D2-F57EA351158A}MpKsl83bfdb04.sys 2013-10-09 13:08 . 2012-03-30 11:00  692616  ----a-w-  c:windowssystem32FlashPlayerApp.exe 2013-10-09 13:08 . 2011-08-07 14:11  71048  ----a-w-  c:windowssystem32FlashPlayerCPLApp.cpl 2013-09-06 17:07 . 2013-09-06 17:07  718712  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{A791E496-9C9C-4EC1-BCB5-B6B12246FAC6}gapaengine.dll 2013-09-05 05:02 . 2013-10-09 16:59  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{22508C58-C50A-41F9-89D2-F57EA351158A}mpengine.dll 2013-09-05 05:02 . 2013-10-09 14:55  7328304  ----a-w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesBackupmpengine.dll 2013-08-22 18:02 . 2011-08-11 08:57  697992  ------w-  c:programdataMicrosoftMicrosoft AntimalwareDefinition UpdatesNISBackupgapaengine.dll 2013-07-25 08:57 . 2013-08-14 11:25  1620992  ----a-w-  c:windowssystem32WMVDECOD.DLL 2013-07-19 01:41 . 2013-08-14 11:25  2048  ----a-w-  c:windowssystem32tzres.dll 2011-09-10 00:24 . 2013-10-01 15:48  119808  ----a-w-  c:program filesmozilla firefoxcomponentsGoogleDesktopMozilla.dll . . ((((((((((((((((((((((((((((((((((((( Reg Loading Points )))))))))))))))))))))))))))))))))))))))))))))))))) . . *Note* empty entries & legit default entries are not shown REGEDIT4 . [HKEY_CURRENT_USERSOFTWAREMicrosoftWindowsCurrentVersionRun] "DAEMON Tools Lite"="c:program filesDAEMON Tools LiteDTLite.exe" [2011-08-02 4910912] "Sidebar"="c:program filesWindows Sidebarsidebar.exe" [2010-11-20 1174016] "Skype"="c:program filesSkypePhoneSkype.exe" [2013-10-02 20472992] "Akamai NetSession Interface"="c:usersUserAppDataLocalAkamainetsession_win.exe" [2013-06-04 4489472] . [HKEY_LOCAL_MACHINESOFTWAREMicrosoftWindowsCurrentVersionRun] "BCSSync"="c:program filesMicrosoft OfficeOffice14BCSSync.exe" [2010-03-13 91520] "ZSSnp211"="c:windowsZSSnp211.exe" [2007-04-06 57344] "Google Desktop Search"="c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe" [2011-09-10 30192] "MSC"="c:program filesMicrosoft Security Clientmsseces.exe" [2013-06-20 995176] "IgfxTray"="c:windowssystem32igfxtray.exe" [2012-11-13 138784] "HotKeysCmds"="c:windowssystem32hkcmd.exe" [2012-11-13 172064] "Persistence"="c:windowssystem32igfxpers.exe" [2012-11-13 173600] "SunJavaUpdateSched"="c:program filesCommon FilesJavaJava Updatejusched.exe" [2013-03-12 253816] "LogMeIn Hamachi Ui"="d:downloadsmyНова папкаhamachi-2-ui.exe" [2013-10-01 2345296] . [HKEY_LOCAL_MACHINEsoftwaremicrosoftwindowscurrentversionpoliciessystem] "ConsentPromptBehaviorUser"= 3 (0x3) "EnableUIADesktopToggle"= 0 (0x0) . [HKEY_LOCAL_MACHINEsoftwaremicrosoftwindows ntcurrentversionwindows] "AppInit_DLLs"=c:progra~1GoogleGOOGLE~2GoogleDesktopNetwork3.dll . [HKEY_LOCAL_MACHINESYSTEMCurrentControlSetControlSafeBootMinimalMsMpSvc] @="Service" . [HKLM~startupfolderC:^Users^User^AppData^Roaming^Microsoft^Windows^Start Menu^Programs^Startup^GamersFirst LIVE!.lnk] path=c:usersUserAppDataRoamingMicrosoftWindowsStart MenuProgramsStartupGamersFirst LIVE!.lnk backup=c:windowspssGamersFirst LIVE!.lnk.Startup backupExtension=.Startup . [HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregDomino] 2006-08-18 13:58  49152  ----a-w-  c:windowsDomino.exe . [HKEY_LOCAL_MACHINEsoftwaremicrosoftshared toolsmsconfigstartupregFacebook Update] 2012-07-11 20:44  138096  ----atw-  c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe . R2 SkypeUpdate;Skype Updater;c:program filesSkypeUpdaterUpdater.exe [2013-09-05 171680] R3 dmvsc;dmvsc;c:windowssystem32driversdmvsc.sys [2010-11-20 62464] R3 EagleXNt;EagleXNt;c:windowssystem32driversEagleXNt.sys [x] R3 FairplayKD;FairplayKD;c:programdataMTA San Andreas All1.3tempFairplayKD.sys [x] R3 GoogleDesktopManager-051210-111108;Диспечер на Google Desktop 5.9.1005.12335;c:program filesGoogleGoogle Desktop SearchGoogleDesktop.exe [2011-09-10 30192] R3 NisDrv;Microsoft Network Inspection System;c:windowssystem32DRIVERSNisDrvWFP.sys [2013-06-18 107392] R3 NisSrv;Мрежова проверка на Microsoft;c:program filesMicrosoft Security ClientNisSrv.exe [2013-06-20 295376] R3 RdpVideoMiniport;Remote Desktop Video Miniport Driver;c:windowssystem32driversrdpvideominiport.sys [2010-11-20 15872] R3 Synth3dVsc;Synth3dVsc;c:windowssystem32driverssynth3dvsc.sys [2010-11-20 77184] R3 terminpt;Microsoft Remote Desktop Input Driver;c:windowssystem32driversterminpt.sys [2010-11-20 25600] R3 TsUsbFlt;TsUsbFlt;c:windowssystem32driverstsusbflt.sys [2010-11-20 52224] R3 TsUsbGD;Remote Desktop Generic USB Device;c:windowssystem32driversTsUsbGD.sys [2010-11-20 27264] R3 tsusbhub;tsusbhub;c:windowssystem32driverstsusbhub.sys [2010-11-20 112640] R3 VGPU;VGPU;c:windowssystem32driversrdvgkmd.sys [x] R3 vvftav211;vvftav211;c:windowssystem32driversvvftav211.sys [2007-12-10 480128] R3 WatAdminSvc;Услуга на технологиите за активиране на Windows;c:windowssystem32WatWatAdminSvc.exe [2011-08-05 1343400] R3 WinRing0_1_2_0;WinRing0_1_2_0;d:mcRazer Game BoosterDriverWinRing0.sys [x] R3 XDva394;XDva394;c:windowssystem32XDva394.sys [x] R3 XDva397;XDva397;c:windowssystem32XDva397.sys [x] R3 XDva399;XDva399;c:windowssystem32XDva399.sys [x] R3 XDva401;XDva401;c:windowssystem32XDva401.sys [x] R3 ZSMC30x;USB PC Camera Service ZSMC30x;c:windowssystem32DriversZS211.sys [2007-12-05 1537024] S1 dtsoftbus01;DAEMON Tools Virtual Bus Driver;c:windowssystem32DRIVERSdtsoftbus01.sys [2011-08-05 232512] S1 MpKsl83bfdb04;MpKsl83bfdb04;c:programdataMicrosoftMicrosoft AntimalwareDefinition Updates{22508C58-C50A-41F9-89D2-F57EA351158A}MpKsl83bfdb04.sys [2013-10-10 40392] S2 Hamachi2Svc;LogMeIn Hamachi Tunneling Engine;d:downloadsmyНова папкаhamachi-2.exe [2013-10-01 1612112] S2 RzKLService;RzKLService;d:mcRazer Game BoosterRzKLService.exe [2013-09-18 106472] S2 Skype C2C Service;Skype C2C Service;c:programdataSkypeToolbarsSkype C2C Servicec2c_service.exe [2013-09-16 3273088] S2 TeamViewer8;TeamViewer 8;c:program filesTeamViewerVersion8TeamViewer_Service.exe [2013-08-07 4308320] S3 RTL8167;Realtek 8167 NT Driver;c:windowssystem32DRIVERSRt86win7.sys [2009-03-01 139776] . . [HKEY_LOCAL_MACHINEsoftwaremicrosoftactive setupinstalled components{8A69D345-D564-463c-AFF1-A69D9E530F96}] 2013-10-06 11:22  1185744  ----a-w-  c:program filesGoogleChromeApplication30.0.1599.69Installerchrmstp.exe . Contents of the 'Scheduled Tasks' folder . 2013-10-10 c:windowsTasksAdobe Flash Player Updater.job - c:windowssystem32MacromedFlashFlashPlayerUpdateService.exe [2012-03-30 13:08] . 2013-10-05 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000Core.job - c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44] . 2013-10-10 c:windowsTasksFacebookUpdateTaskUserS-1-5-21-4085356103-2755973423-1490265005-1000UA.job - c:usersUserAppDataLocalFacebookUpdateFacebookUpdate.exe [2012-06-09 20:44] . 2013-10-10 c:windowsTasksGoogleUpdateTaskMachineCore.job - c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14] . 2013-10-10 c:windowsTasksGoogleUpdateTaskMachineUA.job - c:program filesGoogleUpdateGoogleUpdate.exe [2011-08-16 19:14] . . ------- Supplementary Scan ------- . uInternet Settings,ProxyOverride = <local> IE: Download all by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm IE: Download by FlashGet3 - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm IE: E&xport to Microsoft Excel - c:progra~1MICROS~2Office14EXCEL.EXE/3000 IE: Free YouTube Download - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeytvdownloader.htm IE: Free YouTube to MP3 Converter - c:usersUserAppDataRoamingDVDVideoSoftIEHelpersfreeyoutubetomp3converter.htm IE: Se&nd to OneNote - c:progra~1MICROS~2Office14ONBttnIE.dll/105 IE: ????3?? - c:program filesFlashGet NetworkFlashGet 3GetUrl.htm IE: ????3?????? - c:program filesFlashGet NetworkFlashGet 3GetAllUrl.htm FF - ProfilePath - c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.default FF - prefs.js: browser.search.defaulturl - FF - ExtSQL: 2013-09-30 19:10; WebSiteRecommendation@weliketheweb.com; c:usersUserAppDataRoamingMozillaFirefoxProfilesptoklpuh.defaultextensionsWebSiteRecommendation@weliketheweb.com . . --------------------- LOCKED REGISTRY KEYS --------------------- . [HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}Џ] @Allowed: (Read) (RestrictedCode) @="c:Program FilesFlashGet NetworkFlashGet 3GetUrl.htm" "contexts"=dword:00000022 . [HKEY_USERSS-1-5-21-4085356103-2755973423-1490265005-1000SoftwareMicrosoftInternet ExplorerMenuExtO(uл_fЏ3*N}ЏhQиђю”Ґc] @Allowed: (Read) (RestrictedCode) @="c:Program FilesFlashGet NetworkFlashGet 3GetAllUrl.htm" "contexts"=dword:000000f3 . [HKEY_LOCAL_MACHINESYSTEMControlSet001ControlClass{4D36E96D-E325-11CE-BFC1-08002BE10318}0000AllUserSettings] @Denied: (A) (Users) @Denied: (A) (Everyone) @Allowed: (B 1 2 3 4 5) (S-1-5-20) "BlindDial"=dword:00000000 . [HKEY_LOCAL_MACHINESYSTEMControlSet001ControlPCWSecurity] @Denied: (Full) (Everyone) . ------------------------ Other Running Processes ------------------------ . c:program filesMicrosoft Security ClientMsMpEng.exe c:windowssystem32PnkBstrA.exe c:windowssystem32taskhost.exe c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSVC.EXE c:program filesCommon FilesMicrosoft SharedWindows LiveWLIDSvcM.exe d:downloadsmyd:downloadsmyd:downloadsmyd:downloadsmyc:windowssystem32svchost.exe c:windowsSystem32WUDFHost.exe c:windowssystem32conhost.exe c:windowssystem32DllHost.exe c:windowssystem32sppsvc.exe c:program filesWindows Media Playerwmpnetwk.exe c:windowssystem32taskhost.exe . ************************************************************************** . Completion time: 2013-10-10  17:00:57 - machine was rebooted ComboFix-quarantined-files.txt  2013-10-10 14:00 ComboFix2.txt  2013-10-09 13:37 . Pre-Run: 20 357 251 072 bytes free Post-Run: 20 209 168 384 bytes free . - - End Of File - - 393043544EF5FC5DEAE02717291FDDBF A36C5E4F47E84449FF07ED3517B43A31  

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Какво е положението със системата ви след процедурите до тук..? Наблюдавате ли първоначалните проблеми...?

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Системата се държи доста добре.Имам чувството че все едно е преинсталирана .. :)


Радвам се ,че съм бил полезен..! :)



Деинсталирайте ComboFix така:

[*]Натиснете Start ==> Run ==> въведете командата Combofix /Uninstall ==> OK

[*]Публикувано изображение

[*]Моля, следвайте инструкциите, за да деинсталирате ComboFix. Ще получите съобщение, в което се казва ComboFix е деинсталиран успешно.


Публикувано изображение Изтеглете Delfix.exe и го стартирайте. Сложете отметка пред Remove disinfection tools => натиснете бутона Run Инструмента ще се самоизтрие след като приключи своята задача!


Публикувано изображение Деинсталирайте adwcleaner.exe

[*]Моля, затворете всички отворени програми и интернет браузъри.

[*]Кликнете два пъти върху adwcleaner.exe за да стартирате инструмента.

[*]Кликнете върху Uninstall .

[*]Щракнете върху Yes за да деинсталирате Adwcleaner


Публикувано изображение Изтрийте всичко друго което е останало след процедурите (използвано в лечението).Препоръчвам програмата Malwarebytes' Anti-Malware  да остане на вашия компютър и периодично да сканирате системата си с нея (поне един -два пъти в седмицата),като не забравяйте да обновите дефинициите и преди всяко сканиране..!


Стартирайте PatchMyPC и инсталирайте всички ъпдейти, които инструмента ви предложи.


Ако няма други проблеми,маркирам случая за "РЕШЕН"..Бъдете здрави и ви пожелавам безопасен интернет..! :)

  • Харесва ми 2

Сподели този отговор

Линк към този отговор
Сподели в други сайтове

Регистрирайте се или влезете в профила си за да коментирате

Трябва да имате регистрация за да може да коментирате това

Регистрирайте се

Създайте нова регистрация в нашия форум. Лесно е!

Нова регистрация


Имате регистрация? Влезте от тук.


  • Разглеждащи това в момента   0 потребители

    Няма регистрирани потребители разглеждащи тази страница.

  • Горещи теми в момента

  • Подобни теми

    • от rvp
      Проблема е че след рестарт или изключване процесът отива на 100% и трябва да го спирам ръчно. ето логовете:
      Scan result of Farbar Recovery Scan Tool (FRST) (x64) Version: 01.09.2018 03
      Ran by kpacko (administrator) on KPACKO-MOBILEPC (07-09-2018 10:02:30)
      Running from C:\Users\kpacko\Desktop
      Loaded Profiles: kpacko (Available Profiles: kpacko)
      Platform: Windows 7 Ultimate Service Pack 1 (X64) Language: Български (България)
      Internet Explorer Version 11 (Default browser: Chrome)
      Boot Mode: Normal
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      (NVIDIA Corporation) C:\Program Files\NVIDIA Corporation\Display.NvContainer\NVDisplay.Container.exe
      (NVIDIA Corporation) C:\Program Files\NVIDIA Corporation\Display.NvContainer\NVDisplay.Container.exe
      (Microsoft Corporation) C:\Windows\System32\wlanext.exe
      (Apple Inc.) C:\Program Files\Common Files\Apple\Mobile Device Support\AppleMobileDeviceService.exe
      (Apple Inc.) C:\Program Files\Bonjour\mDNSResponder.exe
      (Intel(R) Corporation) C:\Program Files\Intel\WiFi\bin\EvtEng.exe
      (NVIDIA Corporation) C:\Program Files (x86)\NVIDIA Corporation\NvTelemetry\NvTelemetryContainer.exe
      (Intel(R) Corporation) C:\Program Files\Common Files\Intel\WirelessCommon\RegSrvc.exe
      (TeamViewer GmbH) C:\Program Files (x86)\TeamViewer\TeamViewer_Service.exe
      (Intel® Corporation) C:\Program Files\Intel\WiFi\bin\ZeroConfigService.exe
      (Realtek Semiconductor) C:\Program Files\Realtek\Audio\HDA\RtkNGUI64.exe
      (Realtek Semiconductor) C:\Program Files\Realtek\Audio\HDA\RAVBg64.exe
      () C:\Program Files (x86)\STMicroelectronics\AccelerometerP11\FF_Protection.exe
      (Apple Inc.) C:\Program Files\iTunes\iTunesHelper.exe
      (Renesas Electronics Corporation) C:\Program Files (x86)\Renesas Electronics\USB 3.0 Host Controller Driver\Application\nusb3mon.exe
      (Apple Inc.) C:\Program Files\iPod\bin\iPodService.exe
      () C:\Users\kpacko\AppData\Roaming\WinRAR\Precomp\precomp.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [RTHDVCPL] => C:\Program Files\Realtek\Audio\HDA\RtkNGUI64.exe [6611048 2011-02-18] (Realtek Semiconductor)
      HKLM\...\Run: [RtHDVBg] => C:\Program Files\Realtek\Audio\HDA\RAVBg64.exe [2188904 2011-01-18] (Realtek Semiconductor)
      HKLM\...\Run: [FreeFallProtection] => C:\Program Files (x86)\STMicroelectronics\AccelerometerP11\FF_Protection.exe [727664 2010-09-24] ()
      HKLM\...\Run: [iTunesHelper] => C:\Program Files\iTunes\iTunesHelper.exe [298296 2018-07-06] (Apple Inc.)
      HKLM-x32\...\Run: [NUSB3MON] => C:\Program Files (x86)\Renesas Electronics\USB 3.0 Host Controller Driver\Application\nusb3mon.exe [113288 2010-11-17] (Renesas Electronics Corporation)
      HKU\S-1-5-21-2772379611-2548023608-3356451699-1000\...\Run: [DAEMON Tools Lite] => C:\Program Files (x86)\DAEMON Tools Lite\DTLite.exe [3672640 2013-03-14] (Disc Soft Ltd)
      IFEO\LogTransport2.exe: [Debugger] 0
      Startup: C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Startup\Windows.vbs [2018-02-26] ()
      GroupPolicy: Restriction ? <==== ATTENTION
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      Hosts: There are more than one entry in Hosts. See Hosts section of Addition.txt
      Tcpip\Parameters: [DhcpNameServer]
      Tcpip\..\Interfaces\{EDC66EE9-FC63-456B-9263-6FA1362BFECA}: [DhcpNameServer]
      Tcpip\..\Interfaces\{F056F4A9-7DE8-4608-90FE-D6F4B68785AC}: [DhcpNameServer]
      Internet Explorer:
      HKU\S-1-5-21-2772379611-2548023608-3356451699-1000\Software\Microsoft\Internet Explorer\Main,Start Page = about:NewsFeed
      FF Plugin: @microsoft.com/GENUINE -> disabled [No File]
      FF Plugin-x32: @microsoft.com/GENUINE -> disabled [No File]
      FF Plugin-x32: @tools.google.com/Google Update;version=3 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [2018-05-17] (Google Inc.)
      FF Plugin-x32: @tools.google.com/Google Update;version=9 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [2018-05-17] (Google Inc.)
      CHR NewTab: Default ->  Active:"chrome-extension://jpfpebmajhhopeonhlcgidhclcccjcik/newtab.html"
      CHR Session Restore: Default -> is enabled.
      CHR Profile: C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default [2018-09-07]
      CHR Extension: (Презентации) - C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default\Extensions\aapocclcgogkmnckokdopfmhonfmgoek [2017-10-12]
      CHR Extension: (Документи) - C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default\Extensions\aohghmighlieiainnegkcijnfilokake [2017-10-12]
      CHR Extension: (Google Диск) - C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default\Extensions\apdfllckaahabafndbhieahigkjlhalf [2017-09-15]
      CHR Extension: (Auto Copy) - C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default\Extensions\bijpdibkloghppkbmhcklkogpjaenfkg [2018-01-11]
      CHR Extension: (YouTube) - C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default\Extensions\blpcfgokakmgnkcojhhkbfbldkacnbeo [2017-09-15]
      CHR Extension: (Forecastfox (fix version)) - C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default\Extensions\boljdehmejbffnfiiicckjhafabdepnd [2018-08-05]
      CHR Extension: (uBlock Origin) - C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default\Extensions\cjpalhdlnbpafiamejdnhcphjbkeiagm [2018-08-27]
      CHR Extension: (Таблици) - C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default\Extensions\felcaaldnbdncclmgdcncolpebgiejap [2017-10-12]
      CHR Extension: (Google Документи офлайн) - C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default\Extensions\ghbmnnjooekpmoecnnnilnnbdlolhkhi [2018-08-17]
      CHR Extension: (Speed Dial 2 Нов раздел) - C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default\Extensions\jpfpebmajhhopeonhlcgidhclcccjcik [2018-03-28]
      CHR Extension: (Плащания в уеб магазина на Chrome) - C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default\Extensions\nmmhkkegccagdldgiimedpiccmgmieda [2018-04-03]
      CHR Extension: (Gmail) - C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default\Extensions\pjkljhegncpnkpknbcohdijeoejaedia [2017-09-15]
      CHR Extension: (Chrome Media Router) - C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\Default\Extensions\pkedcjkdefgpdelpbcmbmeomcjbeemfm [2018-09-07]
      CHR Profile: C:\Users\kpacko\AppData\Local\Google\Chrome\User Data\System Profile [2018-04-26]
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      S4 AGSService; C:\Program Files (x86)\Common Files\Adobe\AdobeGCClient\AGSService.exe [2227312 2017-02-27] (Adobe Systems, Incorporated)
      R2 Apple Mobile Device Service; C:\Program Files\Common Files\Apple\Mobile Device Support\AppleMobileDeviceService.exe [83768 2018-07-05] (Apple Inc.)
      S3 MyWiFiDHCPDNS; C:\Program Files\Intel\WiFi\bin\PanDhcpDns.exe [268704 2016-04-04] ()
      R2 TeamViewer; C:\Program Files (x86)\TeamViewer\TeamViewer_Service.exe [11644656 2018-08-13] (TeamViewer GmbH)
      R2 WinDefend; C:\Program Files\Windows Defender\mpsvc.dll [1011712 2017-07-17] (Microsoft Corporation)
      R2 ZeroConfigService; C:\Program Files\Intel\WiFi\bin\ZeroConfigService.exe [3833248 2016-04-04] (Intel® Corporation)
      R2 NVDisplay.ContainerLocalSystem; "C:\Program Files\NVIDIA Corporation\Display.NvContainer\NVDisplay.Container.exe" -s NVDisplay.ContainerLocalSystem -f "C:\ProgramData\NVIDIA\NVDisplay.ContainerLocalSystem.log" -l 3 -d "C:\Program Files\NVIDIA Corporation\Display.NvContainer\plugins\LocalSystem" -r -p 30000
      R2 NvTelemetryContainer; "C:\Program Files (x86)\NVIDIA Corporation\NvTelemetry\NvTelemetryContainer.exe" -s NvTelemetryContainer -f "C:\ProgramData\NVIDIA\NvTelemetryContainer.log" -l 3 -d "C:\Program Files (x86)\NVIDIA Corporation\NvTelemetry\plugins" -r
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      S3 CisUtMonitor; C:\Windows\System32\DRIVERS\CisUtMonitor.sys [54192 2017-07-04] (CrystalIdea Software)
      R1 dtsoftbus01; C:\Windows\System32\DRIVERS\dtsoftbus01.sys [283200 2017-09-16] (DT Soft Ltd)
      R0 iaStorF; C:\Windows\System32\DRIVERS\iaStorF.sys [28216 2012-12-11] (Intel Corporation)
      R3 nvvad_WaveExtensible; C:\Windows\System32\drivers\nvvad64v.sys [59240 2018-03-16] (NVIDIA Corporation)
      U4 AdobeARMservice; no ImagePath
      U3 SwitchBoard; no ImagePath
      S3 VGPU; System32\drivers\rdvgkmd.sys [X]
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-09-07 10:02 - 2018-09-07 10:03 - 000009284 _____ C:\Users\kpacko\Desktop\FRST.txt
      2018-09-07 10:02 - 2018-09-07 10:02 - 000000000 ____D C:\FRST
      2018-09-07 10:01 - 2018-09-07 10:01 - 002413056 _____ (Farbar) C:\Users\kpacko\Desktop\FRST64.exe
      2018-09-06 22:25 - 2018-09-06 13:48 - 000083968 _____ C:\Users\kpacko\Desktop\Working_Schedule_01-10_Sep_Update_4.xls
      2018-09-04 00:43 - 2018-08-03 18:55 - 000109568 _____ (Microsoft Corporation) C:\Windows\system32\hlink.dll
      2018-09-04 00:43 - 2018-08-02 06:18 - 000096864 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ksecdd.sys
      2018-09-04 00:43 - 2018-08-02 06:07 - 000263776 _____ (Microsoft Corporation) C:\Windows\system32\hal.dll
      2018-09-04 00:43 - 2018-08-02 06:02 - 001665320 _____ (Microsoft Corporation) C:\Windows\system32\ntdll.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000503808 _____ (Microsoft Corporation) C:\Windows\system32\srcore.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000361984 _____ (Microsoft Corporation) C:\Windows\system32\wow64win.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000345600 _____ (Microsoft Corporation) C:\Windows\system32\schannel.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000316928 _____ (Microsoft Corporation) C:\Windows\system32\msv1_0.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000312320 _____ (Microsoft Corporation) C:\Windows\system32\ncrypt.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000243712 _____ (Microsoft Corporation) C:\Windows\system32\wow64.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000215552 _____ (Microsoft Corporation) C:\Windows\system32\winsrv.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000210432 _____ (Microsoft Corporation) C:\Windows\system32\wdigest.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000190464 _____ (Microsoft Corporation) C:\Windows\system32\rpchttp.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000135680 _____ (Microsoft Corporation) C:\Windows\system32\sspicli.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000094208 _____ (Microsoft Corporation) C:\Windows\system32\TSpkg.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000063488 _____ (Microsoft Corporation) C:\Windows\system32\setbcdlocale.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000050176 _____ (Microsoft Corporation) C:\Windows\system32\srclient.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000028672 _____ (Microsoft Corporation) C:\Windows\system32\sspisrv.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000028160 _____ (Microsoft Corporation) C:\Windows\system32\secur32.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000016384 _____ (Microsoft Corporation) C:\Windows\system32\ntvdm64.dll
      2018-09-04 00:43 - 2018-08-02 05:59 - 000013312 _____ (Microsoft Corporation) C:\Windows\system32\wow64cpu.dll
      2018-09-04 00:43 - 2018-08-02 05:58 - 001163264 _____ (Microsoft Corporation) C:\Windows\system32\kernel32.dll
      2018-09-04 00:43 - 2018-08-02 05:58 - 000463872 _____ (Microsoft Corporation) C:\Windows\system32\certcli.dll
      2018-09-04 00:43 - 2018-08-02 05:58 - 000419840 _____ (Microsoft Corporation) C:\Windows\system32\KernelBase.dll
      2018-09-04 00:43 - 2018-08-02 05:58 - 000044032 _____ (Microsoft Corporation) C:\Windows\system32\csrsrv.dll
      2018-09-04 00:43 - 2018-08-02 05:58 - 000043520 _____ (Microsoft Corporation) C:\Windows\system32\cryptbase.dll
      2018-09-04 00:43 - 2018-08-02 05:58 - 000022016 _____ (Microsoft Corporation) C:\Windows\system32\credssp.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000123904 _____ (Microsoft Corporation) C:\Windows\system32\bcrypt.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000059904 _____ (Microsoft Corporation) C:\Windows\system32\appidapi.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000034816 _____ (Microsoft Corporation) C:\Windows\system32\appidsvc.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000007168 _____ (Microsoft Corporation) C:\Windows\system32\apisetschema.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000006144 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-security-base-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000005120 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-file-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000004608 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-threadpool-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000004608 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-processthreads-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-sysinfo-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-synch-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-localregistry-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-localization-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-rtlsupport-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-processenvironment-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-namedpipe-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-misc-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-memory-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-libraryloader-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-heap-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-xstate-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-util-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-string-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-profile-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-io-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-interlocked-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-handle-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-fibers-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-errorhandling-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-delayload-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-debug-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-datetime-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:57 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-console-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:45 - 004054192 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntkrnlpa.exe
      2018-09-04 00:43 - 2018-08-02 05:45 - 003959984 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntoskrnl.exe
      2018-09-04 00:43 - 2018-08-02 05:43 - 001315512 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntdll.dll
      2018-09-04 00:43 - 2018-08-02 05:42 - 001114112 _____ (Microsoft Corporation) C:\Windows\SysWOW64\kernel32.dll
      2018-09-04 00:43 - 2018-08-02 05:42 - 000666112 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rpcrt4.dll
      2018-09-04 00:43 - 2018-08-02 05:42 - 000275456 _____ (Microsoft Corporation) C:\Windows\SysWOW64\KernelBase.dll
      2018-09-04 00:43 - 2018-08-02 05:42 - 000096768 _____ (Microsoft Corporation) C:\Windows\SysWOW64\sspicli.dll
      2018-09-04 00:43 - 2018-08-02 05:42 - 000082944 _____ (Microsoft Corporation) C:\Windows\SysWOW64\bcrypt.dll
      2018-09-04 00:43 - 2018-08-02 05:42 - 000005120 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wow32.dll
      2018-09-04 00:43 - 2018-08-02 05:41 - 000554496 _____ (Microsoft Corporation) C:\Windows\SysWOW64\kerberos.dll
      2018-09-04 00:43 - 2018-08-02 05:41 - 000261120 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msv1_0.dll
      2018-09-04 00:43 - 2018-08-02 05:41 - 000254464 _____ (Microsoft Corporation) C:\Windows\SysWOW64\schannel.dll
      2018-09-04 00:43 - 2018-08-02 05:41 - 000223232 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ncrypt.dll
      2018-09-04 00:43 - 2018-08-02 05:41 - 000172032 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wdigest.dll
      2018-09-04 00:43 - 2018-08-02 05:41 - 000141312 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rpchttp.dll
      2018-09-04 00:43 - 2018-08-02 05:41 - 000070144 _____ (Microsoft Corporation) C:\Windows\SysWOW64\TSpkg.dll
      2018-09-04 00:43 - 2018-08-02 05:41 - 000022016 _____ (Microsoft Corporation) C:\Windows\SysWOW64\secur32.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000644096 _____ (Microsoft Corporation) C:\Windows\SysWOW64\advapi32.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000342528 _____ (Microsoft Corporation) C:\Windows\SysWOW64\certcli.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000050688 _____ (Microsoft Corporation) C:\Windows\SysWOW64\appidapi.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000017408 _____ (Microsoft Corporation) C:\Windows\SysWOW64\credssp.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000007168 _____ (Microsoft Corporation) C:\Windows\SysWOW64\apisetschema.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000005120 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-file-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000004608 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-processthreads-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-sysinfo-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-synch-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-misc-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-localregistry-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000004096 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-localization-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-processenvironment-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-namedpipe-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-memory-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-libraryloader-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-interlocked-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-heap-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-string-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-rtlsupport-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-profile-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-io-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-handle-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-fibers-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-errorhandling-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-delayload-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-debug-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-datetime-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:40 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-console-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:26 - 000148480 _____ (Microsoft Corporation) C:\Windows\system32\appidpolicyconverter.exe
      2018-09-04 00:43 - 2018-08-02 05:26 - 000062464 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\appid.sys
      2018-09-04 00:43 - 2018-08-02 05:26 - 000017920 _____ (Microsoft Corporation) C:\Windows\system32\appidcertstorecheck.exe
      2018-09-04 00:43 - 2018-08-02 05:25 - 000064512 _____ (Microsoft Corporation) C:\Windows\system32\auditpol.exe
      2018-09-04 00:43 - 2018-08-02 05:22 - 000338432 _____ (Microsoft Corporation) C:\Windows\system32\conhost.exe
      2018-09-04 00:43 - 2018-08-02 05:21 - 000296960 _____ (Microsoft Corporation) C:\Windows\system32\rstrui.exe
      2018-09-04 00:43 - 2018-08-02 05:21 - 000129536 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\videoprt.sys
      2018-09-04 00:43 - 2018-08-02 05:17 - 000291328 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mrxsmb10.sys
      2018-09-04 00:43 - 2018-08-02 05:17 - 000160256 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mrxsmb.sys
      2018-09-04 00:43 - 2018-08-02 05:17 - 000129536 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mrxsmb20.sys
      2018-09-04 00:43 - 2018-08-02 05:16 - 000112640 _____ (Microsoft Corporation) C:\Windows\system32\smss.exe
      2018-09-04 00:43 - 2018-08-02 05:16 - 000064512 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\amdk8.sys
      2018-09-04 00:43 - 2018-08-02 05:16 - 000062464 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\intelppm.sys
      2018-09-04 00:43 - 2018-08-02 05:16 - 000060928 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\processr.sys
      2018-09-04 00:43 - 2018-08-02 05:16 - 000060928 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\amdppm.sys
      2018-09-04 00:43 - 2018-08-02 05:16 - 000050688 _____ (Microsoft Corporation) C:\Windows\SysWOW64\auditpol.exe
      2018-09-04 00:43 - 2018-08-02 05:16 - 000030720 _____ (Microsoft Corporation) C:\Windows\system32\lsass.exe
      2018-09-04 00:43 - 2018-08-02 05:11 - 000025600 _____ (Microsoft Corporation) C:\Windows\SysWOW64\setup16.exe
      2018-09-04 00:43 - 2018-08-02 05:11 - 000014336 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ntvdm64.dll
      2018-09-04 00:43 - 2018-08-02 05:11 - 000007680 _____ (Microsoft Corporation) C:\Windows\SysWOW64\instnm.exe
      2018-09-04 00:43 - 2018-08-02 05:11 - 000002048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\user.exe
      2018-09-04 00:43 - 2018-08-02 05:10 - 000036352 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cryptbase.dll
      2018-09-04 00:43 - 2018-08-02 05:10 - 000006144 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-security-base-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:10 - 000004608 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-threadpool-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:10 - 000003584 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-xstate-l1-1-0.dll
      2018-09-04 00:43 - 2018-08-02 05:10 - 000003072 ____H (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-util-l1-1-0.dll
      2018-09-04 00:43 - 2018-07-20 02:53 - 000396936 _____ (Microsoft Corporation) C:\Windows\system32\iedkcs32.dll
      2018-09-04 00:43 - 2018-07-20 01:58 - 000350272 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iedkcs32.dll
      2018-09-04 00:43 - 2018-07-19 07:48 - 002724864 _____ (Microsoft Corporation) C:\Windows\system32\mshtml.tlb
      2018-09-04 00:43 - 2018-07-19 07:47 - 000004096 _____ (Microsoft Corporation) C:\Windows\system32\ieetwcollectorres.dll
      2018-09-04 00:43 - 2018-07-19 07:35 - 002902016 _____ (Microsoft Corporation) C:\Windows\system32\iertutil.dll
      2018-09-04 00:43 - 2018-07-19 07:34 - 000066560 _____ (Microsoft Corporation) C:\Windows\system32\iesetup.dll
      2018-09-04 00:43 - 2018-07-19 07:33 - 000576512 _____ (Microsoft Corporation) C:\Windows\system32\vbscript.dll
      2018-09-04 00:43 - 2018-07-19 07:33 - 000417280 _____ (Microsoft Corporation) C:\Windows\system32\html.iec
      2018-09-04 00:43 - 2018-07-19 07:33 - 000048640 _____ (Microsoft Corporation) C:\Windows\system32\ieetwproxystub.dll
      2018-09-04 00:43 - 2018-07-19 07:32 - 000088064 _____ (Microsoft Corporation) C:\Windows\system32\MshtmlDac.dll
      2018-09-04 00:43 - 2018-07-19 07:30 - 005778432 _____ (Microsoft Corporation) C:\Windows\system32\jscript9.dll
      2018-09-04 00:43 - 2018-07-19 07:26 - 000054784 _____ (Microsoft Corporation) C:\Windows\system32\jsproxy.dll
      2018-09-04 00:43 - 2018-07-19 07:25 - 000034304 _____ (Microsoft Corporation) C:\Windows\system32\iernonce.dll
      2018-09-04 00:43 - 2018-07-19 07:23 - 000615936 _____ (Microsoft Corporation) C:\Windows\system32\ieui.dll
      2018-09-04 00:43 - 2018-07-19 07:22 - 020286464 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mshtml.dll
      2018-09-04 00:43 - 2018-07-19 07:22 - 000794624 _____ (Microsoft Corporation) C:\Windows\system32\jscript.dll
      2018-09-04 00:43 - 2018-07-19 07:22 - 000144384 _____ (Microsoft Corporation) C:\Windows\system32\ieUnatt.exe
      2018-09-04 00:43 - 2018-07-19 07:22 - 000116224 _____ (Microsoft Corporation) C:\Windows\system32\ieetwcollector.exe
      2018-09-04 00:43 - 2018-07-19 07:21 - 000814080 _____ (Microsoft Corporation) C:\Windows\system32\jscript9diag.dll
      2018-09-04 00:43 - 2018-07-19 07:16 - 002724864 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mshtml.tlb
      2018-09-04 00:43 - 2018-07-19 07:14 - 000969216 _____ (Microsoft Corporation) C:\Windows\system32\MsSpellCheckingFacility.exe
      2018-09-04 00:43 - 2018-07-19 07:11 - 000489984 _____ (Microsoft Corporation) C:\Windows\system32\dxtmsft.dll
      2018-09-04 00:43 - 2018-07-19 07:05 - 000497664 _____ (Microsoft Corporation) C:\Windows\SysWOW64\vbscript.dll
      2018-09-04 00:43 - 2018-07-19 07:05 - 000077824 _____ (Microsoft Corporation) C:\Windows\system32\JavaScriptCollectionAgent.dll
      2018-09-04 00:43 - 2018-07-19 07:04 - 000341504 _____ (Microsoft Corporation) C:\Windows\SysWOW64\html.iec
      2018-09-04 00:43 - 2018-07-19 07:04 - 000087552 _____ (Microsoft Corporation) C:\Windows\system32\tdc.ocx
      2018-09-04 00:43 - 2018-07-19 07:04 - 000062464 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iesetup.dll
      2018-09-04 00:43 - 2018-07-19 07:03 - 000107520 _____ (Microsoft Corporation) C:\Windows\system32\inseng.dll
      2018-09-04 00:43 - 2018-07-19 07:03 - 000064000 _____ (Microsoft Corporation) C:\Windows\SysWOW64\MshtmlDac.dll
      2018-09-04 00:43 - 2018-07-19 07:01 - 002295808 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iertutil.dll
      2018-09-04 00:43 - 2018-07-19 07:00 - 000199680 _____ (Microsoft Corporation) C:\Windows\system32\msrating.dll
      2018-09-04 00:43 - 2018-07-19 07:00 - 000092160 _____ (Microsoft Corporation) C:\Windows\system32\mshtmled.dll
      2018-09-04 00:43 - 2018-07-19 06:58 - 000315392 _____ (Microsoft Corporation) C:\Windows\system32\dxtrans.dll
      2018-09-04 00:43 - 2018-07-19 06:58 - 000047104 _____ (Microsoft Corporation) C:\Windows\SysWOW64\jsproxy.dll
      2018-09-04 00:43 - 2018-07-19 06:57 - 000030720 _____ (Microsoft Corporation) C:\Windows\SysWOW64\iernonce.dll
      2018-09-04 00:43 - 2018-07-19 06:56 - 000476160 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieui.dll
      2018-09-04 00:43 - 2018-07-19 06:56 - 000152064 _____ (Microsoft Corporation) C:\Windows\system32\occache.dll
      2018-09-04 00:43 - 2018-07-19 06:55 - 000662016 _____ (Microsoft Corporation) C:\Windows\SysWOW64\jscript.dll
      2018-09-04 00:43 - 2018-07-19 06:55 - 000115712 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieUnatt.exe
      2018-09-04 00:43 - 2018-07-19 06:54 - 000620032 _____ (Microsoft Corporation) C:\Windows\SysWOW64\jscript9diag.dll
      2018-09-04 00:43 - 2018-07-19 06:47 - 000262144 _____ (Microsoft Corporation) C:\Windows\system32\webcheck.dll
      2018-09-04 00:43 - 2018-07-19 06:46 - 015283712 _____ (Microsoft Corporation) C:\Windows\system32\ieframe.dll
      2018-09-04 00:43 - 2018-07-19 06:46 - 000416256 _____ (Microsoft Corporation) C:\Windows\SysWOW64\dxtmsft.dll
      2018-09-04 00:43 - 2018-07-19 06:45 - 000809472 _____ (Microsoft Corporation) C:\Windows\system32\msfeeds.dll
      2018-09-04 00:43 - 2018-07-19 06:45 - 000728064 _____ (Microsoft Corporation) C:\Windows\system32\ie4uinit.exe
      2018-09-04 00:43 - 2018-07-19 06:43 - 002136064 _____ (Microsoft Corporation) C:\Windows\system32\inetcpl.cpl
      2018-09-04 00:43 - 2018-07-19 06:43 - 001359360 _____ (Microsoft Corporation) C:\Windows\system32\mshtmlmedia.dll
      2018-09-04 00:43 - 2018-07-19 06:42 - 000060416 _____ (Microsoft Corporation) C:\Windows\SysWOW64\JavaScriptCollectionAgent.dll
      2018-09-04 00:43 - 2018-07-19 06:41 - 000091136 _____ (Microsoft Corporation) C:\Windows\SysWOW64\inseng.dll
      2018-09-04 00:43 - 2018-07-19 06:41 - 000073216 _____ (Microsoft Corporation) C:\Windows\SysWOW64\tdc.ocx
      2018-09-04 00:43 - 2018-07-19 06:39 - 000168960 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msrating.dll
      2018-09-04 00:43 - 2018-07-19 06:38 - 000076288 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mshtmled.dll
      2018-09-04 00:43 - 2018-07-19 06:37 - 000279040 _____ (Microsoft Corporation) C:\Windows\SysWOW64\dxtrans.dll
      2018-09-04 00:43 - 2018-07-19 06:35 - 000130048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\occache.dll
      2018-09-04 00:43 - 2018-07-19 06:32 - 004494848 _____ (Microsoft Corporation) C:\Windows\SysWOW64\jscript9.dll
      2018-09-04 00:43 - 2018-07-19 06:31 - 004510720 _____ (Microsoft Corporation) C:\Windows\system32\wininet.dll
      2018-09-04 00:43 - 2018-07-19 06:30 - 000230400 _____ (Microsoft Corporation) C:\Windows\SysWOW64\webcheck.dll
      2018-09-04 00:43 - 2018-07-19 06:28 - 013679616 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieframe.dll
      2018-09-04 00:43 - 2018-07-19 06:28 - 002059776 _____ (Microsoft Corporation) C:\Windows\SysWOW64\inetcpl.cpl
      2018-09-04 00:43 - 2018-07-19 06:28 - 000696320 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msfeeds.dll
      2018-09-04 00:43 - 2018-07-19 06:27 - 001155072 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mshtmlmedia.dll
      2018-09-04 00:43 - 2018-07-19 06:20 - 001554944 _____ (Microsoft Corporation) C:\Windows\system32\urlmon.dll
      2018-09-04 00:43 - 2018-07-19 06:09 - 004037632 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wininet.dll
      2018-09-04 00:43 - 2018-07-19 06:09 - 000800768 _____ (Microsoft Corporation) C:\Windows\system32\ieapfltr.dll
      2018-09-04 00:43 - 2018-07-19 06:06 - 001329152 _____ (Microsoft Corporation) C:\Windows\SysWOW64\urlmon.dll
      2018-09-04 00:43 - 2018-07-19 06:04 - 000710144 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieapfltr.dll
      2018-09-04 00:43 - 2018-07-13 22:19 - 001894080 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\tcpip.sys
      2018-09-04 00:43 - 2018-07-13 22:19 - 000377024 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\netio.sys
      2018-09-04 00:43 - 2018-07-13 22:19 - 000287936 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\FWPKCLNT.SYS
      2018-09-04 00:43 - 2018-07-08 19:08 - 000383680 _____ (Adobe Systems Incorporated) C:\Windows\system32\atmfd.dll
      2018-09-04 00:43 - 2018-07-08 19:02 - 000041472 _____ (Microsoft Corporation) C:\Windows\system32\lpk.dll
      2018-09-04 00:43 - 2018-07-08 19:01 - 000014336 _____ (Microsoft Corporation) C:\Windows\system32\dciman32.dll
      2018-09-04 00:43 - 2018-07-08 18:47 - 000309440 _____ (Adobe Systems Incorporated) C:\Windows\SysWOW64\atmfd.dll
      2018-09-04 00:43 - 2018-07-08 18:42 - 000025600 _____ (Microsoft Corporation) C:\Windows\SysWOW64\lpk.dll
      2018-09-04 00:43 - 2018-07-06 19:09 - 000947904 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ndis.sys
      2018-09-04 00:43 - 2018-07-06 19:03 - 000008192 _____ (Microsoft Corporation) C:\Windows\system32\msimg32.dll
      2018-09-04 00:43 - 2018-07-06 18:48 - 000004608 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msimg32.dll
      2018-09-04 00:43 - 2018-06-29 18:55 - 000695808 _____ (Microsoft Corporation) C:\Windows\system32\cscsvc.dll
      2018-09-04 00:43 - 2018-06-29 18:55 - 000045568 _____ (Microsoft Corporation) C:\Windows\system32\cscapi.dll
      2018-09-04 00:43 - 2018-06-29 18:55 - 000030208 _____ (Microsoft Corporation) C:\Windows\system32\cscdll.dll
      2018-09-04 00:43 - 2018-06-29 18:40 - 000023040 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cscdll.dll
      2018-09-04 00:43 - 2018-06-29 18:14 - 000516096 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\csc.sys
      2018-09-04 00:43 - 2018-06-29 18:09 - 000034304 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cscapi.dll
      2018-09-04 00:43 - 2018-06-27 19:01 - 000114368 _____ (Microsoft Corporation) C:\Windows\system32\consent.exe
      2018-09-04 00:43 - 2018-06-27 18:55 - 000504320 _____ (Microsoft Corporation) C:\Windows\system32\msihnd.dll
      2018-09-04 00:43 - 2018-06-27 18:55 - 000484864 _____ (Microsoft Corporation) C:\Windows\system32\StructuredQuery.dll
      2018-09-04 00:43 - 2018-06-27 18:54 - 001942016 _____ (Microsoft Corporation) C:\Windows\system32\authui.dll
      2018-09-04 00:43 - 2018-06-27 18:54 - 000070144 _____ (Microsoft Corporation) C:\Windows\system32\appinfo.dll
      2018-09-04 00:43 - 2018-06-27 18:43 - 000363520 _____ (Microsoft Corporation) C:\Windows\SysWOW64\StructuredQuery.dll
      2018-09-04 00:43 - 2018-06-27 18:42 - 002366464 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msi.dll
      2018-09-04 00:43 - 2018-06-27 18:42 - 000337408 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msihnd.dll
      2018-09-04 00:43 - 2018-06-27 18:41 - 001806848 _____ (Microsoft Corporation) C:\Windows\SysWOW64\authui.dll
      2018-09-04 00:43 - 2018-06-27 18:21 - 000128512 _____ (Microsoft Corporation) C:\Windows\system32\msiexec.exe
      2018-09-04 00:43 - 2018-06-27 18:16 - 000073216 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msiexec.exe
      2018-09-04 00:43 - 2018-06-16 08:11 - 000467856 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\cng.sys
      2018-09-04 00:43 - 2018-06-13 19:20 - 014185984 _____ (Microsoft Corporation) C:\Windows\system32\shell32.dll
      2018-09-04 00:43 - 2018-06-13 19:19 - 001867776 _____ (Microsoft Corporation) C:\Windows\system32\ExplorerFrame.dll
      2018-09-04 00:43 - 2018-06-13 18:55 - 012880384 _____ (Microsoft Corporation) C:\Windows\SysWOW64\shell32.dll
      2018-09-04 00:43 - 2018-06-13 18:54 - 001499648 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ExplorerFrame.dll
      2018-09-04 00:43 - 2018-06-08 19:21 - 000369664 _____ (Microsoft Corporation) C:\Windows\system32\zipfldr.dll
      2018-09-04 00:43 - 2018-06-08 19:20 - 000512000 _____ (Microsoft Corporation) C:\Windows\system32\rpcss.dll
      2018-09-04 00:43 - 2018-06-08 19:19 - 000357888 _____ (Microsoft Corporation) C:\Windows\system32\dnsapi.dll
      2018-09-04 00:43 - 2018-06-08 19:19 - 000182272 _____ (Microsoft Corporation) C:\Windows\system32\dnsrslvr.dll
      2018-09-04 00:43 - 2018-06-08 19:19 - 000008704 _____ (Microsoft Corporation) C:\Windows\system32\comcat.dll
      2018-09-04 00:43 - 2018-06-08 18:55 - 001417728 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ole32.dll
      2018-09-04 00:43 - 2018-06-08 18:55 - 000330240 _____ (Microsoft Corporation) C:\Windows\SysWOW64\zipfldr.dll
      2018-09-04 00:43 - 2018-06-08 18:54 - 000269824 _____ (Microsoft Corporation) C:\Windows\SysWOW64\dnsapi.dll
      2018-09-04 00:43 - 2018-06-08 18:29 - 000007168 _____ (Microsoft Corporation) C:\Windows\SysWOW64\comcat.dll
      2018-09-04 00:43 - 2018-06-07 19:19 - 000749568 _____ (Microsoft Corporation) C:\Windows\system32\FirewallAPI.dll
      2018-09-04 00:43 - 2018-06-07 18:57 - 000463360 _____ (Microsoft Corporation) C:\Windows\SysWOW64\FirewallAPI.dll
      2018-09-04 00:43 - 2018-06-07 18:49 - 000077312 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mpsdrv.sys
      2018-09-04 00:43 - 2018-06-07 18:34 - 000018944 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wfapigp.dll
      2018-09-04 00:43 - 2018-05-15 06:44 - 000206848 _____ (Microsoft Corporation) C:\Windows\system32\mfps.dll
      2018-09-04 00:43 - 2018-05-15 06:24 - 000055808 _____ (Microsoft Corporation) C:\Windows\system32\rrinstaller.exe
      2018-09-04 00:43 - 2018-05-15 06:23 - 000024576 _____ (Microsoft Corporation) C:\Windows\system32\mfpmp.exe
      2018-09-04 00:43 - 2018-05-15 06:13 - 003207168 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mf.dll
      2018-09-04 00:43 - 2018-05-15 06:13 - 000782848 _____ (Microsoft Corporation) C:\Windows\SysWOW64\webservices.dll
      2018-09-04 00:43 - 2018-05-15 06:13 - 000103424 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mfps.dll
      2018-09-04 00:43 - 2018-05-15 06:01 - 000050176 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rrinstaller.exe
      2018-09-04 00:43 - 2018-05-15 06:01 - 000023040 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mfpmp.exe
      2018-09-04 00:43 - 2018-05-12 05:07 - 000076800 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\hidclass.sys
      2018-09-04 00:43 - 2018-05-12 05:07 - 000033152 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\hidparse.sys
      2018-09-04 00:43 - 2018-05-12 05:07 - 000030208 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\hidusb.sys
      2018-09-04 00:43 - 2018-05-12 00:19 - 000084480 _____ (Microsoft Corporation) C:\Windows\system32\INETRES.dll
      2018-09-04 00:43 - 2018-05-11 03:40 - 000741888 _____ (Microsoft Corporation) C:\Windows\SysWOW64\inetcomm.dll
      2018-09-04 00:43 - 2018-05-11 03:40 - 000084480 _____ (Microsoft Corporation) C:\Windows\SysWOW64\INETRES.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000998912 _____ (Microsoft Corporation) C:\Windows\system32\ucrtbase.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000918296 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ucrtbase.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000065880 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-private-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000063832 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-private-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000021848 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-math-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000020824 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-math-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000019288 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-multibyte-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000018776 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-multibyte-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000017752 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-string-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000017752 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-stdio-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000017240 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-string-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000017240 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-stdio-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000016216 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-runtime-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000015704 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-runtime-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000015704 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-convert-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000015192 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-convert-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000014168 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-time-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000014168 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-localization-l1-2-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000013656 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-time-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000013656 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-localization-l1-2-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000013656 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-filesystem-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000013152 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-filesystem-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000012640 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-conio-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000012632 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-process-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000012120 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-process-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000012120 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-conio-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000012120 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-utility-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000012120 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-locale-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000012120 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-heap-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000012120 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-crt-environment-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000012120 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-synch-l1-2-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000012120 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-processthreads-l1-1-1.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011608 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-utility-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011608 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-locale-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011608 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-heap-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011608 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-crt-environment-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011608 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-synch-l1-2-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011608 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-processthreads-l1-1-1.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011608 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-xstate-l2-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011608 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-timezone-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011608 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-file-l2-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011608 _____ (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-file-l1-2-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011096 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-xstate-l2-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011096 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-timezone-l1-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011096 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-file-l2-1-0.dll
      2018-09-04 00:43 - 2018-04-26 16:05 - 000011096 _____ (Microsoft Corporation) C:\Windows\SysWOW64\api-ms-win-core-file-l1-2-0.dll
      2018-09-04 00:43 - 2018-04-25 19:02 - 000124416 _____ (Microsoft Corporation) C:\Windows\system32\wkssvc.dll
      2018-09-04 00:43 - 2018-04-25 18:18 - 000115200 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\dfsc.sys
      2018-09-04 00:43 - 2018-04-23 02:40 - 000582144 _____ (Microsoft Corporation) C:\Windows\SysWOW64\oleaut32.dll
      2018-09-04 00:43 - 2018-04-18 19:03 - 000701952 _____ (Microsoft Corporation) C:\Windows\system32\hhctrl.ocx
      2018-09-04 00:43 - 2018-04-18 19:03 - 000053248 _____ (Microsoft Corporation) C:\Windows\system32\hhsetup.dll
      2018-09-04 00:43 - 2018-04-18 18:51 - 000523776 _____ (Microsoft Corporation) C:\Windows\SysWOW64\hhctrl.ocx
      2018-09-04 00:43 - 2018-04-18 18:51 - 000043008 _____ (Microsoft Corporation) C:\Windows\SysWOW64\hhsetup.dll
      2018-09-04 00:43 - 2018-04-18 18:41 - 000016896 _____ (Microsoft Corporation) C:\Windows\hh.exe
      2018-09-04 00:43 - 2018-04-18 18:35 - 000015360 _____ (Microsoft Corporation) C:\Windows\SysWOW64\hh.exe
      2018-09-04 00:43 - 2018-04-11 19:38 - 000194048 _____ (Microsoft Corporation) C:\Windows\system32\itircl.dll
      2018-09-04 00:43 - 2018-04-11 19:36 - 000158720 _____ (Microsoft Corporation) C:\Windows\SysWOW64\itircl.dll
      2018-09-04 00:43 - 2018-04-10 19:36 - 000236032 _____ (Microsoft Corporation) C:\Windows\system32\srvsvc.dll
      2018-09-04 00:43 - 2018-04-10 19:36 - 000013312 _____ (Microsoft Corporation) C:\Windows\system32\sscore.dll
      2018-09-04 00:43 - 2018-04-10 19:34 - 000525824 _____ (Microsoft Corporation) C:\Windows\system32\catsrvut.dll
      2018-09-04 00:43 - 2018-04-10 19:33 - 001241600 _____ (Microsoft Corporation) C:\Windows\SysWOW64\comsvcs.dll
      2018-09-04 00:43 - 2018-04-10 19:32 - 000487936 _____ (Microsoft Corporation) C:\Windows\SysWOW64\catsrvut.dll
      2018-09-04 00:43 - 2018-04-10 19:00 - 000009728 _____ (Microsoft Corporation) C:\Windows\SysWOW64\sscore.dll
      2018-09-04 00:43 - 2018-04-10 18:48 - 000464384 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\srv.sys
      2018-09-04 00:43 - 2018-04-10 18:47 - 000406016 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\srv2.sys
      2018-09-04 00:43 - 2018-04-10 18:47 - 000169984 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\srvnet.sys
      2018-09-04 00:43 - 2018-04-07 19:41 - 000371392 _____ (Microsoft Corporation) C:\Windows\system32\clfs.sys
      2018-09-04 00:43 - 2018-03-14 20:16 - 000174080 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wuwebv.dll
      2018-09-04 00:43 - 2018-03-14 20:12 - 003165184 _____ (Microsoft Corporation) C:\Windows\system32\wucltux.dll
      2018-09-04 00:43 - 2018-03-14 20:12 - 000192512 _____ (Microsoft Corporation) C:\Windows\system32\wuwebv.dll
      2018-09-04 00:43 - 2018-03-14 20:12 - 000098816 _____ (Microsoft Corporation) C:\Windows\system32\wudriver.dll
      2018-09-04 00:43 - 2018-03-14 20:07 - 000091136 _____ (Microsoft Corporation) C:\Windows\system32\WinSetupUI.dll
      2018-09-04 00:43 - 2018-03-14 19:57 - 000573440 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wuapi.dll
      2018-09-04 00:43 - 2018-03-14 19:57 - 000093696 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wudriver.dll
      2018-09-04 00:43 - 2018-03-14 19:57 - 000035328 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wuapp.exe
      2018-09-04 00:43 - 2018-03-14 19:57 - 000030208 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wups.dll
      2018-09-04 00:43 - 2018-03-14 19:53 - 002651648 _____ (Microsoft Corporation) C:\Windows\system32\wuaueng.dll
      2018-09-04 00:43 - 2018-03-14 19:53 - 000709120 _____ (Microsoft Corporation) C:\Windows\system32\wuapi.dll
      2018-09-04 00:43 - 2018-03-14 19:52 - 000140288 _____ (Microsoft Corporation) C:\Windows\system32\wuauclt.exe
      2018-09-04 00:43 - 2018-03-14 19:52 - 000037888 _____ (Microsoft Corporation) C:\Windows\system32\wups2.dll
      2018-09-04 00:43 - 2018-03-14 19:52 - 000037888 _____ (Microsoft Corporation) C:\Windows\system32\wuapp.exe
      2018-09-04 00:43 - 2018-03-14 19:52 - 000036864 _____ (Microsoft Corporation) C:\Windows\system32\wups.dll
      2018-09-04 00:43 - 2018-03-14 19:52 - 000012288 _____ (Microsoft Corporation) C:\Windows\system32\wu.upgrade.ps.dll
      2018-09-04 00:43 - 2018-03-06 21:11 - 000052224 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wsnmp32.dll
      2018-09-04 00:43 - 2018-03-06 21:07 - 000067072 _____ (Microsoft Corporation) C:\Windows\system32\wsnmp32.dll
      2018-09-04 00:43 - 2018-02-22 06:28 - 000217600 _____ (Microsoft Corporation) C:\Windows\system32\WinSCard.dll
      2018-09-04 00:43 - 2018-02-22 06:06 - 000134656 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WinSCard.dll
      2018-09-04 00:43 - 2018-02-10 21:35 - 000367296 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\msrpc.sys
      2018-09-04 00:43 - 2018-02-10 21:35 - 000334528 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\acpi.sys
      2018-09-04 00:43 - 2018-02-10 21:35 - 000185024 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\pci.sys
      2018-09-04 00:43 - 2018-02-10 21:35 - 000122560 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\NV_AGP.SYS
      2018-09-04 00:43 - 2018-02-10 21:35 - 000068288 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\volmgr.sys
      2018-09-04 00:43 - 2018-02-10 21:35 - 000064192 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ULIAGPKX.SYS
      2018-09-04 00:43 - 2018-02-10 21:35 - 000063168 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\termdd.sys
      2018-09-04 00:43 - 2018-02-10 21:35 - 000060608 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\AGP440.sys
      2018-09-04 00:43 - 2018-02-10 21:35 - 000036032 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\vdrvroot.sys
      2018-09-04 00:43 - 2018-02-10 21:35 - 000031936 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\mssmbios.sys
      2018-09-04 00:43 - 2018-02-10 21:35 - 000020160 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\isapnp.sys
      2018-09-04 00:43 - 2018-02-10 21:35 - 000015040 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\msisadrv.sys
      2018-09-04 00:43 - 2018-02-10 21:35 - 000012096 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\swenum.sys
      2018-09-04 00:43 - 2018-02-10 21:23 - 002292224 _____ (Microsoft Corporation) C:\Windows\SysWOW64\MSVidCtl.dll
      2018-09-04 00:43 - 2018-02-10 21:23 - 000111616 _____ (Microsoft Corporation) C:\Windows\SysWOW64\racpldlg.dll
      2018-09-04 00:43 - 2018-02-10 21:11 - 000119296 _____ (Microsoft Corporation) C:\Windows\system32\racpldlg.dll
      2018-09-04 00:43 - 2018-02-10 20:36 - 000007168 _____ (Microsoft Corporation) C:\Windows\SysWOW64\MsraLegacy.tlb
      2018-09-04 00:43 - 2018-02-10 20:25 - 000014336 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\wmiacpi.sys
      2018-09-04 00:43 - 2018-02-10 20:25 - 000009728 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\errdev.sys
      2018-09-04 00:43 - 2018-02-10 20:25 - 000007168 _____ (Microsoft Corporation) C:\Windows\system32\MsraLegacy.tlb
      2018-09-04 00:43 - 2018-01-12 19:40 - 000407040 _____ (Microsoft Corporation) C:\Windows\system32\scesrv.dll
      2018-09-04 00:43 - 2018-01-12 19:27 - 004834816 _____ (Microsoft Corporation) C:\Windows\system32\xpsrchvw.exe
      2018-09-04 00:43 - 2018-01-12 19:26 - 000308224 _____ (Microsoft Corporation) C:\Windows\SysWOW64\scesrv.dll
      2018-09-04 00:43 - 2018-01-12 19:16 - 003405824 _____ (Microsoft Corporation) C:\Windows\SysWOW64\xpsrchvw.exe
      2018-09-04 00:43 - 2018-01-11 19:41 - 001133568 _____ (Microsoft Corporation) C:\Windows\system32\cdosys.dll
      2018-09-04 00:43 - 2018-01-11 19:22 - 000805376 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cdosys.dll
      2018-09-04 00:43 - 2018-01-01 05:21 - 000288488 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\fltMgr.sys
      2018-09-04 00:43 - 2018-01-01 05:21 - 000213736 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\rdyboost.sys
      2018-09-04 00:43 - 2018-01-01 05:18 - 001741312 _____ (Microsoft Corporation) C:\Windows\system32\sysmain.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 001361408 _____ (Microsoft Corporation) C:\Windows\system32\PeerDistSvc.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 001110528 _____ (Microsoft Corporation) C:\Windows\system32\schedsvc.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000961024 _____ (Microsoft Corporation) C:\Windows\system32\actxprxy.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000842752 _____ (Microsoft Corporation) C:\Windows\system32\nshwfp.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000473600 _____ (Microsoft Corporation) C:\Windows\system32\taskcomp.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000444928 _____ (Microsoft Corporation) C:\Windows\system32\winhttp.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000439296 _____ (Microsoft Corporation) C:\Windows\system32\p2psvc.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000366592 _____ (Microsoft Corporation) C:\Windows\system32\wcncsvc.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000327168 _____ (Microsoft Corporation) C:\Windows\system32\pnrpsvc.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000324096 _____ (Microsoft Corporation) C:\Windows\system32\FWPUCLNT.DLL
      2018-09-04 00:43 - 2018-01-01 05:18 - 000264704 _____ (Microsoft Corporation) C:\Windows\system32\P2P.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000223232 _____ (Microsoft Corporation) C:\Windows\system32\ncsi.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000181760 _____ (Microsoft Corporation) C:\Windows\system32\PeerDist.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000131584 _____ (Microsoft Corporation) C:\Windows\system32\PeerDistWSDDiscoProv.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000120320 _____ (Microsoft Corporation) C:\Windows\system32\WcnApi.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000101376 _____ (Microsoft Corporation) C:\Windows\system32\fdWCN.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000095744 _____ (Microsoft Corporation) C:\Windows\system32\rascfg.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000070656 _____ (Microsoft Corporation) C:\Windows\system32\nlaapi.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000051200 _____ (Microsoft Corporation) C:\Windows\system32\PeerDistHttpTrans.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000024576 _____ (Microsoft Corporation) C:\Windows\system32\WcnEapPeerProxy.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000024064 _____ (Microsoft Corporation) C:\Windows\system32\WcnEapAuthProxy.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000016896 _____ (Microsoft Corporation) C:\Windows\system32\wshqos.dll
      2018-09-04 00:43 - 2018-01-01 05:18 - 000013312 _____ (Microsoft Corporation) C:\Windows\system32\wshnetbs.dll
      2018-09-04 00:43 - 2018-01-01 05:04 - 000559616 _____ (Microsoft Corporation) C:\Windows\system32\spoolsv.exe
      2018-09-04 00:43 - 2018-01-01 05:00 - 000666624 _____ (Microsoft Corporation) C:\Windows\SysWOW64\nshwfp.dll
      2018-09-04 00:43 - 2018-01-01 05:00 - 000351744 _____ (Microsoft Corporation) C:\Windows\SysWOW64\winhttp.dll
      2018-09-04 00:43 - 2018-01-01 05:00 - 000304640 _____ (Microsoft Corporation) C:\Windows\SysWOW64\taskcomp.dll
      2018-09-04 00:43 - 2018-01-01 05:00 - 000276992 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wcncsvc.dll
      2018-09-04 00:43 - 2018-01-01 05:00 - 000217600 _____ (Microsoft Corporation) C:\Windows\SysWOW64\P2P.dll
      2018-09-04 00:43 - 2018-01-01 05:00 - 000216576 _____ (Microsoft Corporation) C:\Windows\SysWOW64\FWPUCLNT.DLL
      2018-09-04 00:43 - 2018-01-01 05:00 - 000162304 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ncsi.dll
      2018-09-04 00:43 - 2018-01-01 05:00 - 000139776 _____ (Microsoft Corporation) C:\Windows\SysWOW64\PeerDist.dll
      2018-09-04 00:43 - 2018-01-01 05:00 - 000081920 _____ (Microsoft Corporation) C:\Windows\SysWOW64\fdWCN.dll
      2018-09-04 00:43 - 2018-01-01 05:00 - 000081408 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rascfg.dll
      2018-09-04 00:43 - 2018-01-01 05:00 - 000052224 _____ (Microsoft Corporation) C:\Windows\SysWOW64\nlaapi.dll
      2018-09-04 00:43 - 2018-01-01 04:59 - 000309760 _____ (Microsoft Corporation) C:\Windows\SysWOW64\actxprxy.dll
      2018-09-04 00:43 - 2018-01-01 04:55 - 000131584 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\pacer.sys
      2018-09-04 00:43 - 2018-01-01 04:55 - 000088576 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\wanarp.sys
      2018-09-04 00:43 - 2018-01-01 04:55 - 000058368 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ndproxy.sys
      2018-09-04 00:43 - 2018-01-01 04:55 - 000045056 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\netbios.sys
      2018-09-04 00:43 - 2018-01-01 04:55 - 000024064 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ndistapi.sys
      2018-09-04 00:43 - 2018-01-01 04:50 - 000455680 _____ (Microsoft Corporation) C:\Windows\system32\winlogon.exe
      2018-09-04 00:43 - 2018-01-01 04:47 - 000244224 _____ (Microsoft Corporation) C:\Windows\system32\vmicsvc.exe
      2018-09-04 00:43 - 2018-01-01 04:46 - 000051712 _____ (Microsoft Corporation) C:\Windows\system32\vmictimeprovider.dll
      2018-09-04 00:43 - 2018-01-01 04:43 - 000086528 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WcnApi.dll
      2018-09-04 00:43 - 2018-01-01 04:43 - 000033280 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rasmxs.dll
      2018-09-04 00:43 - 2018-01-01 04:43 - 000022528 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rasser.dll
      2018-09-04 00:43 - 2018-01-01 04:43 - 000020480 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WcnEapPeerProxy.dll
      2018-09-04 00:43 - 2018-01-01 04:43 - 000019968 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WcnEapAuthProxy.dll
      2018-09-04 00:43 - 2018-01-01 04:43 - 000013824 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wshqos.dll
      2018-09-04 00:43 - 2018-01-01 04:41 - 000754176 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\http.sys
      2018-09-04 00:43 - 2017-12-05 20:36 - 000625664 _____ (Microsoft Corporation) C:\Windows\system32\mscms.dll
      2018-09-04 00:43 - 2017-12-05 20:36 - 000229376 _____ (Microsoft Corporation) C:\Windows\system32\wintrust.dll
      2018-09-04 00:43 - 2017-12-05 20:36 - 000190976 _____ (Microsoft Corporation) C:\Windows\system32\cryptsvc.dll
      2018-09-04 00:43 - 2017-12-05 20:36 - 000141824 _____ (Microsoft Corporation) C:\Windows\system32\cryptnet.dll
      2018-09-04 00:43 - 2017-12-05 20:36 - 000092160 _____ (Microsoft Corporation) C:\Windows\system32\TabSvc.dll
      2018-09-04 00:43 - 2017-12-05 20:36 - 000040960 _____ (Microsoft Corporation) C:\Windows\system32\WcsPlugInService.dll
      2018-09-04 00:43 - 2017-12-05 20:08 - 001176576 _____ (Microsoft Corporation) C:\Windows\SysWOW64\crypt32.dll
      2018-09-04 00:43 - 2017-12-05 20:08 - 000481792 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mscms.dll
      2018-09-04 00:43 - 2017-12-05 20:08 - 000179200 _____ (Microsoft Corporation) C:\Windows\SysWOW64\wintrust.dll
      2018-09-04 00:43 - 2017-12-05 20:08 - 000145920 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cryptsvc.dll
      2018-09-04 00:43 - 2017-12-05 20:08 - 000106496 _____ (Microsoft Corporation) C:\Windows\SysWOW64\cryptnet.dll
      2018-09-04 00:43 - 2017-12-05 19:04 - 000404992 _____ (Microsoft Corporation) C:\Windows\system32\wisptis.exe
      2018-09-04 00:43 - 2017-12-05 18:49 - 000032768 _____ (Microsoft Corporation) C:\Windows\SysWOW64\WcsPlugInService.dll
      2018-09-04 00:42 - 2018-08-03 18:39 - 000084992 _____ (Microsoft Corporation) C:\Windows\SysWOW64\hlink.dll
      2018-09-04 00:42 - 2018-08-02 06:20 - 000708272 _____ (Microsoft Corporation) C:\Windows\system32\winload.efi
      2018-09-04 00:42 - 2018-08-02 06:06 - 000156256 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ksecpkg.sys
      2018-09-04 00:42 - 2018-08-02 06:05 - 005553760 _____ (Microsoft Corporation) C:\Windows\system32\ntoskrnl.exe
      2018-09-04 00:42 - 2018-08-02 06:00 - 000633080 _____ (Microsoft Corporation) C:\Windows\system32\winresume.efi
      2018-09-04 00:42 - 2018-08-02 05:59 - 001211904 _____ (Microsoft Corporation) C:\Windows\system32\rpcrt4.dll
      2018-09-04 00:42 - 2018-08-02 05:59 - 000146432 _____ (Microsoft Corporation) C:\Windows\system32\msaudite.dll
      2018-09-04 00:42 - 2018-08-02 05:59 - 000060416 _____ (Microsoft Corporation) C:\Windows\system32\msobjs.dll
      2018-09-04 00:42 - 2018-08-02 05:58 - 001461760 _____ (Microsoft Corporation) C:\Windows\system32\lsasrv.dll
      2018-09-04 00:42 - 2018-08-02 05:58 - 000731648 _____ (Microsoft Corporation) C:\Windows\system32\kerberos.dll
      2018-09-04 00:42 - 2018-08-02 05:57 - 000880640 _____ (Microsoft Corporation) C:\Windows\system32\advapi32.dll
      2018-09-04 00:42 - 2018-08-02 05:57 - 000690688 _____ (Microsoft Corporation) C:\Windows\system32\adtschema.dll
      2018-09-04 00:42 - 2018-08-02 05:41 - 000146432 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msaudite.dll
      2018-09-04 00:42 - 2018-08-02 05:41 - 000060416 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msobjs.dll
      2018-09-04 00:42 - 2018-08-02 05:41 - 000043008 _____ (Microsoft Corporation) C:\Windows\SysWOW64\srclient.dll
      2018-09-04 00:42 - 2018-08-02 05:40 - 000690688 _____ (Microsoft Corporation) C:\Windows\SysWOW64\adtschema.dll
      2018-09-04 00:42 - 2018-07-19 09:15 - 025745408 _____ (Microsoft Corporation) C:\Windows\system32\mshtml.dll
      2018-09-04 00:42 - 2018-07-19 07:04 - 000047616 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ieetwproxystub.dll
      2018-09-04 00:42 - 2018-07-08 19:02 - 000152064 _____ (Microsoft Corporation) C:\Windows\system32\t2embed.dll
      2018-09-04 00:42 - 2018-07-08 19:02 - 000100864 _____ (Microsoft Corporation) C:\Windows\system32\fontsub.dll
      2018-09-04 00:42 - 2018-07-08 19:01 - 000046080 _____ (Adobe Systems) C:\Windows\system32\atmlib.dll
      2018-09-04 00:42 - 2018-07-08 18:42 - 000111616 _____ (Microsoft Corporation) C:\Windows\SysWOW64\t2embed.dll
      2018-09-04 00:42 - 2018-07-08 18:41 - 000071680 _____ (Microsoft Corporation) C:\Windows\SysWOW64\fontsub.dll
      2018-09-04 00:42 - 2018-07-08 18:41 - 000010240 _____ (Microsoft Corporation) C:\Windows\SysWOW64\dciman32.dll
      2018-09-04 00:42 - 2018-07-08 18:13 - 000034304 _____ (Adobe Systems) C:\Windows\SysWOW64\atmlib.dll
      2018-09-04 00:42 - 2018-07-07 18:24 - 003226112 _____ (Microsoft Corporation) C:\Windows\system32\win32k.sys
      2018-09-04 00:42 - 2018-07-06 19:03 - 000056832 _____ (Microsoft Corporation) C:\Windows\system32\mf3216.dll
      2018-09-04 00:42 - 2018-07-06 18:48 - 000043008 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mf3216.dll
      2018-09-04 00:42 - 2018-06-29 18:55 - 000137728 _____ (Microsoft Corporation) C:\Windows\system32\CscMig.dll
      2018-09-04 00:42 - 2018-06-27 18:55 - 003246592 _____ (Microsoft Corporation) C:\Windows\system32\msi.dll
      2018-09-04 00:42 - 2018-06-27 18:55 - 000025088 _____ (Microsoft Corporation) C:\Windows\system32\msimsg.dll
      2018-09-04 00:42 - 2018-06-27 18:42 - 000025088 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msimsg.dll
      2018-09-04 00:42 - 2018-06-21 06:33 - 000002048 _____ (Microsoft Corporation) C:\Windows\system32\tzres.dll
      2018-09-04 00:42 - 2018-06-21 06:09 - 000002048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\tzres.dll
      2018-09-04 00:42 - 2018-06-16 08:24 - 000459632 _____ (Microsoft Corporation) C:\Windows\system32\ci.dll
      2018-09-04 00:42 - 2018-06-16 08:11 - 000634272 _____ (Microsoft Corporation) C:\Windows\system32\winload.exe
      2018-09-04 00:42 - 2018-06-13 19:23 - 000140992 _____ (Microsoft Corporation) C:\Windows\system32\CompatTelRunner.exe
      2018-09-04 00:42 - 2018-06-13 19:18 - 000680960 _____ (Microsoft Corporation) C:\Windows\system32\aeinv.dll
      2018-09-04 00:42 - 2018-06-08 19:20 - 002066432 _____ (Microsoft Corporation) C:\Windows\system32\ole32.dll
      2018-09-04 00:42 - 2018-06-08 19:20 - 000026112 _____ (Microsoft Corporation) C:\Windows\system32\oleres.dll
      2018-09-04 00:42 - 2018-06-08 18:55 - 000026112 _____ (Microsoft Corporation) C:\Windows\SysWOW64\oleres.dll
      2018-09-04 00:42 - 2018-06-08 18:44 - 000030208 _____ (Microsoft Corporation) C:\Windows\system32\dnscacheugc.exe
      2018-09-04 00:42 - 2018-06-08 18:28 - 000030720 _____ (Microsoft Corporation) C:\Windows\SysWOW64\dnscacheugc.exe
      2018-09-04 00:42 - 2018-06-08 16:05 - 002860032 _____ (Microsoft Corporation) C:\Windows\system32\aitstatic.exe
      2018-09-04 00:42 - 2018-06-08 16:05 - 001602048 _____ (Microsoft Corporation) C:\Windows\system32\appraiser.dll
      2018-09-04 00:42 - 2018-06-08 16:05 - 000783872 _____ (Microsoft Corporation) C:\Windows\system32\generaltel.dll
      2018-09-04 00:42 - 2018-06-08 16:05 - 000612352 _____ (Microsoft Corporation) C:\Windows\system32\devinv.dll
      2018-09-04 00:42 - 2018-06-08 16:05 - 000470016 _____ (Microsoft Corporation) C:\Windows\system32\centel.dll
      2018-09-04 00:42 - 2018-06-08 16:05 - 000443392 _____ (Microsoft Corporation) C:\Windows\system32\invagent.dll
      2018-09-04 00:42 - 2018-06-08 16:05 - 000301056 _____ (Microsoft Corporation) C:\Windows\system32\acmigration.dll
      2018-09-04 00:42 - 2018-06-08 16:05 - 000246272 _____ (Microsoft Corporation) C:\Windows\system32\aepic.dll
      2018-09-04 00:42 - 2018-06-07 19:20 - 000022528 _____ (Microsoft Corporation) C:\Windows\system32\wfapigp.dll
      2018-09-04 00:42 - 2018-06-07 19:19 - 000828928 _____ (Microsoft Corporation) C:\Windows\system32\MPSSVC.dll
      2018-09-04 00:42 - 2018-06-07 19:19 - 000108544 _____ (Microsoft Corporation) C:\Windows\system32\icfupgd.dll
      2018-09-04 00:42 - 2018-05-15 07:16 - 001681088 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\ntfs.sys
      2018-09-04 00:42 - 2018-05-15 06:44 - 004120576 _____ (Microsoft Corporation) C:\Windows\system32\mf.dll
      2018-09-04 00:42 - 2018-05-15 06:44 - 001159680 _____ (Microsoft Corporation) C:\Windows\system32\webservices.dll
      2018-09-04 00:42 - 2018-05-15 06:44 - 000002048 _____ (Microsoft Corporation) C:\Windows\system32\mferror.dll
      2018-09-04 00:42 - 2018-05-15 06:13 - 000002048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\mferror.dll
      2018-09-04 00:42 - 2018-05-12 00:19 - 000977408 _____ (Microsoft Corporation) C:\Windows\system32\inetcomm.dll
      2018-09-04 00:42 - 2018-05-02 18:32 - 000344064 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbhub.sys
      2018-09-04 00:42 - 2018-05-02 18:32 - 000325632 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbport.sys
      2018-09-04 00:42 - 2018-05-02 18:32 - 000099840 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbccgp.sys
      2018-09-04 00:42 - 2018-05-02 18:32 - 000056320 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbehci.sys
      2018-09-04 00:42 - 2018-05-02 18:32 - 000030720 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbuhci.sys
      2018-09-04 00:42 - 2018-05-02 18:32 - 000025600 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbohci.sys
      2018-09-04 00:42 - 2018-05-02 18:32 - 000007808 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\usbd.sys
      2018-09-04 00:42 - 2018-04-23 03:00 - 000876032 _____ (Microsoft Corporation) C:\Windows\system32\oleaut32.dll
      2018-09-04 00:42 - 2018-04-11 19:38 - 000170496 _____ (Microsoft Corporation) C:\Windows\system32\itss.dll
      2018-09-04 00:42 - 2018-04-11 19:36 - 000142848 _____ (Microsoft Corporation) C:\Windows\SysWOW64\itss.dll
      2018-09-04 00:42 - 2018-04-10 19:35 - 001735168 _____ (Microsoft Corporation) C:\Windows\system32\comsvcs.dll
      2018-09-04 00:42 - 2018-03-10 20:11 - 000340480 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msexcl40.dll
      2018-09-04 00:42 - 2018-03-06 21:13 - 000148160 _____ (Microsoft Corporation) C:\Windows\SysWOW64\basecsp.dll
      2018-09-04 00:42 - 2018-03-06 21:11 - 000184320 _____ (Microsoft Corporation) C:\Windows\SysWOW64\scksp.dll
      2018-09-04 00:42 - 2018-03-06 21:10 - 000170176 _____ (Microsoft Corporation) C:\Windows\system32\basecsp.dll
      2018-09-04 00:42 - 2018-03-06 21:07 - 000229376 _____ (Microsoft Corporation) C:\Windows\system32\scksp.dll
      2018-09-04 00:42 - 2018-02-10 21:35 - 000023744 _____ (Microsoft Corporation) C:\Windows\system32\streamci.dll
      2018-09-04 00:42 - 2018-02-10 21:11 - 003665920 _____ (Microsoft Corporation) C:\Windows\system32\MSVidCtl.dll
      2018-09-04 00:42 - 2018-02-10 21:11 - 000133120 _____ (Microsoft Corporation) C:\Windows\system32\msrahc.dll
      2018-09-04 00:42 - 2018-02-10 20:36 - 000108032 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msra.exe
      2018-09-04 00:42 - 2018-02-10 20:36 - 000040960 _____ (Microsoft Corporation) C:\Windows\SysWOW64\sdchange.exe
      2018-09-04 00:42 - 2018-02-10 20:26 - 000653312 _____ (Microsoft Corporation) C:\Windows\system32\msra.exe
      2018-09-04 00:42 - 2018-02-10 20:26 - 000051712 _____ (Microsoft Corporation) C:\Windows\system32\sdchange.exe
      2018-09-04 00:42 - 2018-01-01 05:18 - 002004480 _____ (Microsoft Corporation) C:\Windows\system32\msxml6.dll
      2018-09-04 00:42 - 2018-01-01 05:18 - 000863232 _____ (Microsoft Corporation) C:\Windows\system32\IKEEXT.DLL
      2018-09-04 00:42 - 2018-01-01 05:18 - 000705024 _____ (Microsoft Corporation) C:\Windows\system32\BFE.DLL
      2018-09-04 00:42 - 2018-01-01 05:18 - 000303104 _____ (Microsoft Corporation) C:\Windows\system32\nlasvc.dll
      2018-09-04 00:42 - 2018-01-01 05:18 - 000076288 _____ (Microsoft Corporation) C:\Windows\system32\rasdiag.dll
      2018-09-04 00:42 - 2018-01-01 05:18 - 000060928 _____ (Microsoft Corporation) C:\Windows\system32\ndptsp.tsp
      2018-09-04 00:42 - 2018-01-01 05:18 - 000053760 _____ (Microsoft Corporation) C:\Windows\system32\vmicres.dll
      2018-09-04 00:42 - 2018-01-01 05:18 - 000047104 _____ (Microsoft Corporation) C:\Windows\system32\kmddsp.tsp
      2018-09-04 00:42 - 2018-01-01 05:18 - 000041472 _____ (Microsoft Corporation) C:\Windows\system32\rasmxs.dll
      2018-09-04 00:42 - 2018-01-01 05:18 - 000039424 _____ (Microsoft Corporation) C:\Windows\system32\traffic.dll
      2018-09-04 00:42 - 2018-01-01 05:18 - 000029696 _____ (Microsoft Corporation) C:\Windows\system32\rasser.dll
      2018-09-04 00:42 - 2018-01-01 05:18 - 000002048 _____ (Microsoft Corporation) C:\Windows\system32\msxml6r.dll
      2018-09-04 00:42 - 2018-01-01 05:00 - 001390080 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msxml6.dll
      2018-09-04 00:42 - 2018-01-01 05:00 - 000061952 _____ (Microsoft Corporation) C:\Windows\SysWOW64\rasdiag.dll
      2018-09-04 00:42 - 2018-01-01 05:00 - 000050688 _____ (Microsoft Corporation) C:\Windows\SysWOW64\ndptsp.tsp
      2018-09-04 00:42 - 2018-01-01 05:00 - 000033280 _____ (Microsoft Corporation) C:\Windows\SysWOW64\traffic.dll
      2018-09-04 00:42 - 2018-01-01 05:00 - 000002048 _____ (Microsoft Corporation) C:\Windows\SysWOW64\msxml6r.dll
      2018-09-04 00:42 - 2018-01-01 04:46 - 000128512 _____ (Microsoft Corporation) C:\Windows\system32\IcCoinstall.dll
      2018-09-04 00:42 - 2018-01-01 04:43 - 000038912 _____ (Microsoft Corporation) C:\Windows\SysWOW64\kmddsp.tsp
      2018-09-04 00:42 - 2017-12-05 20:36 - 001484288 _____ (Microsoft Corporation) C:\Windows\system32\crypt32.dll
      2018-09-04 00:42 - 2017-12-05 20:36 - 000250880 _____ (Microsoft Corporation) C:\Windows\system32\icm32.dll
      2018-09-04 00:42 - 2017-12-05 20:08 - 000215040 _____ (Microsoft Corporation) C:\Windows\SysWOW64\icm32.dll
      2018-08-13 10:45 - 2018-08-13 10:45 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\qBittorrent
      2018-08-13 10:45 - 2018-08-13 10:45 - 000000000 ____D C:\Program Files\qBittorrent
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-09-07 10:02 - 2017-09-16 15:50 - 000000000 ____D C:\Users\kpacko\AppData\Roaming\qBittorrent
      2018-09-07 07:53 - 2009-07-14 07:45 - 000026576 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-1.C7483456-A289-439d-8115-601632D005A0
      2018-09-07 07:53 - 2009-07-14 07:45 - 000026576 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-0.C7483456-A289-439d-8115-601632D005A0
      2018-09-07 07:51 - 2009-07-14 08:13 - 000772130 _____ C:\Windows\system32\PerfStringBackup.INI
      2018-09-07 07:51 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\inf
      2018-09-07 07:49 - 2017-09-15 22:54 - 000002269 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Google Chrome.lnk
      2018-09-07 07:45 - 2017-09-16 17:07 - 000000000 ____D C:\Program Files (x86)\TeamViewer
      2018-09-07 07:45 - 2017-09-15 18:18 - 000000000 ____D C:\ProgramData\NVIDIA
      2018-09-07 07:45 - 2009-07-14 08:08 - 000000006 ____H C:\Windows\Tasks\SA.DAT
      2018-09-07 00:19 - 2017-10-22 09:50 - 000000000 ____D C:\Users\kpacko\AppData\Local\CrashDumps
      2018-09-06 23:59 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\rescache
      2018-09-04 22:42 - 2017-09-17 23:54 - 000000000 ____D C:\Users\kpacko\AppData\Roaming\FileZilla
      2018-09-04 00:58 - 2009-07-14 07:45 - 000295648 _____ C:\Windows\system32\FNTCACHE.DAT
      2018-09-04 00:56 - 2017-09-16 19:15 - 000000000 ____D C:\Windows\system32\appraiser
      2018-09-04 00:56 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\PolicyDefinitions
      2018-09-04 00:51 - 2017-07-17 23:37 - 000756356 _____ C:\Windows\SysWOW64\PerfStringBackup.INI
      2018-09-02 00:28 - 2017-10-02 14:41 - 000000000 ____D C:\Users\kpacko\AppData\Roaming\ViberPC
      2018-09-02 00:27 - 2018-07-02 00:59 - 000000000 ____D C:\Users\kpacko\AppData\Local\Viber
      2018-09-02 00:26 - 2017-10-02 14:41 - 000000000 ____D C:\Users\kpacko\Documents\ViberDownloads
      2018-08-19 17:49 - 2017-11-02 01:00 - 000001018 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\TeamViewer 13.lnk
      2018-08-08 00:53 - 2017-10-02 09:30 - 000000000 ____D C:\Users\kpacko\AppData\Local\ElevatedDiagnostics
      2018-08-08 00:53 - 2009-07-14 06:20 - 000000000 ____D C:\Windows\system32\NDF
      ==================== Files in the root of some directories =======
      2018-05-04 13:56 - 2018-05-01 20:53 - 001527138 _____ () C:\Users\kpacko\AppData\Roaming\ccseetup542pro.exe
      2018-05-04 13:56 - 2018-04-30 15:50 - 015816144 ____R (Piriform Ltd) C:\Users\kpacko\AppData\Roaming\ccsetup542pro.exe
      2018-05-04 13:56 - 2018-03-12 20:36 - 001371485 _____ () C:\Users\kpacko\AppData\Roaming\ccsetup542proo.exe
      2018-05-04 13:56 - 2018-03-12 20:34 - 000211375 _____ () C:\Users\kpacko\AppData\Roaming\ccsetup542prro.exe
      2017-11-30 16:35 - 2018-02-22 12:29 - 000007603 _____ () C:\Users\kpacko\AppData\Local\Resmon.ResmonCfg
      Some files in TEMP:
      2018-04-30 12:09 - 2018-04-30 12:09 - 011491456 _____ (Raxco Software, Inc.                                        ) C:\Users\kpacko\AppData\Local\Temp\PD140p_x64.exe
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\Windows\system32\winlogon.exe => File is digitally signed
      C:\Windows\system32\wininit.exe => File is digitally signed
      C:\Windows\SysWOW64\wininit.exe => File is digitally signed
      C:\Windows\explorer.exe => File is digitally signed
      C:\Windows\SysWOW64\explorer.exe => File is digitally signed
      C:\Windows\system32\svchost.exe => File is digitally signed
      C:\Windows\SysWOW64\svchost.exe => File is digitally signed
      C:\Windows\system32\services.exe => File is digitally signed
      C:\Windows\system32\User32.dll => File is digitally signed
      C:\Windows\SysWOW64\User32.dll => File is digitally signed
      C:\Windows\system32\userinit.exe => File is digitally signed
      C:\Windows\SysWOW64\userinit.exe => File is digitally signed
      C:\Windows\system32\rpcss.dll => File is digitally signed
      C:\Windows\system32\dnsapi.dll => File is digitally signed
      C:\Windows\SysWOW64\dnsapi.dll => File is digitally signed
      C:\Windows\system32\Drivers\volsnap.sys => File is digitally signed
      LastRegBack: 2018-09-06 23:52
      ==================== End of FRST.txt ============================
    • от мирослав24
      Здравейте,сблъсках се със следния проблем-неизвестно лице или лица правят опити за проникване в мои акаунти в електронни  пощи и  сайтове където съм се регистрирал.Получих писмо от единия сайт че е правен опит за вписване с моето потребителско име,но с грешна парола,и аналогично съобщение от е-майл провайдър.Ползвам десктоп компютър и лаптоп и не знам дали някое от устройствата не е със зловреден софтуер.Видимо нямам проблеми с машините,освен че и на двата компютъра като исках да си сменя паролата на един сайт,ми излезе прозорец с искане да си напиша електронната поща с който съм регистриран в сайта и като я написах след това ми излезе втори прозорец с подкана да напиша и паролата си за съответната поща.Нищо не смених в крайна сметка докато не установя къде е проблема.Изпращам резултатите от сканиране с FRST на настолния компютър :
      Scan result of Farbar Recovery Scan Tool (FRST) (x86) Version: 23.08.2018
      Ran by User1 (administrator) on PC1 (30-08-2018 15:49:50)
      Running from C:\Documents and Settings\User1\Desktop
      Loaded Profiles: User1 (Available Profiles: User1 & User2 & Administrator)
      Platform: Microsoft Windows XP Professional Service Pack 3 (X86) Language: English (United States)
      Internet Explorer Version 8 (Default browser: IE)
      Boot Mode: Normal
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      (Cisco Systems, Inc.) C:\Program Files\Cisco Systems\VPN Client\cvpnd.exe
      (Comodo) C:\Program Files\Comodo\Dragon\dragon_updater.exe
      () C:\Program Files\Lavasoft\Ad-Aware Antivirus\Ad-Aware Antivirus\11.12.945.9202\AdAwareService.exe
      () C:\WINDOWS\tsnpstd3.exe
      () C:\WINDOWS\vsnpstd3.exe
      () C:\Program Files\Lavasoft\Ad-Aware Antivirus\Ad-Aware Antivirus\11.12.945.9202\AdAwareTray.exe
      (Hewlett-Packard Co.) C:\Program Files\HP\HP Software Update\hpwuSchd2.exe
      (Sun Microsystems, Inc.) C:\Program Files\Common Files\Java\Java Update\jusched.exe
      (BitTorrent, Inc.) C:\Program Files\uTorrent\uTorrent.exe
      (Piriform Ltd) C:\Program Files\CCleaner\CCleaner.exe
      (MyCity) C:\Program Files\MCShield\MCShieldRTM.exe
      (Hewlett-Packard Co.) C:\Program Files\HP\Digital Imaging\bin\hpqtra08.exe
      (Microsoft Corporation) C:\WINDOWS\system32\wuauclt.exe
      (Sun Microsystems, Inc.) C:\Program Files\Common Files\Java\Java Update\jucheck.exe
      (Cisco Systems, Inc.) C:\Program Files\Cisco Systems\VPN Client\vpngui.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [tsnpstd3] => C:\WINDOWS\tsnpstd3.exe [262144 2006-06-19] ()
      HKLM\...\Run: [snpstd3] => C:\WINDOWS\vsnpstd3.exe [827392 2006-09-19] ()
      HKLM\...\Run: [AdAwareTray] => C:\Program Files\Lavasoft\Ad-Aware Antivirus\Ad-Aware Antivirus\11.12.945.9202\AdAwareTray.exe [8063200 2016-07-18] ()
      HKLM\...\Run: [HP Software Update] => C:\Program Files\HP\HP Software Update\HPWuSchd2.exe [49152 2007-03-11] (Hewlett-Packard Co.)
      HKLM\...\Run: [SunJavaUpdateSched] => C:\Program Files\Common Files\Java\Java Update\jusched.exe [252848 2012-07-03] (Sun Microsystems, Inc.)
      HKU\S-1-5-21-220523388-412668190-1417001333-1003\...\Run: [Messenger (Yahoo!)] => "F:\SKYPE_~1\yahoo\Messenger\YahooMessenger.exe" -quiet
      HKU\S-1-5-21-220523388-412668190-1417001333-1003\...\Run: [uTorrent] => C:\Program Files\uTorrent\uTorrent.exe [395640 2011-05-02] (BitTorrent, Inc.)
      HKU\S-1-5-21-220523388-412668190-1417001333-1003\...\Run: [CCleaner Monitoring] => C:\Program Files\CCleaner\CCleaner.exe [6490904 2015-08-20] (Piriform Ltd)
      HKU\S-1-5-21-220523388-412668190-1417001333-1003\...\Run: [Google Update] => C:\Documents and Settings\User1\Local Settings\Application Data\Google\Update\\GoogleUpdateCore.exe [601680 2017-12-02] (Google Inc.)
      HKU\S-1-5-21-220523388-412668190-1417001333-1003\...\Run: [MCShield Monitor] => C:\Program Files\MCShield\mcshieldrtm.exe [650816 2014-04-11] (MyCity)
      HKU\S-1-5-18\...\RunOnce: [RunNarrator] => C:\WINDOWS\system32\Narrator.exe [53760 2008-04-14] (Microsoft Corporation)
      HKU\S-1-5-18\...\RunOnce: [FlashPlayerUpdate] => C:\WINDOWS\system32\Macromed\Flash\FlashUtil32_30_0_0_134_pepper.exe [1447936 2018-07-27] (Adobe Systems Incorporated)
      Startup: C:\Documents and Settings\All Users\Start Menu\Programs\Startup\HP Digital Imaging Monitor.lnk [2018-03-28]
      ShortcutTarget: HP Digital Imaging Monitor.lnk -> C:\Program Files\HP\Digital Imaging\bin\hpqtra08.exe (Hewlett-Packard Co.)
      Startup: C:\Documents and Settings\All Users\Start Menu\Programs\Startup\VPN Client.lnk [2018-08-30]
      ShortcutTarget: VPN Client.lnk -> C:\WINDOWS\Installer\{B0BF7057-6869-4E4B-920C-EA2A58DA07F0}\Icon3E5562ED7.ico ()
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      Tcpip\..\Interfaces\{0227FD86-8C54-4C88-8029-3F44137A8ADF}: [DhcpNameServer]
      Tcpip\..\Interfaces\{1524681E-CD57-4084-9846-709C0A2CC0ED}: [NameServer],
      Internet Explorer:
      HKU\.DEFAULT\Software\Microsoft\Internet Explorer\Main,Start Page = about:blank
      HKU\S-1-5-21-220523388-412668190-1417001333-1003\Software\Microsoft\Internet Explorer\Main,Start Page = about:blank
      BHO: Java(tm) Plug-In SSV Helper -> {761497BB-D6F0-462C-B6EB-D4DAF1D92D43} -> C:\Program Files\Java\jre1.8.0_152\bin\ssv.dll [2017-12-08] (Oracle Corporation)
      BHO: Java(tm) Plug-In 2 SSV Helper -> {DBC80044-A445-435b-BC74-9C25C1C588A9} -> C:\Program Files\Java\jre1.8.0_152\bin\jp2ssv.dll [2017-12-08] (Oracle Corporation)
      DPF: {8AD9C840-044E-11D1-B3E9-00805F499D93} hxxp://java.sun.com/update/1.7.0/jinstall-1_7_0_09-windows-i586.cab
      FF Plugin: @adobe.com/FlashPlayer -> C:\WINDOWS\system32\Macromed\Flash\NPSWF32_27_0_0_187.dll [2017-12-08] ()
      FF Plugin: @java.com/DTPlugin,version=11.152.2 -> C:\Program Files\Java\jre1.8.0_152\bin\dtplugin\npDeployJava1.dll [2017-12-08] (Oracle Corporation)
      FF Plugin: @java.com/JavaPlugin,version=11.152.2 -> C:\Program Files\Java\jre1.8.0_152\bin\plugin2\npjp2.dll [2017-12-08] (Oracle Corporation)
      FF Plugin: @microsoft.com/WPF,version=3.5 -> C:\WINDOWS\Microsoft.NET\Framework\v3.5\Windows Presentation Foundation\NPWPF.dll [2008-07-29] (Microsoft Corporation)
      FF Plugin: Adobe Reader -> C:\Program Files\Adobe\Reader 11.0\Reader\AIR\nppdf32.dll [2014-08-05] (Adobe Systems Inc.)
      FF Plugin HKU\S-1-5-21-220523388-412668190-1417001333-1003: @talk.google.com/GoogleTalkPlugin -> C:\Documents and Settings\User1\Application Data\Mozilla\plugins\npgoogletalk.dll [2015-12-08] (Google)
      FF Plugin HKU\S-1-5-21-220523388-412668190-1417001333-1003: @talk.google.com/O1DPlugin -> C:\Documents and Settings\User1\Application Data\Mozilla\plugins\npo1d.dll [2015-12-08] (Google)
      FF Plugin HKU\S-1-5-21-220523388-412668190-1417001333-1003: @tools.google.com/Google Update;version=3 -> C:\Documents and Settings\User1\Local Settings\Application Data\Google\Update\\npGoogleUpdate3.dll [2017-12-02] (Google Inc.)
      FF Plugin HKU\S-1-5-21-220523388-412668190-1417001333-1003: @tools.google.com/Google Update;version=9 -> C:\Documents and Settings\User1\Local Settings\Application Data\Google\Update\\npGoogleUpdate3.dll [2017-12-02] (Google Inc.)
      FF Plugin ProgramFiles/Appdata: C:\Documents and Settings\User1\Application Data\mozilla\plugins\npgoogletalk.dll [2015-12-08] (Google)
      FF Plugin ProgramFiles/Appdata: C:\Documents and Settings\User1\Application Data\mozilla\plugins\npo1d.dll [2015-12-08] (Google)
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      S3 AdobeFlashPlayerUpdateSvc; C:\WINDOWS\system32\Macromed\Flash\FlashPlayerUpdateService.exe [335872 2018-07-27] (Adobe Systems Incorporated) [File not signed]
      S2 Browser; C:\WINDOWS\System32\browser.dll [78336 2012-07-06] (Microsoft Corporation) [File not signed]
      R2 CVPND; C:\Program Files\Cisco Systems\VPN Client\cvpnd.exe [1528616 2010-03-23] (Cisco Systems, Inc.)
      R2 DcomLaunch; C:\WINDOWS\system32\rpcss.dll [401408 2009-02-09] (Microsoft Corporation) [File not signed]
      R2 Dnscache; C:\WINDOWS\System32\dnsrslvr.dll [45568 2009-04-20] (Microsoft Corporation) [File not signed]
      R2 DragonUpdater; C:\Program Files\Comodo\Dragon\dragon_updater.exe [2060848 2016-02-05] (Comodo)
      R2 Eventlog; C:\WINDOWS\system32\services.exe [110592 2009-02-06] (Microsoft Corporation) [File not signed]
      R3 EventSystem; C:\WINDOWS\system32\es.dll [253952 2008-07-07] (Microsoft Corporation) [File not signed]
      S3 FastUserSwitchingCompatibility; C:\WINDOWS\System32\shsvcs.dll [135168 2009-07-28] (Microsoft Corporation) [File not signed]
      R3 hpqcxs08; C:\Program Files\HP\Digital Imaging\bin\hpqcxs08.dll [217088 2007-03-11] (Hewlett-Packard Co.) [File not signed]
      R2 HPSLPSVC; C:\Program Files\HP\Digital Imaging\bin\HPSLPSVC32.DLL [602112 2007-06-04] (Hewlett-Packard Co.) [File not signed]
      S4 JavaQuickStarterService; C:\Program Files\Java\jre7\bin\jqs.exe [170912 2013-01-12] (Oracle Corporation)
      R2 LanmanServer; C:\WINDOWS\System32\srvsvc.dll [99840 2010-08-27] (Microsoft Corporation) [File not signed]
      R2 lanmanworkstation; C:\WINDOWS\System32\wkssvc.dll [132096 2009-06-10] (Microsoft Corporation) [File not signed]
      R2 LavasoftAdAwareService11; C:\Program Files\Lavasoft\Ad-Aware Antivirus\Ad-Aware Antivirus\11.12.945.9202\AdAwareService.exe [664040 2016-07-18] ()
      S3 MSIServer; C:\WINDOWS\System32\msiexec.exe [95744 2008-05-19] (Microsoft Corporation) [File not signed]
      S3 Net Driver HPZ12; C:\WINDOWS\system32\HPZinw12.dll [43520 2006-11-08] (Hewlett-Packard) [File not signed]
      R3 Nla; C:\WINDOWS\System32\mswsock.dll [245248 2008-06-20] (Microsoft Corporation) [File not signed]
      R2 PlugPlay; C:\WINDOWS\system32\services.exe [110592 2009-02-06] (Microsoft Corporation) [File not signed]
      R3 Pml Driver HPZ12; C:\WINDOWS\system32\HPZipm12.dll [53248 2006-11-08] (Hewlett-Packard) [File not signed]
      R2 RpcSs; C:\WINDOWS\System32\rpcss.dll [401408 2009-02-09] (Microsoft Corporation) [File not signed]
      R2 ShellHWDetection; C:\WINDOWS\System32\shsvcs.dll [135168 2009-07-28] (Microsoft Corporation) [File not signed]
      S2 SkypeUpdate; C:\Program Files\Skype\Updater\Updater.exe [317400 2017-04-05] (Skype Technologies) [File not signed]
      R2 Spooler; C:\WINDOWS\system32\spoolsv.exe [58880 2010-08-17] (Microsoft Corporation) [File not signed]
      R2 Themes; C:\WINDOWS\System32\shsvcs.dll [135168 2009-07-28] (Microsoft Corporation) [File not signed]
      S3 Wmi; C:\WINDOWS\System32\advapi32.dll [617472 2009-02-09] (Microsoft Corporation) [File not signed]
      S2 hpqddsvc; C:\Program Files\HP\Digital Imaging\bin\hpqddsvc.dll [X]
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R1 AFD; C:\WINDOWS\System32\drivers\afd.sys [138496 2011-08-17] (Microsoft Corporation) [File not signed]
      R1 AmdK8; C:\WINDOWS\System32\DRIVERS\AmdK8.sys [36864 2006-06-18] (Advanced Micro Devices)
      S3 CCDECODE; C:\WINDOWS\System32\DRIVERS\CCDECODE.sys [17024 2008-04-14] (Microsoft Corporation)
      R3 CVirtA; C:\WINDOWS\System32\DRIVERS\CVirtA.sys [5275 2007-01-18] (Cisco Systems, Inc.)
      R2 CVPNDRVA; C:\WINDOWS\system32\Drivers\CVPNDRVA.sys [308859 2010-03-23] (Cisco Systems, Inc.) [File not signed]
      R3 DNE; C:\WINDOWS\System32\DRIVERS\dne2000.sys [131984 2008-11-16] (Deterministic Networks, Inc.)
      R3 gzflt; C:\Program Files\Lavasoft\Ad-Aware Antivirus\Antimalware Engine\\gzflt.sys [175008 2016-04-28] (BitDefender LLC)
      R3 HPZid412; C:\WINDOWS\System32\DRIVERS\HPZid412.sys [49920 2007-01-19] (HP)
      R3 HPZipr12; C:\WINDOWS\System32\DRIVERS\HPZipr12.sys [16496 2007-01-19] (HP)
      R3 HPZius12; C:\WINDOWS\System32\DRIVERS\HPZius12.sys [21568 2007-01-19] (HP)
      R3 HTTP; C:\WINDOWS\System32\Drivers\HTTP.sys [265728 2009-10-20] (Microsoft Corporation) [File not signed]
      R3 IntcAzAudAddService; C:\WINDOWS\System32\drivers\RtkHDAud.sys [4368896 2006-08-15] (Realtek Semiconductor Corp.) [File not signed]
      R3 irsir; C:\WINDOWS\System32\DRIVERS\irsir.sys [18688 2001-08-17] (Microsoft Corporation)
      R0 KSecDD; C:\WINDOWS\system32\Drivers\KSecDD.sys [92928 2009-06-24] (Microsoft Corporation) [File not signed]
      R1 MRxSmb; C:\WINDOWS\System32\DRIVERS\mrxsmb.sys [456320 2011-07-15] (Microsoft Corporation) [File not signed]
      R0 Mup; C:\WINDOWS\system32\Drivers\Mup.sys [105472 2011-04-21] (Microsoft Corporation) [File not signed]
      S3 NdisIP; C:\WINDOWS\System32\DRIVERS\NdisIP.sys [10880 2008-04-14] (Microsoft Corporation)
      R3 NdisTapi; C:\WINDOWS\System32\DRIVERS\ndistapi.sys [10496 2011-07-08] (Microsoft Corporation) [File not signed]
      R3 NDProxy; C:\WINDOWS\system32\Drivers\NDProxy.sys [40960 2013-11-27] (Microsoft Corporation) [File not signed]
      R3 NVENETFD; C:\WINDOWS\System32\DRIVERS\NVENETFD.sys [57856 2006-07-11] (NVIDIA Corporation)
      R3 nvnetbus; C:\WINDOWS\System32\DRIVERS\nvnetbus.sys [20480 2006-07-11] (NVIDIA Corporation)
      R3 Rasirda; C:\WINDOWS\System32\DRIVERS\rasirda.sys [19584 2001-08-17] (Microsoft Corporation)
      S3 SNPSTD3; C:\WINDOWS\System32\DRIVERS\snpstd3.sys [10252544 2007-03-27] (Sonix Co. Ltd.)
      R3 Srv; C:\WINDOWS\System32\DRIVERS\srv.sys [357888 2011-02-17] (Microsoft Corporation) [File not signed]
      R1 Tcpip; C:\WINDOWS\System32\DRIVERS\tcpip.sys [361600 2008-06-20] (Microsoft Corporation) [File not signed]
      S3 Trufos; C:\WINDOWS\System32\DRIVERS\Trufos.sys [428832 2016-04-28] (BitDefender S.R.L.)
      S3 usbaudio; C:\WINDOWS\System32\drivers\usbaudio.sys [60160 2013-07-17] (Microsoft Corporation) [File not signed]
      R3 usbccgp; C:\WINDOWS\System32\DRIVERS\usbccgp.sys [32384 2013-08-09] (Microsoft Corporation) [File not signed]
      R3 usbehci; C:\WINDOWS\System32\DRIVERS\usbehci.sys [30336 2009-03-18] (Microsoft Corporation) [File not signed]
      S3 usbscan; C:\WINDOWS\System32\DRIVERS\usbscan.sys [14976 2013-07-03] (Microsoft Corporation) [File not signed]
      R3 vsdatant; C:\WINDOWS\system32\vsdatant.sys [394952 2007-11-14] (Zone Labs, LLC)
      S3 catchme; \??\C:\DOCUME~1\User1\LOCALS~1\Temp\catchme.sys [X]
      S4 IntelIde; no ImagePath
      S2 StarOpen; no ImagePath
      S1 ZAM; \??\C:\WINDOWS\System32\drivers\zam32.sys [X]
      S1 ZAM_Guard; \??\C:\WINDOWS\System32\drivers\zamguard32.sys [X]
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-08-30 15:49 - 2018-08-30 15:50 - 000014109 _____ C:\Documents and Settings\User1\Desktop\FRST.txt
      2018-08-30 15:15 - 2018-08-30 15:15 - 001773568 _____ (Farbar) C:\Documents and Settings\User1\Desktop\FRST.exe
      2018-08-10 12:36 - 2018-08-10 12:40 - 000000000 ____D C:\Documents and Settings\User2\Desktop\куче Анжело 0887999938
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-08-30 15:50 - 2015-07-18 13:46 - 000000000 ____D C:\Documents and Settings\User1\Local Settings\temp
      2018-08-30 15:49 - 2018-03-26 11:31 - 000000000 ____D C:\FRST
      2018-08-30 15:48 - 2011-05-02 12:46 - 000000000 ____D C:\Documents and Settings\User1\Application Data\uTorrent
      2018-08-30 15:31 - 2011-05-02 12:44 - 000000000 ____D C:\Program Files\Opera
      2018-08-30 14:58 - 2016-02-20 13:25 - 000000000 ____D C:\Documents and Settings\All Users\Application Data\MCShield
      2018-08-30 14:58 - 2015-06-22 14:14 - 000000222 _____ C:\WINDOWS\Tasks\Microsoft Windows XP End of Service Notification Logon.job
      2018-08-30 14:58 - 2015-06-22 14:14 - 000000216 _____ C:\WINDOWS\Tasks\Microsoft Windows XP End of Service Notification Monthly.job
      2018-08-30 14:58 - 2011-05-02 10:20 - 000000006 ____H C:\WINDOWS\Tasks\SA.DAT
      2018-08-30 14:57 - 2018-03-27 15:50 - 000032638 _____ C:\WINDOWS\SchedLgU.Txt
      2018-08-30 14:57 - 2011-05-02 12:10 - 000000178 ___SH C:\Documents and Settings\User1\ntuser.ini
      2018-08-30 14:57 - 2011-05-02 12:10 - 000000000 ____D C:\Documents and Settings\User1
      2018-08-30 14:55 - 2013-03-08 15:11 - 000001078 _____ C:\WINDOWS\Tasks\GoogleUpdateTaskUserS-1-5-21-220523388-412668190-1417001333-1003UA.job
      2018-08-30 14:47 - 2015-04-26 09:48 - 000000000 ____D C:\Documents and Settings\User2\Application Data\Skype
      2018-08-30 14:47 - 2011-05-02 13:28 - 000000000 ____D C:\Documents and Settings\User2\Local Settings\Temp
      2018-08-30 12:55 - 2013-03-08 15:11 - 000001026 _____ C:\WINDOWS\Tasks\GoogleUpdateTaskUserS-1-5-21-220523388-412668190-1417001333-1003Core.job
      2018-08-30 07:50 - 2001-08-23 12:00 - 000002206 _____ C:\WINDOWS\system32\wpa.dbl
      2018-08-25 12:48 - 2017-01-16 13:16 - 000000892 _____ C:\WINDOWS\Tasks\Adobe Flash Player PPAPI Notifier.job
      2018-08-25 12:48 - 2011-05-02 10:10 - 000000000 ____D C:\WINDOWS\system32\Macromed
      2018-08-09 12:25 - 2011-05-16 16:38 - 000000000 ____D C:\Program Files\Recuva
      2018-08-02 14:29 - 2013-12-09 13:51 - 000000000 ____D C:\Documents and Settings\User2\Desktop\образци PDF
      ==================== Files in the root of some directories =======
      2011-05-02 13:33 - 2014-09-24 16:20 - 000014848 _____ () C:\Documents and Settings\User1\Local Settings\Application Data\DCBC2A71-70D8-4DAN-EHR8-E0D61DEA3FDF.ini
      2014-01-01 13:07 - 2014-01-01 13:07 - 000000036 _____ () C:\Documents and Settings\User1\Local Settings\Application Data\housecall.guid.cache
      2011-05-15 13:35 - 2011-05-15 13:35 - 000000056 _____ () C:\Documents and Settings\All Users\Application Data\ezsidmv.dat
      2017-09-02 12:57 - 2018-04-11 15:32 - 000021736 _____ () C:\Documents and Settings\All Users\Application Data\hpzinstall.log
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\WINDOWS\explorer.exe => File is digitally signed
      C:\WINDOWS\system32\winlogon.exe => File is digitally signed
      C:\WINDOWS\system32\svchost.exe => File is digitally signed
      C:\WINDOWS\system32\services.exe => MD5 is legit
      C:\WINDOWS\system32\User32.dll => File is digitally signed
      C:\WINDOWS\system32\userinit.exe => File is digitally signed
      C:\WINDOWS\system32\rpcss.dll => MD5 is legit
      C:\WINDOWS\system32\dnsapi.dll => MD5 is legit
      C:\WINDOWS\system32\Drivers\volsnap.sys => File is digitally signed
      ==================== End of FRST.txt ============================
    • от d1cho
      Привет преди два дни ми изпищя windows defender-a и антивируснта програма,пише, че гадината е Trojan:Win32/Killav.DR. Компютрите са в мрежа, единя е с vista business 64 bit, a другия с windows 10 32bit. Този с vistata не ми да ва да включа защитната стена и да инсталриам антивирусна. Мъчих компютъра с windows 10 с различни антивирусни понеже ми позволява да инсталриам,но само ги слага под карантина,а мен ме е страх да ги трия понеже имаме софтуер за работа и ме тревожи да не би да повредя нещо и да замине информацията.
      Моля за съдействие, понеже е почти невъзможно да се работи на компютрите.
      Ето тоша ми е от лог файла на компѝтъра с вистата FRST.txt
      Scan result of Farbar Recovery Scan Tool (FRST) (x64) Version: 02.08.2018
      Ran by DBPROTOOLS (administrator) on DBPROTOOLS-PC (17-08-2018 10:17:44)
      Running from C:\Users\DBPROTOOLS\Desktop
      Loaded Profiles: DBPROTOOLS (Available Profiles: DBPROTOOLS)
      Platform: Windows Vista (TM) Business Service Pack 2 (X64) Language: English (United States)
      Internet Explorer Version 7 (Default browser: Chrome)
      Boot Mode: Normal
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      (Microsoft Corporation) C:\Windows\System32\SLsvc.exe
      (TeamViewer GmbH) C:\Program Files (x86)\TeamViewer\TeamViewer_Service.exe
      () C:\Windows\zqmeyojeujuakpbxqoc.exe
      (Microsoft Corporation) C:\Program Files\Windows Sidebar\sidebar.exe
      (Brother Industries, Ltd.) C:\Program Files (x86)\Browny02\Brother\BrStMonW.exe
      (Brother Industries, Ltd.) C:\Program Files (x86)\BrownyInd\Brother\BrIndicator.exe
      (Brother Industries, Ltd.) C:\Program Files (x86)\ControlCenter4\BrCtrlCntr.exe
      (Brother Industries, Ltd.) C:\Program Files (x86)\Browny02\BrYNSvc.exe
      () C:\Users\DBPROTOOLS\AppData\Local\Temp\zeoucgp.exe
      () C:\Users\DBPROTOOLS\AppData\Local\Temp\zeoucgp.exe
      (Brother Industries, Ltd.) C:\Program Files (x86)\ControlCenter4\BrCcUxSys.exe
      (TeamViewer GmbH) C:\Program Files (x86)\TeamViewer\TeamViewer.exe
      (TeamViewer GmbH) C:\Program Files (x86)\TeamViewer\tv_w32.exe
      (TeamViewer GmbH) C:\Program Files (x86)\TeamViewer\tv_x64.exe
      (Microsoft Corporation) C:\Windows\SysWOW64\conime.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files (x86)\Google\Chrome\Application\chrome.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [Windows Defender] => C:\Program Files\Windows Defender\MSASCui.exe [1584184 2008-01-21] (Microsoft Corporation)
      HKLM-x32\...\Run: [ControlCenter4] => C:\Program Files (x86)\ControlCenter4\BrCcBoot.exe [139264 2013-01-23] (Brother Industries, Ltd.)
      HKLM-x32\...\Run: [BrStsMon00] => C:\Program Files (x86)\Browny02\Brother\BrStMonW.exe [4509184 2012-12-27] (Brother Industries, Ltd.)
      HKLM-x32\...\Run: [BrStsInd00] => C:\Program Files (x86)\BrownyInd\Brother\BrIndicator.exe [1885184 2012-12-18] (Brother Industries, Ltd.)
      HKLM-x32\...\Run: [mqzelo] => C:\Windows\fuoewkdwkxgksvfzq.exe [503808 2018-08-17] ()
      HKLM-x32\...\Run: [qapanwkyhpts] => C:\Users\DBPROTOOLS\AppData\Local\Temp\fuoewkdwkxgksvfzq.exe [503808 2018-08-16] () <==== ATTENTION
      HKLM-x32\...\RunOnce: [zeoucgp] => mebupgcypfryjpcztshe.exe .
      HKLM-x32\...\RunOnce: [tcqamuhucjm] => C:\Users\DBPROTOOLS\AppData\Local\Temp\zqmeyojeujuakpbxqoc.exe . [503808 2018-08-16] () <==== ATTENTION
      HKLM\...\Policies\Explorer\Run: [oufmvaku] => C:\Windows\zqmeyojeujuakpbxqoc.exe [503808 2018-08-16] ()
      HKLM\...\Policies\Explorer\Run: [bemqw] => C:\Users\DBPROTOOLS\AppData\Local\Temp\fuoewkdwkxgksvfzq.exe [503808 2018-08-16] ()
      HKU\S-1-5-21-3181692578-1277306937-1901717452-1000\...\Run: [fmygqwhsy] => C:\Windows\oezqjysmbpzenrcxpm.exe [503808 2018-08-17] ()
      HKU\S-1-5-21-3181692578-1277306937-1901717452-1000\...\Run: [mqzelo] => C:\Users\DBPROTOOLS\AppData\Local\Temp\ymfulyqivhpszbkd.exe [503808 2018-08-16] () <==== ATTENTION
      HKU\S-1-5-21-3181692578-1277306937-1901717452-1000\...\RunOnce: [ygtcnugszf] => fuoewkdwkxgksvfzq.exe .
      HKU\S-1-5-21-3181692578-1277306937-1901717452-1000\...\RunOnce: [zeoucgp] => C:\Users\DBPROTOOLS\AppData\Local\Temp\oezqjysmbpzenrcxpm.exe . [503808 2018-08-16] () <==== ATTENTION
      HKU\S-1-5-21-3181692578-1277306937-1901717452-1000\...\Policies\system: [DisableRegistryTools] 1
      HKU\S-1-5-21-3181692578-1277306937-1901717452-1000\...\MountPoints2: {175dbd82-9a45-11e8-861a-0019990d7d87} - E:\tyquftktfbz.bat
      HKU\S-1-5-21-3181692578-1277306937-1901717452-1000\...\MountPoints2: {1b56a57f-9a44-11e8-a149-8748c642f7d2} - E:\setup.exe
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      Tcpip\Parameters: [DhcpNameServer]
      Tcpip\..\Interfaces\{16F65250-913D-4F56-B2DA-49AF5C765191}: [DhcpNameServer]
      Internet Explorer:
      HKLM\Software\Microsoft\Internet Explorer\Main,Local Page = %SystemRoot%\system32\blank.htm
      HKLM\Software\Wow6432Node\Microsoft\Internet Explorer\Main,Local Page = %SystemRoot%\system32\blank.htm
      SearchScopes: HKLM -> {0633EE93-D776-472f-A0FF-E1416B8B2E3A} URL = hxxp://search.live.com/results.aspx?q={searchTerms}&src={referrer:source?}
      SearchScopes: HKLM-x32 -> {0633EE93-D776-472f-A0FF-E1416B8B2E3A} URL = hxxp://search.live.com/results.aspx?q={searchTerms}&src={referrer:source?}
      SearchScopes: HKU\S-1-5-21-3181692578-1277306937-1901717452-1000 -> {0633EE93-D776-472f-A0FF-E1416B8B2E3A} URL = hxxp://search.live.com/results.aspx?q={searchTerms}&src={referrer:source?}
      Filter: deflate - {8f6b0360-b80d-11d0-a9b3-006097942311} - C:\Windows\system32\urlmon.dll [2009-04-11] (Microsoft Corporation)
      Filter-x32: deflate - {8f6b0360-b80d-11d0-a9b3-006097942311} - C:\Windows\SysWOW64\urlmon.dll [2009-04-11] (Microsoft Corporation)
      Filter: gzip - {8f6b0360-b80d-11d0-a9b3-006097942311} - C:\Windows\system32\urlmon.dll [2009-04-11] (Microsoft Corporation)
      Filter-x32: gzip - {8f6b0360-b80d-11d0-a9b3-006097942311} - C:\Windows\SysWOW64\urlmon.dll [2009-04-11] (Microsoft Corporation)
      FF Plugin-x32: @tools.google.com/Google Update;version=3 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [2018-08-06] (Google Inc.)
      FF Plugin-x32: @tools.google.com/Google Update;version=9 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [2018-08-06] (Google Inc.)
      CHR Profile: C:\Users\DBPROTOOLS\AppData\Local\Google\Chrome\User Data\Default [2018-08-17]
      CHR Extension: (Slides) - C:\Users\DBPROTOOLS\AppData\Local\Google\Chrome\User Data\Default\Extensions\aapocclcgogkmnckokdopfmhonfmgoek [2018-08-07]
      CHR Extension: (Docs) - C:\Users\DBPROTOOLS\AppData\Local\Google\Chrome\User Data\Default\Extensions\aohghmighlieiainnegkcijnfilokake [2018-08-07]
      CHR Extension: (Google Drive) - C:\Users\DBPROTOOLS\AppData\Local\Google\Chrome\User Data\Default\Extensions\apdfllckaahabafndbhieahigkjlhalf [2018-08-07]
      CHR Extension: (YouTube) - C:\Users\DBPROTOOLS\AppData\Local\Google\Chrome\User Data\Default\Extensions\blpcfgokakmgnkcojhhkbfbldkacnbeo [2018-08-07]
      CHR Extension: (Sheets) - C:\Users\DBPROTOOLS\AppData\Local\Google\Chrome\User Data\Default\Extensions\felcaaldnbdncclmgdcncolpebgiejap [2018-08-07]
      CHR Extension: (Google Docs Offline) - C:\Users\DBPROTOOLS\AppData\Local\Google\Chrome\User Data\Default\Extensions\ghbmnnjooekpmoecnnnilnnbdlolhkhi [2018-08-07]
      CHR Extension: (Chrome Web Store Payments) - C:\Users\DBPROTOOLS\AppData\Local\Google\Chrome\User Data\Default\Extensions\nmmhkkegccagdldgiimedpiccmgmieda [2018-08-07]
      CHR Extension: (Gmail) - C:\Users\DBPROTOOLS\AppData\Local\Google\Chrome\User Data\Default\Extensions\pjkljhegncpnkpknbcohdijeoejaedia [2018-08-07]
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R3 BrYNSvc; C:\Program Files (x86)\Browny02\BrYNSvc.exe [282112 2012-10-26] (Brother Industries, Ltd.) [File not signed]
      R2 TeamViewer; C:\Program Files (x86)\TeamViewer\TeamViewer_Service.exe [11644656 2018-08-13] (TeamViewer GmbH)
      S2 WinDefend; C:\Program Files\Windows Defender\mpsvc.dll [383544 2008-01-21] (Microsoft Corporation)
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      S3 IpInIp; system32\DRIVERS\ipinip.sys [X]
      S3 NwlnkFlt; system32\DRIVERS\nwlnkflt.sys [X]
      S3 NwlnkFwd; system32\DRIVERS\nwlnkfwd.sys [X]
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-08-17 10:17 - 2018-08-17 10:18 - 000008964 _____ C:\Users\DBPROTOOLS\Desktop\FRST.txt
      2018-08-17 10:16 - 2018-08-17 10:17 - 000000000 ____D C:\FRST
      2018-08-17 10:15 - 2018-08-17 10:15 - 002412544 _____ (Farbar) C:\Users\DBPROTOOLS\Desktop\FRST64.exe
      2018-08-17 09:35 - 2018-08-17 09:36 - 046625016 _____ (Microsoft Corporation) C:\Users\DBPROTOOLS\Downloads\Windows-KB890830-x64-V5.63.exe
      2018-08-16 12:03 - 2018-08-16 12:03 - 000000000 ____D C:\ProgramData\AVG
      2018-08-16 12:02 - 2018-08-16 11:36 - 007460520 _____ (AVG Technologies CZ, s.r.o.) C:\Users\DBPROTOOLS\Desktop\avg_antivirus_free_setup.exe
      2018-08-15 16:13 - 2018-08-15 16:33 - 000038147 _____ C:\Users\DBPROTOOLS\Documents\ПРОТОКОЛ КОНСИГНАЦИЯ.odt
      2018-08-15 10:04 - 2018-08-17 10:18 - 000000272 ____H C:\Windows\SysWOW64\dacaawxyupgsitlnmqkmj.vgd
      2018-08-15 10:04 - 2018-08-17 10:18 - 000000272 ____H C:\Windows\dacaawxyupgsitlnmqkmj.vgd
      2018-08-15 10:04 - 2018-08-17 10:18 - 000000272 ____H C:\Program Files (x86)\dacaawxyupgsitlnmqkmj.vgd
      2018-08-15 10:03 - 2018-08-17 10:16 - 000503808 __RSH C:\Windows\ymfulyqivhpszbkd.exe
      2018-08-15 10:03 - 2018-08-17 10:16 - 000503808 __RSH C:\Windows\smlgdwusldranvkjfgxwqy.exe
      2018-08-15 10:03 - 2018-08-17 10:16 - 000503808 __RSH C:\Windows\oezqjysmbpzenrcxpm.exe
      2018-08-15 10:03 - 2018-08-17 10:16 - 000503808 __RSH C:\Windows\mebupgcypfryjpcztshe.exe
      2018-08-15 10:03 - 2018-08-17 10:16 - 000503808 __RSH C:\Windows\fuoewkdwkxgksvfzq.exe
      2018-08-15 10:03 - 2018-08-17 10:16 - 000503808 __RSH C:\Windows\busmiaxumdqykrfdyyomf.exe
      2018-08-15 10:03 - 2018-08-16 17:01 - 000503808 __RSH C:\Windows\zqmeyojeujuakpbxqoc.exe
      2018-08-15 10:03 - 2018-08-16 17:01 - 000503808 __RSH C:\Windows\SysWOW64\zqmeyojeujuakpbxqoc.exe
      2018-08-15 10:03 - 2018-08-16 17:01 - 000503808 __RSH C:\Windows\SysWOW64\ymfulyqivhpszbkd.exe
      2018-08-15 10:03 - 2018-08-16 17:01 - 000503808 __RSH C:\Windows\SysWOW64\smlgdwusldranvkjfgxwqy.exe
      2018-08-15 10:03 - 2018-08-16 17:01 - 000503808 __RSH C:\Windows\SysWOW64\oezqjysmbpzenrcxpm.exe
      2018-08-15 10:03 - 2018-08-16 17:01 - 000503808 __RSH C:\Windows\SysWOW64\mebupgcypfryjpcztshe.exe
      2018-08-15 10:03 - 2018-08-16 17:01 - 000503808 __RSH C:\Windows\SysWOW64\fuoewkdwkxgksvfzq.exe
      2018-08-15 10:03 - 2018-08-15 10:03 - 000503808 __RSH C:\Windows\SysWOW64\busmiaxumdqykrfdyyomf.exe
      2018-08-08 19:55 - 2018-08-08 19:55 - 000000586 _____ C:\Users\DBPROTOOLS\Desktop\control8.lnk
      2018-08-08 19:53 - 2018-08-08 19:54 - 000000586 _____ C:\Users\DBPROTOOLS\Desktop\control7.lnk
      2018-08-08 10:50 - 2018-08-08 10:51 - 000000000 ___HD C:\Program Files (x86)\Temp
      2018-08-08 10:49 - 2018-08-08 10:49 - 020227746 _____ C:\Users\DBPROTOOLS\Downloads\FTS_RealtekHDAudio_6015911_1039707.zip
      2018-08-08 10:36 - 2018-08-08 10:36 - 000529696 _____ (Fujitsu) C:\Users\DBPROTOOLS\Downloads\AutoDetect_CR.exe
      2018-08-08 10:19 - 2018-08-08 10:19 - 000870768 _____ (PDFLogic Corporation ) C:\Users\DBPROTOOLS\Downloads\pdfvista.exe
      2018-08-08 10:14 - 2018-08-08 10:14 - 000127389 _____ C:\Users\DBPROTOOLS\Downloads\received_1656658347796650.jpeg
      2018-08-08 09:51 - 2018-08-08 09:51 - 000131068 _____ C:\Users\DBPROTOOLS\Downloads\ACFrOgD5qMx8urBDsFoSA7F_JPxuDeiEhFOgmeQLIU44kuc2fxOLoZfY-xq9ebf1sM-mw4X0coR12Y2kOz69foLufsDyMtHGIiFwi_Ya2E4BRTKHCOlw-VxJoiTp7S8=
      2018-08-08 09:41 - 2018-08-08 09:41 - 000949332 _____ (Vivid Document Imaging Technologies ) C:\Users\DBPROTOOLS\Downloads\PDFViewerSetup (1).exe
      2018-08-08 09:40 - 2018-08-16 12:03 - 000000000 ____D C:\Users\DBPROTOOLS\AppData\Roaming\YcanPDF
      2018-08-08 09:39 - 2018-08-08 09:39 - 003451040 _____ (PDFZilla, Inc. ) C:\Users\DBPROTOOLS\Downloads\freepdfreader.exe
      2018-08-07 17:15 - 2018-08-07 17:15 - 000008192 ___RS C:\BOOTSECT.BAK
      2018-08-07 17:15 - 2018-08-07 16:22 - 000000000 ____D C:\Windows\Panther
      2018-08-07 17:15 - 2009-04-11 19:22 - 000333257 __RSH C:\bootmgr
      2018-08-07 16:21 - 2018-08-07 16:21 - 000000000 ____H C:\Windows\system32\Drivers\Msft_User_WpdFs_01_00_00.Wdf
      2018-08-07 16:18 - 2018-08-07 16:18 - 000000000 ____D C:\Windows\CSC
      2018-08-07 12:34 - 2018-08-07 12:34 - 000044749 _____ C:\Users\DBPROTOOLS\Downloads\logo_db_protools.pdf
      2018-08-07 12:29 - 2018-08-07 12:29 - 001207800 _____ (Adobe Systems Incorporated) C:\Users\DBPROTOOLS\Downloads\readerdc_en_ha_install.exe
      2018-08-07 12:27 - 2018-08-07 12:27 - 000949332 _____ (Vivid Document Imaging Technologies ) C:\Users\DBPROTOOLS\Downloads\PDFViewerSetup.exe
      2018-08-07 12:22 - 2018-08-07 12:22 - 000004088 ____H C:\Users\DBPROTOOLS\AppData\Local\ygtcnugszfhefberbqviqmyucpyjqcov.dab
      2018-08-07 12:20 - 2018-08-17 10:18 - 000000272 ____H C:\Users\DBPROTOOLS\AppData\Local\dacaawxyupgsitlnmqkmj.vgd
      2018-08-07 12:19 - 2018-08-07 12:19 - 000000000 ____D C:\Users\DBPROTOOLS\Desktop\Оферти Доставчици
      2018-08-07 12:16 - 2018-08-07 12:16 - 000000000 ____D C:\Users\DBPROTOOLS\AppData\Roaming\ControlCenter4
      2018-08-07 12:13 - 2018-08-07 12:13 - 000001975 _____ C:\Users\Public\Desktop\Brother Creative Center.lnk
      2018-08-07 12:13 - 2018-08-07 12:13 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Brother
      2018-08-07 12:11 - 2018-08-07 12:11 - 000000000 ____D C:\ProgramData\ControlCenter4
      2018-08-07 12:11 - 2018-08-07 12:11 - 000000000 ____D C:\Program Files (x86)\ControlCenter4
      2018-08-07 12:11 - 2018-08-07 12:11 - 000000000 ____D C:\Program Files (x86)\BrownyInd
      2018-08-07 12:11 - 2018-08-07 12:11 - 000000000 ____D C:\Program Files (x86)\Browny02
      2018-08-07 12:11 - 2018-08-07 12:11 - 000000000 ____D C:\Brother
      2018-08-07 12:11 - 2012-12-14 04:31 - 000180224 _____ (Brother Industries, Ltd.) C:\Windows\SysWOW64\BROSNMP.DLL
      2018-08-07 12:11 - 2012-12-14 04:31 - 000113744 _____ (Brother Industries Ltd) C:\Windows\SysWOW64\BRRBTOOL.EXE
      2018-08-07 12:11 - 2012-12-14 04:31 - 000077824 _____ (Brother Industries, Ltd.) C:\Windows\SysWOW64\BRLMW03A.DLL
      2018-08-07 12:11 - 2012-12-14 04:31 - 000045056 _____ C:\Windows\SysWOW64\BRTCPCON.DLL
      2018-08-07 12:11 - 2012-12-14 04:31 - 000025299 _____ (Brother Industries, Ltd) C:\Windows\SysWOW64\BRLM03A.DLL
      2018-08-07 12:11 - 2012-12-14 04:31 - 000000114 _____ C:\Windows\SysWOW64\BRLMW03A.INI
      2018-08-07 12:11 - 2012-12-14 04:29 - 000000050 _____ C:\Windows\system32\BRADM12A.DAT
      2018-08-07 12:11 - 2012-12-13 19:00 - 000226816 _____ (Brother Industries, Ltd.) C:\Windows\system32\BRCOM12A.DLL
      2018-08-07 12:11 - 2012-10-19 15:07 - 001441792 _____ (Brother Industries, Ltd.) C:\Windows\system32\BrWi212c.dll
      2018-08-07 12:11 - 2012-10-19 15:03 - 000054272 _____ (Brother Industries, Ltd.) C:\Windows\system32\BrUsi12c.dll
      2018-08-07 12:11 - 2012-07-06 13:56 - 000012800 _____ (Brother Industries Ltd.) C:\Windows\system32\BrCiImg.dll
      2018-08-07 12:11 - 2011-09-08 12:36 - 000279040 _____ (Brother Industries, Ltd.) C:\Windows\system32\BrJDec.dll
      2018-08-07 12:10 - 2018-08-07 12:11 - 000000000 ____D C:\Program Files (x86)\Brother
      2018-08-07 12:10 - 2018-08-07 12:10 - 000000000 ___HD C:\Program Files (x86)\InstallShield Installation Information
      2018-08-07 12:10 - 2012-11-02 18:15 - 000245760 ____N (brother) C:\Windows\SysWOW64\NSSearch.dll
      2018-08-07 12:10 - 2012-02-02 11:21 - 000002560 ____N (Brother Industries Ltd.) C:\Windows\SysWOW64\BrDctF2S.dll
      2018-08-07 12:10 - 2010-03-15 19:45 - 000073728 ____N (Brother Industries Ltd.) C:\Windows\SysWOW64\BrDctF2.dll
      2018-08-07 12:10 - 2007-12-13 22:16 - 000005120 ____N (Brother Industries Ltd.) C:\Windows\SysWOW64\BrDctF2L.dll
      2018-08-07 12:09 - 2018-08-07 12:13 - 000000000 ____D C:\ProgramData\Brother
      2018-08-07 12:09 - 2018-08-07 12:09 - 000000000 ____D C:\Users\DBPROTOOLS\Downloads\install
      2018-08-07 12:08 - 2018-08-07 12:08 - 141297272 _____ (A.I.SOFT,INC.) C:\Users\DBPROTOOLS\Downloads\DCP-1510-inst-A1-eeu.EXE
      2018-08-07 10:22 - 2018-08-07 10:22 - 000000000 ____D C:\Users\DBPROTOOLS\AppData\Roaming\OpenOffice
      2018-08-07 10:12 - 2018-08-07 10:12 - 000000985 _____ C:\Users\Public\Desktop\OpenOffice 4.1.5.lnk
      2018-08-07 10:12 - 2018-08-07 10:12 - 000000000 ___SD C:\ProgramData\Microsoft\Windows\Start Menu\Programs\OpenOffice 4.1.5
      2018-08-07 10:12 - 2018-08-07 10:12 - 000000000 ____D C:\Program Files (x86)\OpenOffice 4
      2018-08-07 09:45 - 2018-08-07 09:46 - 000456080 _____ C:\Users\DBPROTOOLS\AppData\Local\dd_vcredistMSI22E4.txt
      2018-08-07 09:45 - 2018-08-07 09:46 - 000011632 _____ C:\Users\DBPROTOOLS\AppData\Local\dd_vcredistUI22E4.txt
      2018-08-07 09:44 - 2018-08-07 09:45 - 000452836 _____ C:\Users\DBPROTOOLS\AppData\Local\dd_vcredistMSI223D.txt
      2018-08-07 09:44 - 2018-08-07 09:45 - 000011616 _____ C:\Users\DBPROTOOLS\AppData\Local\dd_vcredistUI223D.txt
      2018-08-07 09:44 - 2018-08-07 09:44 - 000000000 ____D C:\Users\DBPROTOOLS\Desktop\OpenOffice 4.1.5 (bg) Installation Files
      2018-08-07 09:40 - 2018-08-07 09:40 - 013057882 _____ C:\Users\DBPROTOOLS\Downloads\Apache_OpenOffice_4.1.5_Win_x86_langpack_bg.exe
      2018-08-07 09:40 - 2018-08-07 09:40 - 000000000 ____D C:\Users\DBPROTOOLS\Desktop\OpenOffice 4.1.5 Language Pack (Bulgarian) Installation Files
      2018-08-07 09:39 - 2018-08-07 09:40 - 129515834 _____ C:\Users\DBPROTOOLS\Downloads\Apache_OpenOffice_4.1.5_Win_x86_install_bg.exe
      2018-08-07 09:34 - 2018-08-07 09:34 - 000000000 ____D C:\Users\DBPROTOOLS\Desktop\Нова папка
      2018-08-07 09:34 - 2013-06-28 14:49 - 001732096 _____ (Atheros Communications, Inc.) C:\Windows\system32\Drivers\athurx.sys
      2018-08-07 09:31 - 2018-08-07 09:32 - 245571584 _____ C:\Users\DBPROTOOLS\Downloads\LibreOffice_5.4.7_Win_x64.msi
      2018-08-07 07:22 - 2018-08-08 09:45 - 000054608 _____ C:\Users\DBPROTOOLS\AppData\Local\GDIPFONTCACHEV1.DAT
      2018-08-07 07:22 - 2018-08-07 07:22 - 000000979 _____ C:\Users\DBPROTOOLS\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Internet Explorer.lnk
      2018-08-07 07:22 - 2018-08-07 07:22 - 000000974 _____ C:\Users\DBPROTOOLS\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Windows Media Player.lnk
      2018-08-07 07:22 - 2018-08-07 07:22 - 000000949 _____ C:\Users\DBPROTOOLS\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Internet Explorer (64-bit).lnk
      2018-08-07 07:21 - 2018-08-16 17:01 - 000000732 _____ C:\Users\DBPROTOOLS\AppData\Local\d3d9caps64.dat
      2018-08-07 07:21 - 2018-08-10 15:00 - 000000000 ____D C:\Users\DBPROTOOLS
      2018-08-07 07:21 - 2018-08-07 12:20 - 000000000 ____D C:\Users\DBPROTOOLS\AppData\Local\VirtualStore
      2018-08-07 07:21 - 2018-08-07 07:22 - 000000915 _____ C:\Users\DBPROTOOLS\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Windows Mail.lnk
      2018-08-07 07:21 - 2018-08-07 07:21 - 000000020 ___SH C:\Users\DBPROTOOLS\ntuser.ini
      2018-08-07 00:53 - 2018-08-16 17:02 - 000000680 _____ C:\Users\DBPROTOOLS\AppData\Local\d3d9caps.dat
      2018-08-07 00:52 - 2018-08-16 17:01 - 000000000 ____D C:\Program Files (x86)\TeamViewer
      2018-08-07 00:52 - 2018-08-15 06:17 - 000000882 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\TeamViewer 13.lnk
      2018-08-07 00:52 - 2018-08-15 06:17 - 000000870 _____ C:\Users\Public\Desktop\TeamViewer 13.lnk
      2018-08-07 00:52 - 2018-08-07 00:52 - 000000000 ____D C:\Users\DBPROTOOLS\AppData\Roaming\TeamViewer
      2018-08-07 00:51 - 2018-08-07 00:51 - 020688888 _____ (TeamViewer GmbH) C:\Users\DBPROTOOLS\Downloads\TeamViewer_Setup.exe
      2018-08-07 00:47 - 2018-08-07 00:47 - 000002037 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Google Chrome.lnk
      2018-08-07 00:47 - 2018-08-07 00:47 - 000002025 _____ C:\Users\Public\Desktop\Google Chrome.lnk
      2018-08-07 00:47 - 2018-08-07 00:47 - 000000000 ____D C:\Users\DBPROTOOLS\AppData\Local\Google
      2018-08-07 00:47 - 2018-08-07 00:47 - 000000000 ____D C:\Users\DBPROTOOLS\AppData\Local\Deployment
      2018-08-07 00:47 - 2018-08-07 00:47 - 000000000 ____D C:\Users\DBPROTOOLS\AppData\Local\Apps\2.0
      2018-08-07 00:47 - 2018-08-07 00:47 - 000000000 ____D C:\Program Files (x86)\Google
      2018-08-07 00:47 - 2018-08-06 16:30 - 000003332 _____ C:\Windows\System32\Tasks\GoogleUpdateTaskMachineUA
      2018-08-07 00:47 - 2018-08-06 16:30 - 000003204 _____ C:\Windows\System32\Tasks\GoogleUpdateTaskMachineCore
      2018-08-06 19:35 - 2018-08-06 19:35 - 000000000 ____D C:\Users\DBPROTOOLS\AppData\Local\TeamViewer
      2018-08-06 16:30 - 2018-08-06 16:30 - 000000693 _____ C:\Users\DBPROTOOLS\Desktop\Downloads - Shortcut.lnk
      2018-08-06 16:29 - 2018-08-06 16:29 - 000000000 ____D C:\Program Files (x86)\GUM4368.tmp
      2018-08-06 14:37 - 2018-08-06 14:38 - 274317312 _____ C:\Users\DBPROTOOLS\Downloads\LibreOffice_6.0.6_Win_x64.msi
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-08-17 09:01 - 2006-11-02 18:20 - 000005024 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-2P-1.C7483456-A289-439d-8115-601632D005A0
      2018-08-17 09:01 - 2006-11-02 18:20 - 000005024 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-2P-0.C7483456-A289-439d-8115-601632D005A0
      2018-08-16 17:08 - 2006-11-02 16:33 - 000000000 ____D C:\Windows\inf
      2018-08-16 17:08 - 2006-11-02 15:46 - 000690960 _____ C:\Windows\system32\PerfStringBackup.INI
      2018-08-16 17:01 - 2006-11-02 18:38 - 000000006 ____H C:\Windows\Tasks\SA.DAT
      2018-08-16 14:51 - 2006-11-02 18:38 - 000011762 _____ C:\Windows\Tasks\SCHEDLGU.TXT
      2018-08-08 09:44 - 2006-11-02 18:20 - 000256016 _____ C:\Windows\system32\FNTCACHE.DAT
      2018-08-07 17:15 - 2006-11-02 18:05 - 000262144 _____ C:\Windows\system32\config\BCD-Template
      2018-08-07 09:44 - 2006-11-02 16:33 - 000000000 ____D C:\Program Files\Common Files\Microsoft Shared
      2018-08-07 09:43 - 2006-11-02 16:34 - 000000000 ____D C:\Windows\system32\NDF
      2018-08-07 07:21 - 2006-11-02 16:33 - 000000000 ____D C:\Windows\rescache
      ==================== Files in the root of some directories =======
      2018-08-15 10:04 - 2018-08-17 10:18 - 000000272 ____H () C:\Program Files (x86)\dacaawxyupgsitlnmqkmj.vgd
      2018-08-07 00:53 - 2018-08-16 17:02 - 000000680 _____ () C:\Users\DBPROTOOLS\AppData\Local\d3d9caps.dat
      2018-08-07 07:21 - 2018-08-16 17:01 - 000000732 _____ () C:\Users\DBPROTOOLS\AppData\Local\d3d9caps64.dat
      2018-08-07 12:20 - 2018-08-17 10:18 - 000000272 ____H () C:\Users\DBPROTOOLS\AppData\Local\dacaawxyupgsitlnmqkmj.vgd
      2018-08-07 09:44 - 2018-08-07 09:45 - 000452836 _____ () C:\Users\DBPROTOOLS\AppData\Local\dd_vcredistMSI223D.txt
      2018-08-07 09:45 - 2018-08-07 09:46 - 000456080 _____ () C:\Users\DBPROTOOLS\AppData\Local\dd_vcredistMSI22E4.txt
      2018-08-07 09:44 - 2018-08-07 09:45 - 000011616 _____ () C:\Users\DBPROTOOLS\AppData\Local\dd_vcredistUI223D.txt
      2018-08-07 09:45 - 2018-08-07 09:46 - 000011632 _____ () C:\Users\DBPROTOOLS\AppData\Local\dd_vcredistUI22E4.txt
      2018-08-07 12:22 - 2018-08-07 12:22 - 000004088 ____H () C:\Users\DBPROTOOLS\AppData\Local\ygtcnugszfhefberbqviqmyucpyjqcov.dab
      Files to move or delete:
      C:\Users\DBPROTOOLS\AppData\Local\Temp\zqmeyojeujuakpbxqoc.exe .
      C:\Users\DBPROTOOLS\AppData\Local\Temp\oezqjysmbpzenrcxpm.exe .

      Some files in TEMP:
      2018-08-15 10:03 - 2018-08-16 17:02 - 000503808 __RSH () C:\Users\DBPROTOOLS\AppData\Local\Temp\busmiaxumdqykrfdyyomf.exe
      2018-08-15 10:03 - 2018-08-16 17:02 - 000503808 __RSH () C:\Users\DBPROTOOLS\AppData\Local\Temp\fuoewkdwkxgksvfzq.exe
      2018-08-07 12:20 - 2018-08-07 12:20 - 000327680 _____ () C:\Users\DBPROTOOLS\AppData\Local\Temp\gegdhvgwcqz.exe
      2018-08-15 10:03 - 2018-08-16 17:02 - 000503808 __RSH () C:\Users\DBPROTOOLS\AppData\Local\Temp\mebupgcypfryjpcztshe.exe
      2018-08-15 10:03 - 2018-08-16 17:02 - 000503808 __RSH () C:\Users\DBPROTOOLS\AppData\Local\Temp\oezqjysmbpzenrcxpm.exe
      2018-08-15 10:03 - 2018-08-16 17:02 - 000503808 __RSH () C:\Users\DBPROTOOLS\AppData\Local\Temp\smlgdwusldranvkjfgxwqy.exe
      2018-08-15 10:03 - 2018-08-16 17:01 - 000503808 __RSH () C:\Users\DBPROTOOLS\AppData\Local\Temp\ymfulyqivhpszbkd.exe
      2018-08-07 12:20 - 2018-08-07 12:20 - 000708608 _____ () C:\Users\DBPROTOOLS\AppData\Local\Temp\zeoucgp.exe
      2018-08-15 10:03 - 2018-08-16 17:02 - 000503808 __RSH () C:\Users\DBPROTOOLS\AppData\Local\Temp\zqmeyojeujuakpbxqoc.exe
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\Windows\system32\winlogon.exe => File is digitally signed
      C:\Windows\system32\wininit.exe => File is digitally signed
      C:\Windows\SysWOW64\wininit.exe => File is digitally signed
      C:\Windows\explorer.exe => File is digitally signed
      C:\Windows\SysWOW64\explorer.exe => File is digitally signed
      C:\Windows\system32\svchost.exe => File is digitally signed
      C:\Windows\SysWOW64\svchost.exe => File is digitally signed
      C:\Windows\system32\services.exe => File is digitally signed
      C:\Windows\system32\User32.dll => File is digitally signed
      C:\Windows\SysWOW64\User32.dll => File is digitally signed
      C:\Windows\system32\userinit.exe => File is digitally signed
      C:\Windows\SysWOW64\userinit.exe => File is digitally signed
      C:\Windows\system32\rpcss.dll => File is digitally signed
      C:\Windows\system32\dnsapi.dll => File is digitally signed
      C:\Windows\SysWOW64\dnsapi.dll => File is digitally signed
      C:\Windows\system32\Drivers\volsnap.sys => File is digitally signed
      LastRegBack: 2018-08-17 05:08
      ==================== End of FRST.txt ============================
    • от v3cko
      malwarbytes засече троянец и други гадинки
      Scan result of Farbar Recovery Scan Tool (FRST) (x86) Version: 02.08.2018
      Ran by BECKO (administrator) on BECKO-PC (12-08-2018 08:46:39)
      Running from C:\Users\BECKO\Downloads
      Loaded Profiles: BECKO (Available Profiles: BECKO)
      Platform: Microsoft Windows 7 Ultimate  Service Pack 1 (X86) Language: Английски (Съединени щати)
      Internet Explorer Version 11 (Default browser: Chrome)
      Boot Mode: Normal
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      (Hewlett-Packard Company) C:\Windows\System32\hpservice.exe
      (Broadcom Corporation.) C:\Windows\System32\BtwRSupportService.exe
      (Malwarebytes) C:\Program Files\Malwarebytes\Anti-Malware\MBAMService.exe
      (Google Inc.) C:\Program Files\Google\Update\\GoogleCrashHandler.exe
      (Microsoft Corporation) C:\Windows\System32\rundll32.exe
      (Intel Corporation) C:\Windows\System32\igfxtray.exe
      (Intel Corporation) C:\Windows\System32\hkcmd.exe
      (Intel Corporation) C:\Windows\System32\igfxpers.exe
      (Synaptics Incorporated) C:\Program Files\Synaptics\SynTP\SynTPEnh.exe
      (Synaptics Incorporated) C:\Program Files\Synaptics\SynTP\SynTPHelper.exe
      (Malwarebytes) C:\Program Files\Malwarebytes\Anti-Malware\mbamtray.exe
      (Microsoft Corporation) C:\Windows\System32\wuauclt.exe
      (Copyright 2017.) C:\Program Files\Zemana AntiMalware\ZAM.exe
      (Copyright 2017.) C:\Program Files\Zemana AntiMalware\ZAM.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      (Google Inc.) C:\Program Files\Google\Chrome\Application\chrome.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [SynTPEnh] => C:\Program Files\Synaptics\SynTP\SynTPEnh.exe [1791272 2018-08-11] (Synaptics Incorporated)
      HKLM\...\Run: [ZAM] => C:\Program Files\Zemana AntiMalware\ZAM.exe [15775888 2017-08-09] (Copyright 2017.)
      HKU\S-1-5-21-4192057778-3853912004-1886924142-1001\...\Run: [Chromium] => "c:\users\becko\appdata\local\chromium\application\chrome.exe" --auto-launch-at-startup --profile-directory="Default" --restore-last-session
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      Tcpip\Parameters: [DhcpNameServer]
      Tcpip\..\Interfaces\{4447F6FC-1164-470A-9CC4-84A798333B40}: [DhcpNameServer]
      Tcpip\..\Interfaces\{566E0D37-D76E-44FA-984D-4A40BF15E2B7}: [DhcpNameServer]
      Internet Explorer:
      HKU\S-1-5-21-4192057778-3853912004-1886924142-1001\Software\Microsoft\Internet Explorer\Main,Start Page Redirect Cache = hxxp://www.msn.com/en-xl/?ocid=iehp
      StartMenuInternet: IEXPLORE.EXE - iexplore.exe
      FF ProfilePath: C:\Users\BECKO\AppData\Roaming\K-Meleon\ignaeef5.default [2018-08-12]
      FF user.js: detected! => C:\Users\BECKO\AppData\Roaming\K-Meleon\ignaeef5.default\user.js [2006-04-06]
      FF Homepage: K-Meleon\ignaeef5.default -> google.bg
      FF Extension: (NewsFox) - C:\Program Files\K-Meleon\browser\extensions\{899DF1F8-2F43-4394-8315-37F6744E6319}.xpi [2016-01-04] [Legacy] [not signed]
      FF Plugin: @adobe.com/FlashPlayer -> C:\Windows\system32\Macromed\Flash\NPSWF32_30_0_0_134.dll [2018-08-11] ()
      FF Plugin: @tools.google.com/Google Update;version=3 -> C:\Program Files\Google\Update\\npGoogleUpdate3.dll [2018-08-11] (Google Inc.)
      FF Plugin: @tools.google.com/Google Update;version=9 -> C:\Program Files\Google\Update\\npGoogleUpdate3.dll [2018-08-11] (Google Inc.)
      CHR HomePage: Default -> hxxp://google.bg/
      CHR StartupUrls: Default -> "hxxps://www.google.bg/"
      CHR Profile: C:\Users\BECKO\AppData\Local\Google\Chrome\User Data\Default [2018-08-12]
      CHR Extension: (Презентации) - C:\Users\BECKO\AppData\Local\Google\Chrome\User Data\Default\Extensions\aapocclcgogkmnckokdopfmhonfmgoek [2018-08-11]
      CHR Extension: (Документи) - C:\Users\BECKO\AppData\Local\Google\Chrome\User Data\Default\Extensions\aohghmighlieiainnegkcijnfilokake [2018-08-11]
      CHR Extension: (Google Диск) - C:\Users\BECKO\AppData\Local\Google\Chrome\User Data\Default\Extensions\apdfllckaahabafndbhieahigkjlhalf [2018-08-11]
      CHR Extension: (YouTube) - C:\Users\BECKO\AppData\Local\Google\Chrome\User Data\Default\Extensions\blpcfgokakmgnkcojhhkbfbldkacnbeo [2018-08-11]
      CHR Extension: (Adblock Plus) - C:\Users\BECKO\AppData\Local\Google\Chrome\User Data\Default\Extensions\cfhdojbkjhnklbpkdaibdccddilifddb [2018-08-11]
      CHR Extension: (Таблици) - C:\Users\BECKO\AppData\Local\Google\Chrome\User Data\Default\Extensions\felcaaldnbdncclmgdcncolpebgiejap [2018-08-11]
      CHR Extension: (Google Документи офлайн) - C:\Users\BECKO\AppData\Local\Google\Chrome\User Data\Default\Extensions\ghbmnnjooekpmoecnnnilnnbdlolhkhi [2018-08-11]
      CHR Extension: (Lightshot (скрииншот инструмент)) - C:\Users\BECKO\AppData\Local\Google\Chrome\User Data\Default\Extensions\mbniclmhobmnbdlbpiphghaielnnpgdp [2018-08-11]
      CHR Extension: (Плащания в уеб магазина на Chrome) - C:\Users\BECKO\AppData\Local\Google\Chrome\User Data\Default\Extensions\nmmhkkegccagdldgiimedpiccmgmieda [2018-08-11]
      CHR Extension: (Gmail) - C:\Users\BECKO\AppData\Local\Google\Chrome\User Data\Default\Extensions\pjkljhegncpnkpknbcohdijeoejaedia [2018-08-11]
      CHR Extension: (Chrome Media Router) - C:\Users\BECKO\AppData\Local\Google\Chrome\User Data\Default\Extensions\pkedcjkdefgpdelpbcmbmeomcjbeemfm [2018-08-11]
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R2 BcmBtRSupport; C:\Windows\system32\BtwRSupportService.exe [1680088 2018-08-11] (Broadcom Corporation.)
      R2 MBAMService; C:\Program Files\Malwarebytes\Anti-Malware\mbamservice.exe [4753104 2018-05-09] (Malwarebytes)
      R2 WinDefend; C:\Program Files\Windows Defender\mpsvc.dll [680960 2009-07-14] (Microsoft Corporation)
      R2 ZAMSvc; C:\Program Files\Zemana AntiMalware\ZAM.exe [15775888 2017-08-09] (Copyright 2017.)
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R3 bcbtums; C:\Windows\System32\drivers\bcbtums.sys [175320 2018-08-11] (Broadcom Corporation.)
      S3 btwampfl; C:\Windows\System32\DRIVERS\btwampfl.sys [144600 2018-08-11] (Broadcom Corporation.)
      R1 ESProtectionDriver; C:\Windows\system32\drivers\mbae.sys [129248 2018-06-19] (Malwarebytes)
      S3 hitmanpro37; C:\Windows\system32\drivers\hitmanpro37.sys [38224 2018-08-11] ()
      R0 iaStorA; C:\Windows\System32\DRIVERS\iaStorA.sys [527344 2018-08-11] (Intel Corporation)
      R0 iaStorF; C:\Windows\System32\DRIVERS\iaStorF.sys [26096 2018-08-11] (Intel Corporation)
      R3 IFXTPM; C:\Windows\System32\DRIVERS\IFXTPM.SYS [44800 2018-08-11] (Infineon Technologies AG)
      R3 KMWDFILTER; C:\Windows\System32\DRIVERS\KMWDFILTER.sys [17408 2018-08-11] (Windows (R) Codename Longhorn DDK provider)
      R2 MBAMChameleon; C:\Windows\System32\Drivers\MbamChameleon.sys [165608 2018-08-11] (Malwarebytes)
      R3 MBAMFarflt; C:\Windows\System32\DRIVERS\farflt.sys [95488 2018-08-12] (Malwarebytes)
      R3 MBAMProtection; C:\Windows\System32\DRIVERS\mbam.sys [42728 2018-08-12] (Malwarebytes)
      R3 MBAMSwissArmy; C:\Windows\System32\Drivers\mbamswissarmy.sys [220896 2018-08-12] (Malwarebytes)
      R3 MBAMWebProtection; C:\Windows\System32\DRIVERS\mwac.sys [73336 2018-08-12] (Malwarebytes)
      R3 NETwNs32; C:\Windows\System32\DRIVERS\NETwNs32.sys [7523840 2018-08-11] (Intel Corporation)
      R3 whfltr2k; C:\Windows\System32\DRIVERS\whfltr2k.sys [7424 2018-08-11] ()
      R1 ZAM; C:\Windows\System32\drivers\zam32.sys [181496 2018-08-12] (Zemana Ltd.)
      R1 ZAM_Guard; C:\Windows\System32\drivers\zamguard32.sys [181496 2018-08-12] (Zemana Ltd.)
      S3 VGPU; System32\drivers\rdvgkmd.sys [X]
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-08-12 08:46 - 2018-08-12 08:47 - 000008916 _____ C:\Users\BECKO\Downloads\FRST.txt
      2018-08-12 08:46 - 2018-08-12 08:46 - 000000000 ____D C:\FRST
      2018-08-12 08:44 - 2018-08-12 08:44 - 001773056 _____ (Farbar) C:\Users\BECKO\Downloads\FRST.exe
      2018-08-12 08:08 - 2018-08-12 08:46 - 000032169 _____ C:\Windows\ZAM.krnl.trace
      2018-08-12 08:08 - 2018-08-12 08:46 - 000011705 _____ C:\Windows\ZAM_Guard.krnl.trace
      2018-08-12 08:08 - 2018-08-12 08:08 - 000181496 _____ (Zemana Ltd.) C:\Windows\system32\Drivers\zamguard32.sys
      2018-08-12 08:08 - 2018-08-12 08:08 - 000181496 _____ (Zemana Ltd.) C:\Windows\system32\Drivers\zam32.sys
      2018-08-12 08:08 - 2018-08-12 08:08 - 000001892 _____ C:\Users\Public\Desktop\Zemana AntiMalware.lnk
      2018-08-12 08:08 - 2018-08-12 08:08 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Zemana AntiMalware
      2018-08-12 08:08 - 2018-08-12 08:08 - 000000000 ____D C:\Program Files\Zemana AntiMalware
      2018-08-12 08:06 - 2018-08-12 08:06 - 000000000 ____D C:\Users\BECKO\AppData\Local\Zemana
      2018-08-12 08:05 - 2018-08-12 08:05 - 006625600 _____ (Zemana Ltd. ) C:\Users\BECKO\Downloads\Zemana.AntiMalware.Setup.exe
      2018-08-12 07:45 - 2018-08-12 07:45 - 007417040 _____ (Malwarebytes) C:\Users\BECKO\Downloads\adwcleaner_7.2.2.exe
      2018-08-12 07:44 - 2018-08-12 07:45 - 000000000 ____D C:\AdwCleaner
      2018-08-12 07:44 - 2018-08-12 07:44 - 007277776 _____ (Malwarebytes) C:\Users\BECKO\Downloads\adwcleaner_7.1.1.exe
      2018-08-12 07:12 - 2018-08-12 07:12 - 000000000 ____D C:\Users\BECKO\AppData\Local\CrashDumps
      2018-08-12 06:43 - 2018-08-12 08:36 - 000000000 ____D C:\ProgramData\RogueKiller
      2018-08-12 06:43 - 2018-08-12 08:16 - 000024688 _____ C:\Windows\system32\Drivers\TrueSight.sys
      2018-08-12 06:42 - 2018-08-12 06:42 - 000001005 _____ C:\Users\Public\Desktop\RogueKiller.lnk
      2018-08-12 06:42 - 2018-08-12 06:42 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\RogueKiller
      2018-08-12 06:42 - 2018-08-12 06:42 - 000000000 ____D C:\Program Files\RogueKiller
      2018-08-12 06:41 - 2018-08-12 06:41 - 036826200 _____ (Adlice Software ) C:\Users\BECKO\Downloads\RogueKiller_setup.exe
      2018-08-12 06:39 - 2018-08-12 06:39 - 000000000 _____ C:\Users\BECKO\Downloads\RogueKiller.exe
      2018-08-12 00:53 - 2018-08-12 00:53 - 000000046 _____ C:\Users\BECKO\AppData\Roaming\WB.CFG
      2018-08-12 00:38 - 2018-08-11 13:48 - 000000000 ____D C:\Windows\Panther
      2018-08-12 00:32 - 2018-08-12 00:32 - 000000000 ____D C:\Windows.old
      2018-08-12 00:20 - 2018-08-12 00:20 - 000000000 ____D C:\Windows\pss
      2018-08-11 22:23 - 2018-08-11 22:23 - 000000000 ____H C:\Windows\system32\Drivers\Msft_Kernel_SynTP_01009.Wdf
      2018-08-11 22:23 - 2018-08-11 22:23 - 000000000 ____D C:\Program Files\Synaptics
      2018-08-11 22:18 - 2018-08-11 22:18 - 000214312 _____ (Synaptics Incorporated) C:\Windows\system32\SynCtrl.dll
      2018-08-11 22:18 - 2018-08-11 22:18 - 000173352 _____ (Synaptics Incorporated) C:\Windows\system32\SynCOM.dll
      2018-08-11 22:18 - 2018-08-11 22:18 - 000120104 _____ (Synaptics Incorporated) C:\Windows\system32\SynTPCo4.dll
      2018-08-11 22:14 - 2018-08-11 22:14 - 000165160 _____ (Synaptics Incorporated) C:\Windows\system32\SynTPAPI.dll
      2018-08-11 22:11 - 2018-08-11 22:11 - 001303728 _____ (Synaptics Incorporated) C:\Windows\system32\Drivers\SynTP.sys
      2018-08-11 22:09 - 2018-08-11 22:09 - 000046592 _____ (REDC) C:\Windows\system32\Drivers\risdptsk.sys
      2018-08-11 22:04 - 2018-08-11 22:04 - 000044800 _____ (Infineon Technologies AG) C:\Windows\system32\Drivers\ifxtpm.sys
      2018-08-11 21:57 - 2018-08-11 21:57 - 000000000 ____H C:\Windows\system32\Drivers\Msft_Kernel_ATSwpWDF_01009.Wdf
      2018-08-11 21:57 - 2018-08-11 21:57 - 000000000 ____D C:\Program Files\AuthenTec
      2018-08-11 21:54 - 2018-08-11 21:54 - 000000000 ____D C:\Intel
      2018-08-11 21:52 - 2018-08-11 21:53 - 000571904 _____ (Intel Corporation) C:\Windows\system32\igdumdx32.dll
      2018-08-11 21:52 - 2018-08-11 21:52 - 000452440 _____ (Microsoft Corporation) C:\Windows\system32\d3dx10_40.dll
      2018-08-11 21:51 - 2018-08-11 21:52 - 004411392 _____ (Intel Corporation) C:\Windows\system32\igd10umd32.dll
      2018-08-11 21:48 - 2018-08-11 21:51 - 011405312 _____ (Intel Corporation) C:\Windows\system32\ig4icd32.dll
      2018-08-11 21:48 - 2018-08-11 21:48 - 000004096 _____ ( ) C:\Windows\system32\IGFXDEVLib.dll
      2018-08-11 21:48 - 2018-08-11 21:48 - 000000268 _____ C:\Windows\system32\GfxUI.exe.config
      2018-08-11 21:47 - 2018-08-11 21:48 - 003157784 _____ (Intel Corporation) C:\Windows\system32\GfxUI.exe
      2018-08-11 21:47 - 2018-08-11 21:47 - 000189552 _____ C:\Windows\system32\Gfxres.th-TH.resources
      2018-08-11 21:47 - 2018-08-11 21:47 - 000121173 _____ C:\Windows\system32\Gfxres.tr-TR.resources
      2018-08-11 21:47 - 2018-08-11 21:47 - 000120320 _____ (Intel Corporation) C:\Windows\system32\gfxSrvc.dll
      2018-08-11 21:47 - 2018-08-11 21:47 - 000104044 _____ C:\Windows\system32\Gfxres.zh-TW.resources
      2018-08-11 21:47 - 2018-08-11 21:47 - 000102883 _____ C:\Windows\system32\Gfxres.zh-CN.resources
      2018-08-11 21:46 - 2018-08-11 21:47 - 000119360 _____ C:\Windows\system32\Gfxres.sv-SE.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000178407 _____ C:\Windows\system32\Gfxres.el-GR.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000165395 _____ C:\Windows\system32\Gfxres.ru-RU.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000139909 _____ C:\Windows\system32\Gfxres.ar-SA.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000136401 _____ C:\Windows\system32\Gfxres.ja-JP.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000133746 _____ C:\Windows\system32\Gfxres.he-IL.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000125558 _____ C:\Windows\system32\Gfxres.it-IT.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000123230 _____ C:\Windows\system32\Gfxres.ko-KR.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000122927 _____ C:\Windows\system32\Gfxres.es-ES.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000122709 _____ C:\Windows\system32\Gfxres.de-DE.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000120800 _____ C:\Windows\system32\Gfxres.fr-FR.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000120366 _____ C:\Windows\system32\Gfxres.pt-BR.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000119616 _____ C:\Windows\system32\Gfxres.hu-HU.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000119586 _____ C:\Windows\system32\Gfxres.nl-NL.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000119067 _____ C:\Windows\system32\Gfxres.pt-PT.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000118745 _____ C:\Windows\system32\Gfxres.cs-CZ.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000118697 _____ C:\Windows\system32\Gfxres.fi-FI.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000118409 _____ C:\Windows\system32\Gfxres.pl-PL.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000118058 _____ C:\Windows\system32\Gfxres.sk-SK.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000114852 _____ C:\Windows\system32\Gfxres.nb-NO.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000114372 _____ C:\Windows\system32\Gfxres.sl-SI.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000114261 _____ C:\Windows\system32\Gfxres.da-DK.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000110214 _____ C:\Windows\system32\Gfxres.en-US.resources
      2018-08-11 21:46 - 2018-08-11 21:46 - 000086528 _____ (Intel Corporation) C:\Windows\system32\igfxrell.lrc
      2018-08-11 21:46 - 2018-08-11 21:46 - 000086016 _____ (Intel Corporation) C:\Windows\system32\igfxrsky.lrc
      2018-08-11 21:46 - 2018-08-11 21:46 - 000085504 _____ (Intel Corporation) C:\Windows\system32\igfxrtrk.lrc
      2018-08-11 21:46 - 2018-08-11 21:46 - 000085504 _____ (Intel Corporation) C:\Windows\system32\igfxrsve.lrc
      2018-08-11 21:46 - 2018-08-11 21:46 - 000085504 _____ (Intel Corporation) C:\Windows\system32\igfxrslv.lrc
      2018-08-11 21:46 - 2018-08-11 21:46 - 000085504 _____ (Intel Corporation) C:\Windows\system32\igfxrhun.lrc
      2018-08-11 21:46 - 2018-08-11 21:46 - 000085504 _____ (Intel Corporation) C:\Windows\system32\igfxrcsy.lrc
      2018-08-11 21:46 - 2018-08-11 21:46 - 000084992 _____ (Intel Corporation) C:\Windows\system32\igfxrtha.lrc
      2018-08-11 21:45 - 2018-08-11 21:46 - 000086016 _____ (Intel Corporation) C:\Windows\system32\igfxrrus.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000086528 _____ (Intel Corporation) C:\Windows\system32\igfxrfra.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000086528 _____ (Intel Corporation) C:\Windows\system32\igfxresn.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000086016 _____ (Intel Corporation) C:\Windows\system32\igfxrptg.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000086016 _____ (Intel Corporation) C:\Windows\system32\igfxrplk.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000086016 _____ (Intel Corporation) C:\Windows\system32\igfxrnld.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000086016 _____ (Intel Corporation) C:\Windows\system32\igfxrita.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000086016 _____ (Intel Corporation) C:\Windows\system32\igfxrdeu.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000085504 _____ (Intel Corporation) C:\Windows\system32\igfxrptb.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000085504 _____ (Intel Corporation) C:\Windows\system32\igfxrnor.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000085504 _____ (Intel Corporation) C:\Windows\system32\igfxrfin.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000085504 _____ (Intel Corporation) C:\Windows\system32\igfxrenu.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000084992 _____ (Intel Corporation) C:\Windows\system32\igfxrdan.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000084480 _____ (Intel Corporation) C:\Windows\system32\igfxrheb.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000084480 _____ (Intel Corporation) C:\Windows\system32\igfxrara.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000082944 _____ (Intel Corporation) C:\Windows\system32\igfxrkor.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000082944 _____ (Intel Corporation) C:\Windows\system32\igfxrjpn.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000081920 _____ (Intel Corporation) C:\Windows\system32\igfxrcht.lrc
      2018-08-11 21:45 - 2018-08-11 21:45 - 000081920 _____ (Intel Corporation) C:\Windows\system32\igfxrchs.lrc
      2018-08-11 21:43 - 2018-08-11 21:45 - 008198936 _____ (Intel(R) Corporation) C:\Windows\system32\TVWSetup.exe
      2018-08-11 21:43 - 2018-08-11 21:43 - 000261632 _____ (Intel Corporation) C:\Windows\system32\igfxTMM.dll
      2018-08-11 21:43 - 2018-08-11 21:43 - 000179480 _____ (Intel Corporation) C:\Windows\system32\igfxext.exe
      2018-08-11 21:43 - 2018-08-11 21:43 - 000023552 _____ (Intel Corporation) C:\Windows\system32\igfxexps.dll
      2018-08-11 21:42 - 2018-08-11 21:43 - 000172824 _____ (Intel Corporation) C:\Windows\system32\igfxpers.exe
      2018-08-11 21:42 - 2018-08-11 21:42 - 000828928 _____ (Intel Corporation) C:\Windows\system32\igfxress.dll
      2018-08-11 21:42 - 2018-08-11 21:42 - 000268056 _____ (Intel Corporation) C:\Windows\system32\igfxsrvc.exe
      2018-08-11 21:42 - 2018-08-11 21:42 - 000228864 _____ (Intel Corporation) C:\Windows\system32\igfxdev.dll
      2018-08-11 21:42 - 2018-08-11 21:42 - 000208896 _____ (Intel Corporation) C:\Windows\system32\iglhsip32.dll
      2018-08-11 21:42 - 2018-08-11 21:42 - 000195584 _____ (Intel Corporation) C:\Windows\system32\igfxpph.dll
      2018-08-11 21:42 - 2018-08-11 21:42 - 000171288 _____ (Intel Corporation) C:\Windows\system32\hkcmd.exe
      2018-08-11 21:42 - 2018-08-11 21:42 - 000147456 _____ (Intel Corporation) C:\Windows\system32\iglhcp32.dll
      2018-08-11 21:42 - 2018-08-11 21:42 - 000138008 _____ (Intel Corporation) C:\Windows\system32\igfxtray.exe
      2018-08-11 21:42 - 2018-08-11 21:42 - 000130048 _____ (Intel Corporation) C:\Windows\system32\igfxdo.dll
      2018-08-11 21:42 - 2018-08-11 21:42 - 000115200 _____ (Intel Corporation) C:\Windows\system32\igfxcpl.cpl
      2018-08-11 21:42 - 2018-08-11 21:42 - 000095232 _____ (Intel Corporation) C:\Windows\system32\hccutils.dll
      2018-08-11 21:42 - 2018-08-11 21:42 - 000057856 _____ (Intel Corporation) C:\Windows\system32\igfxsrvc.dll
      2018-08-11 21:41 - 2018-08-11 21:42 - 001921265 _____ C:\Windows\system32\iglhxa32.cpa
      2018-08-11 21:41 - 2018-08-11 21:41 - 000439308 _____ C:\Windows\system32\igcompkrng500.bin
      2018-08-11 21:41 - 2018-08-11 21:41 - 000092356 _____ C:\Windows\system32\igfcg500m.bin
      2018-08-11 21:41 - 2018-08-11 21:41 - 000081920 _____ (Intel Corporation) C:\Windows\system32\igfxCoIn_v2555.dll
      2018-08-11 21:41 - 2018-08-11 21:41 - 000060254 _____ C:\Windows\system32\iglhxg32.vp
      2018-08-11 21:41 - 2018-08-11 21:41 - 000060226 _____ C:\Windows\system32\iglhxc32.vp
      2018-08-11 21:41 - 2018-08-11 21:41 - 000060015 _____ C:\Windows\system32\iglhxo32.vp
      2018-08-11 21:41 - 2018-08-11 21:41 - 000051628 _____ C:\Windows\system32\iglhxs32.vp
      2018-08-11 21:41 - 2018-08-11 21:41 - 000001090 _____ C:\Windows\system32\iglhxa32.vp
      2018-08-11 21:40 - 2018-08-11 21:41 - 000982240 _____ C:\Windows\system32\igkrng500.bin
      2018-08-11 21:37 - 2018-08-11 21:37 - 000017408 _____ (Windows (R) Codename Longhorn DDK provider) C:\Windows\system32\Drivers\KMWDFILTER.sys
      2018-08-11 21:36 - 2018-08-11 21:36 - 000007424 _____ () C:\Windows\system32\Drivers\whfltr2k.sys
      2018-08-11 20:30 - 2018-08-12 07:51 - 000220896 _____ (Malwarebytes) C:\Windows\system32\Drivers\mbamswissarmy.sys
      2018-08-11 20:30 - 2018-08-12 07:51 - 000095488 _____ (Malwarebytes) C:\Windows\system32\Drivers\farflt.sys
      2018-08-11 20:30 - 2018-08-12 07:51 - 000073336 _____ (Malwarebytes) C:\Windows\system32\Drivers\mwac.sys
      2018-08-11 20:30 - 2018-08-12 07:51 - 000042728 _____ (Malwarebytes) C:\Windows\system32\Drivers\mbam.sys
      2018-08-11 20:30 - 2018-08-11 20:30 - 000165608 _____ (Malwarebytes) C:\Windows\system32\Drivers\MbamChameleon.sys
      2018-08-11 20:27 - 2018-08-11 20:28 - 000000000 ____D C:\Users\BECKO\Downloads\windows.loader.v2.2.2
      2018-08-11 20:26 - 2018-08-11 20:26 - 001768154 _____ C:\Users\BECKO\Downloads\windows.loader.v2.2.2.zip
      2018-08-11 19:36 - 2018-08-11 19:36 - 078989872 _____ (Malwarebytes ) C:\Users\BECKO\Downloads\mb3-setup-consumer-
      2018-08-11 19:36 - 2018-08-11 19:36 - 000002024 _____ C:\Users\Public\Desktop\Malwarebytes.lnk
      2018-08-11 19:36 - 2018-08-11 19:36 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Malwarebytes
      2018-08-11 19:36 - 2018-08-11 19:36 - 000000000 ____D C:\ProgramData\Malwarebytes
      2018-08-11 19:36 - 2018-08-11 19:36 - 000000000 ____D C:\Program Files\Malwarebytes
      2018-08-11 19:36 - 2018-06-19 14:09 - 000129248 _____ (Malwarebytes) C:\Windows\system32\Drivers\mbae.sys
      2018-08-11 19:15 - 2018-08-11 19:15 - 000038224 _____ C:\Windows\system32\Drivers\hitmanpro37.sys
      2018-08-11 19:14 - 2018-08-11 19:15 - 000000000 ____D C:\ProgramData\HitmanPro
      2018-08-11 18:56 - 2018-08-12 08:13 - 000001134 _____ C:\Users\BECKO\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Chromium.lnk
      2018-08-11 18:54 - 2018-07-20 18:17 - 084469760 _____ (Microsoft Corporation) C:\Users\BECKO\AppData\Roaming\rasapi32.dll
      2018-08-11 18:53 - 2018-08-12 06:28 - 000000000 ____D C:\Users\BECKO\AppData\Roaming\41B13405-F6F9-0E07-41F8-1ED9F82C4739
      2018-08-11 18:52 - 2018-08-11 19:54 - 000000000 ____D C:\ProgramData\McAfee
      2018-08-11 18:51 - 2018-08-12 00:31 - 000000000 ____D C:\Windows\system32\yiuxtdsr
      2018-08-11 18:50 - 2018-08-11 19:43 - 000000000 ____D C:\Users\BECKO\AppData\Roaming\Sound Volume Control
      2018-08-11 18:47 - 2018-08-11 18:47 - 000000000 ____D C:\Windows\system32\appmgmt
      2018-08-11 18:28 - 2018-08-11 18:28 - 017142784 _____ (Microsoft Corporation) C:\Windows\system32\mshtml.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 011220992 _____ (Microsoft Corporation) C:\Windows\system32\ieframe.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 004240384 _____ (Microsoft Corporation) C:\Windows\system32\jscript9.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 003969472 _____ (Microsoft Corporation) C:\Windows\system32\ntkrnlpa.exe
      2018-08-11 18:28 - 2018-08-11 18:28 - 003914176 _____ (Microsoft Corporation) C:\Windows\system32\ntoskrnl.exe
      2018-08-11 18:28 - 2018-08-11 18:28 - 002724864 _____ (Microsoft Corporation) C:\Windows\system32\mshtml.tlb
      2018-08-11 18:28 - 2018-08-11 18:28 - 002166272 _____ (Microsoft Corporation) C:\Windows\system32\iertutil.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 001926656 _____ (Microsoft Corporation) C:\Windows\system32\inetcpl.cpl
      2018-08-11 18:28 - 2018-08-11 18:28 - 001818112 _____ (Microsoft Corporation) C:\Windows\system32\wininet.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 001289096 _____ (Microsoft Corporation) C:\Windows\system32\ntdll.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 001156608 _____ (Microsoft Corporation) C:\Windows\system32\urlmon.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 001051136 _____ (Microsoft Corporation) C:\Windows\system32\mshtmlmedia.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000703488 _____ (Microsoft Corporation) C:\Windows\system32\ieapfltr.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000646144 _____ (Microsoft Corporation) C:\Windows\system32\MsSpellCheckingFacility.exe
      2018-08-11 18:28 - 2018-08-11 18:28 - 000645120 _____ (Microsoft Corporation) C:\Windows\system32\jsIntl.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000640512 _____ (Microsoft Corporation) C:\Windows\system32\advapi32.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000619520 _____ (Microsoft Corporation) C:\Windows\system32\tdh.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000616104 _____ (Microsoft Corporation) C:\Windows\system32\ieapfltr.dat
      2018-08-11 18:28 - 2018-08-11 18:28 - 000610304 _____ (Microsoft Corporation) C:\Windows\system32\jscript.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000553472 _____ (Microsoft Corporation) C:\Windows\system32\jscript9diag.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000523776 _____ (Microsoft Corporation) C:\Windows\system32\msfeeds.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000454656 _____ (Microsoft Corporation) C:\Windows\system32\vbscript.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000440832 _____ (Microsoft Corporation) C:\Windows\system32\ieui.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000367104 _____ (Microsoft Corporation) C:\Windows\system32\dxtmsft.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000337408 _____ (Microsoft Corporation) C:\Windows\system32\html.iec
      2018-08-11 18:28 - 2018-08-11 18:28 - 000244736 _____ (Microsoft Corporation) C:\Windows\system32\dxtrans.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000238288 _____ (Microsoft Corporation) C:\Windows\system32\iedkcs32.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000233472 _____ (Microsoft Corporation) C:\Windows\system32\url.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000208896 _____ (Microsoft Corporation) C:\Windows\system32\ie4uinit.exe
      2018-08-11 18:28 - 2018-08-11 18:28 - 000208384 _____ (Microsoft Corporation) C:\Windows\system32\webcheck.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000194048 _____ (Microsoft Corporation) C:\Windows\system32\elshyph.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000182272 _____ (Microsoft Corporation) C:\Windows\system32\msls31.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000164864 _____ (Microsoft Corporation) C:\Windows\system32\msrating.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000151552 _____ (Microsoft Corporation) C:\Windows\system32\iexpress.exe
      2018-08-11 18:28 - 2018-08-11 18:28 - 000139264 _____ (Microsoft Corporation) C:\Windows\system32\wextract.exe
      2018-08-11 18:28 - 2018-08-11 18:28 - 000127488 _____ (Microsoft Corporation) C:\Windows\system32\occache.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000116736 _____ (Microsoft Corporation) C:\Windows\system32\iepeers.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000112128 _____ (Microsoft Corporation) C:\Windows\system32\ieUnatt.exe
      2018-08-11 18:28 - 2018-08-11 18:28 - 000111616 _____ (Microsoft Corporation) C:\Windows\system32\IEAdvpack.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000108032 _____ (Microsoft Corporation) C:\Windows\system32\ieetwcollector.exe
      2018-08-11 18:28 - 2018-08-11 18:28 - 000086016 _____ (Microsoft Corporation) C:\Windows\system32\iesysprep.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000083456 _____ (Microsoft Corporation) C:\Windows\system32\inseng.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000074240 _____ (Microsoft Corporation) C:\Windows\system32\SetIEInstalledDate.exe
      2018-08-11 18:28 - 2018-08-11 18:28 - 000071680 _____ (Microsoft Corporation) C:\Windows\system32\RegisterIEPKEYs.exe
      2018-08-11 18:28 - 2018-08-11 18:28 - 000069632 _____ (Microsoft Corporation) C:\Windows\system32\smss.exe
      2018-08-11 18:28 - 2018-08-11 18:28 - 000069632 _____ (Microsoft Corporation) C:\Windows\system32\mshtmled.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000069120 _____ (Microsoft Corporation) C:\Windows\system32\icardie.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000062464 _____ (Microsoft Corporation) C:\Windows\system32\tdc.ocx
      2018-08-11 18:28 - 2018-08-11 18:28 - 000061952 _____ (Microsoft Corporation) C:\Windows\system32\MshtmlDac.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000061952 _____ (Microsoft Corporation) C:\Windows\system32\iesetup.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000056832 _____ (Microsoft Corporation) C:\Windows\system32\pngfilt.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000051200 _____ (Microsoft Corporation) C:\Windows\system32\ieetwproxystub.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000048640 _____ (Microsoft Corporation) C:\Windows\system32\mshtmler.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000043008 _____ (Microsoft Corporation) C:\Windows\system32\msfeedsbs.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000043008 _____ (Microsoft Corporation) C:\Windows\system32\jsproxy.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000038912 _____ (Microsoft Corporation) C:\Windows\system32\csrsrv.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000036352 _____ (Microsoft Corporation) C:\Windows\system32\imgutil.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000034816 _____ (Microsoft Corporation) C:\Windows\system32\JavaScriptCollectionAgent.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000032768 _____ (Microsoft Corporation) C:\Windows\system32\iernonce.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000024576 _____ (Microsoft Corporation) C:\Windows\system32\licmgr10.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000013312 _____ (Microsoft Corporation) C:\Windows\system32\mshta.exe
      2018-08-11 18:28 - 2018-08-11 18:28 - 000012800 _____ (Microsoft Corporation) C:\Windows\system32\msfeedssync.exe
      2018-08-11 18:28 - 2018-08-11 18:28 - 000004096 _____ (Microsoft Corporation) C:\Windows\system32\ieetwcollectorres.dll
      2018-08-11 18:28 - 2018-08-11 18:28 - 000000000 ____D C:\Users\BECKO\AppData\LocalLow\Temp
      2018-08-11 18:27 - 2018-08-11 18:27 - 001294272 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\tcpip.sys
      2018-08-11 18:27 - 2018-08-11 18:27 - 000868352 _____ (Microsoft Corporation) C:\Windows\system32\kernel32.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000338944 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\afd.sys
      2018-08-11 18:27 - 2018-08-11 18:27 - 000293376 _____ (Microsoft Corporation) C:\Windows\system32\KernelBase.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000271360 _____ (Microsoft Corporation) C:\Windows\system32\conhost.exe
      2018-08-11 18:27 - 2018-08-11 18:27 - 000240496 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\netio.sys
      2018-08-11 18:27 - 2018-08-11 18:27 - 000231424 _____ (Microsoft Corporation) C:\Windows\system32\mswsock.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000187752 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\FWPKCLNT.SYS
      2018-08-11 18:27 - 2018-08-11 18:27 - 000169984 _____ (Microsoft Corporation) C:\Windows\system32\winsrv.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000049152 _____ (Microsoft Corporation) C:\Windows\system32\taskhost.exe
      2018-08-11 18:27 - 2018-08-11 18:27 - 000006144 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-security-base-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000005120 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-file-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000004608 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-threadpool-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000004608 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-processthreads-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-sysinfo-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-synch-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-misc-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-localregistry-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-localization-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-xstate-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-processenvironment-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-namedpipe-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-memory-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-libraryloader-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-interlocked-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-heap-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-util-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-string-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-rtlsupport-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-profile-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-io-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-handle-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-fibers-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-errorhandling-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-delayload-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-debug-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-datetime-l1-1-0.dll
      2018-08-11 18:27 - 2018-08-11 18:27 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-core-console-l1-1-0.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 003419136 _____ (Microsoft Corporation) C:\Windows\system32\d2d1.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 002284544 _____ (Microsoft Corporation) C:\Windows\system32\msmpeg2vdec.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 001988096 _____ (Microsoft Corporation) C:\Windows\system32\d3d10warp.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 001247744 _____ (Microsoft Corporation) C:\Windows\system32\DWrite.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 001230336 _____ (Microsoft Corporation) C:\Windows\system32\WindowsCodecs.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 001158144 _____ (Microsoft Corporation) C:\Windows\system32\XpsPrint.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 001080832 _____ (Microsoft Corporation) C:\Windows\system32\d3d10.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000906240 _____ (Microsoft Corporation) C:\Windows\system32\FntCache.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000604160 _____ (Microsoft Corporation) C:\Windows\system32\d3d10level9.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000417792 _____ (Microsoft Corporation) C:\Windows\system32\WMPhoto.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000364544 _____ (Microsoft Corporation) C:\Windows\system32\XpsGdiConverter.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000293376 _____ (Microsoft Corporation) C:\Windows\system32\dxgi.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000249856 _____ (Microsoft Corporation) C:\Windows\system32\d3d10_1core.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000220160 _____ (Microsoft Corporation) C:\Windows\system32\d3d10core.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000207872 _____ (Microsoft Corporation) C:\Windows\system32\WindowsCodecsExt.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000187392 _____ (Microsoft Corporation) C:\Windows\system32\UIAnimation.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000161792 _____ (Microsoft Corporation) C:\Windows\system32\d3d10_1.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000010752 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-downlevel-advapi32-l1-1-0.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000009728 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-downlevel-shlwapi-l1-1-0.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000005632 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-downlevel-shlwapi-l2-1-0.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000005632 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-downlevel-ole32-l1-1-0.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000004096 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-downlevel-user32-l1-1-0.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000003584 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-downlevel-advapi32-l2-1-0.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-downlevel-version-l1-1-0.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000003072 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-downlevel-shell32-l1-1-0.dll
      2018-08-11 18:25 - 2018-08-11 18:25 - 000002560 ____H (Microsoft Corporation) C:\Windows\system32\api-ms-win-downlevel-normaliz-l1-1-0.dll
      2018-08-11 18:23 - 2018-08-11 18:23 - 001505280 _____ (Microsoft Corporation) C:\Windows\system32\d3d11.dll
      2018-08-11 18:22 - 2018-08-11 18:22 - 031194832 _____ (Microsoft Corporation) C:\Users\BECKO\Downloads\IE11-Windows6.1-x86-bg-bg.exe
      2018-08-11 17:59 - 2018-08-11 18:02 - 009037312 _____ (Intel Corporation) C:\Windows\system32\Drivers\igdkmd32.sys
      2018-08-11 17:57 - 2018-08-11 17:58 - 002760704 _____ (Intel Corporation) C:\Windows\system32\NETwNr32.dll
      2018-08-11 17:57 - 2018-08-11 17:57 - 000684032 _____ (Intel Corporation) C:\Windows\system32\NETwNc32.dll
      2018-08-11 17:55 - 2018-08-11 17:57 - 007523840 _____ (Intel Corporation) C:\Windows\system32\Drivers\NETwNs32.sys
      2018-08-11 17:55 - 2018-08-11 17:55 - 000527344 _____ (Intel Corporation) C:\Windows\system32\Drivers\iaStorA.sys
      2018-08-11 17:55 - 2018-08-11 17:55 - 000026096 _____ (Intel Corporation) C:\Windows\system32\Drivers\iaStorF.sys
      2018-08-11 17:54 - 2018-08-11 17:54 - 000232664 _____ (Intel Corporation) C:\Windows\system32\Drivers\e1y6232.sys
      2018-08-11 17:54 - 2018-08-11 17:54 - 000121440 _____ (Intel Corporation) C:\Windows\system32\e1000msg.dll
      2018-08-11 17:54 - 2018-08-11 17:54 - 000081600 _____ (Intel Corporation) C:\Windows\system32\NicInstY.dll
      2018-08-11 17:54 - 2018-08-11 17:54 - 000028792 _____ (Intel Corporation) C:\Windows\system32\NicCo36.dll
      2018-08-11 17:54 - 2018-08-11 17:54 - 000003313 _____ C:\Windows\system32\e1y6232.din
      2018-08-11 17:53 - 2018-08-11 17:53 - 000144600 _____ (Broadcom Corporation.) C:\Windows\system32\Drivers\btwampfl.sys
      2018-08-11 17:53 - 2018-08-11 17:53 - 000060120 _____ (Broadcom Corporation.) C:\Windows\system32\btwdi.dll
      2018-08-11 17:52 - 2018-08-11 17:53 - 001680088 _____ (Broadcom Corporation.) C:\Windows\system32\BtwRSupportService.exe
      2018-08-11 17:52 - 2018-08-11 17:52 - 001640152 _____ (Broadcom Corporation.) C:\Windows\system32\BcmBtRSupport.dll
      2018-08-11 17:52 - 2018-08-11 17:52 - 000175320 _____ (Broadcom Corporation.) C:\Windows\system32\Drivers\bcbtums.sys
      2018-08-11 17:50 - 2018-08-11 17:50 - 000048128 _____ (REDC) C:\Windows\system32\Drivers\rimmptsk.sys
      2018-08-11 17:45 - 2018-08-11 17:45 - 001461992 _____ (Microsoft Corporation) C:\Windows\system32\WdfCoinstaller01009.dll
      2018-08-11 17:45 - 2018-08-11 17:45 - 000015544 _____ (Hewlett-Packard Company) C:\Windows\system32\Drivers\CPQBttn.sys
      2018-08-11 17:44 - 2018-08-11 17:44 - 000971752 _____ (AuthenTec, Inc.) C:\Windows\system32\Drivers\ATSwpWDF.sys
      2018-08-11 17:42 - 2018-08-11 17:42 - 000035896 _____ (Hewlett-Packard Company) C:\Windows\system32\Drivers\Accelerometer.sys
      2018-08-11 17:42 - 2018-08-11 17:42 - 000026168 _____ (Hewlett-Packard Company) C:\Windows\system32\hpservice.exe
      2018-08-11 17:42 - 2018-08-11 17:42 - 000025656 _____ (Hewlett-Packard Company) C:\Windows\system32\Drivers\hpdskflt.sys
      2018-08-11 17:42 - 2018-08-11 17:42 - 000016952 _____ (Hewlett-Packard Company) C:\Windows\system32\accelerometerdll.DLL
      2018-08-11 17:42 - 2018-08-11 17:42 - 000014392 _____ (Hewlett-Packard Company) C:\Windows\system32\HPMDPCoInst12.dll
      2018-08-11 17:40 - 2018-08-12 07:12 - 000000000 ____D C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Driver Easy
      2018-08-11 17:39 - 2018-08-11 17:39 - 004107032 _____ (Easeware ) C:\Users\BECKO\Downloads\DriverEasy_Setup.exe
      2018-08-11 16:22 - 2018-08-11 16:22 - 000000000 ____D C:\Users\BECKO\AppData\Roaming\Adobe
      2018-08-11 16:21 - 2018-08-11 18:15 - 000842240 _____ (Adobe Systems Incorporated) C:\Windows\system32\FlashPlayerApp.exe
      2018-08-11 16:21 - 2018-08-11 18:15 - 000175104 _____ (Adobe Systems Incorporated) C:\Windows\system32\FlashPlayerCPLApp.cpl
      2018-08-11 16:21 - 2018-08-11 18:15 - 000000000 ____D C:\Windows\system32\Macromed
      2018-08-11 16:21 - 2018-08-11 18:15 - 000000000 ____D C:\Users\BECKO\AppData\Local\Adobe
      2018-08-11 16:21 - 2018-08-11 16:21 - 000000000 ____D C:\Users\BECKO\AppData\Roaming\Macromedia
      2018-08-11 16:21 - 2018-08-11 16:21 - 000000000 ____D C:\Users\BECKO\AppData\Local\CEF
      2018-08-11 16:17 - 2018-08-11 17:11 - 000000000 ____D C:\Users\BECKO\AppData\Local\K-Meleon
      2018-08-11 16:17 - 2018-08-11 16:17 - 000001079 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\K-Meleon.lnk
      2018-08-11 16:17 - 2018-08-11 16:17 - 000001067 _____ C:\Users\Public\Desktop\K-Meleon.lnk
      2018-08-11 16:17 - 2018-08-11 16:17 - 000000000 ____D C:\Users\BECKO\Downloads\k-meleon
      2018-08-11 16:17 - 2018-08-11 16:17 - 000000000 ____D C:\Users\BECKO\AppData\Roaming\Mozilla
      2018-08-11 16:17 - 2018-08-11 16:17 - 000000000 ____D C:\Users\BECKO\AppData\Roaming\K-Meleon
      2018-08-11 16:17 - 2018-08-11 16:17 - 000000000 ____D C:\Program Files\K-Meleon
      2018-08-11 16:14 - 2018-08-11 16:14 - 032875887 _____ (kmeleonbrowser.org) C:\Users\BECKO\Downloads\K-Meleon76RC.exe
      2018-08-11 16:04 - 2018-08-11 16:04 - 000000000 ____H C:\Windows\system32\Drivers\MsftWdf_Kernel_01011_Coinstaller_Critical.Wdf
      2018-08-11 16:04 - 2018-08-11 16:04 - 000000000 ____H C:\Windows\system32\Drivers\Msft_Kernel_avusbflt_01011.Wdf
      2018-08-11 16:04 - 2012-07-26 06:39 - 000526952 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\Wdf01000.sys
      2018-08-11 16:04 - 2012-07-26 06:39 - 000047720 _____ (Microsoft Corporation) C:\Windows\system32\Drivers\WdfLdr.sys
      2018-08-11 16:04 - 2012-07-26 05:46 - 000009728 _____ (Microsoft Corporation) C:\Windows\system32\Wdfres.dll
      2018-08-11 16:04 - 2012-06-02 17:34 - 000000003 _____ C:\Windows\system32\Drivers\MsftWdf_Kernel_01011_Inbox_Critical.Wdf
      2018-08-11 14:20 - 2018-07-17 01:02 - 000480888 ____N (Microsoft Corporation) C:\Windows\system32\MpSigStub.exe
      2018-08-11 14:18 - 2018-08-11 14:18 - 000000492 _____ C:\Users\BECKO\Desktop\LFS.lnk
      2018-08-11 14:04 - 2018-08-11 14:04 - 000002244 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Google Chrome.lnk
      2018-08-11 14:04 - 2018-08-11 14:04 - 000002203 _____ C:\Users\Public\Desktop\Google Chrome.lnk
      2018-08-11 14:04 - 2018-08-11 14:04 - 000000000 ____D C:\Users\BECKO\AppData\Roaming\Google
      2018-08-11 14:03 - 2018-08-11 14:18 - 000000000 ____D C:\Users\BECKO\AppData\Local\Google
      2018-08-11 14:03 - 2018-08-11 14:03 - 000000000 ____D C:\Program Files\Google
      2018-08-11 14:02 - 2018-08-11 14:02 - 000057560 _____ C:\Users\BECKO\AppData\Local\GDIPFONTCACHEV1.DAT
      2018-08-11 13:49 - 2018-08-11 13:49 - 000001417 _____ C:\Users\BECKO\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Internet Explorer.lnk
      2018-08-11 13:49 - 2014-05-14 19:23 - 001973728 _____ (Microsoft Corporation) C:\Windows\system32\wuaueng.dll
      2018-08-11 13:49 - 2014-05-14 19:23 - 000581600 _____ (Microsoft Corporation) C:\Windows\system32\wuapi.dll
      2018-08-11 13:49 - 2014-05-14 19:23 - 000054240 _____ (Microsoft Corporation) C:\Windows\system32\wuauclt.exe
      2018-08-11 13:49 - 2014-05-14 19:23 - 000045536 _____ (Microsoft Corporation) C:\Windows\system32\wups2.dll
      2018-08-11 13:49 - 2014-05-14 19:23 - 000036320 _____ (Microsoft Corporation) C:\Windows\system32\wups.dll
      2018-08-11 13:49 - 2014-05-14 19:17 - 002425856 _____ (Microsoft Corporation) C:\Windows\system32\wucltux.dll
      2018-08-11 13:49 - 2014-05-14 19:17 - 000092672 _____ (Microsoft Corporation) C:\Windows\system32\wudriver.dll
      2018-08-11 13:49 - 2014-05-14 09:23 - 000179656 _____ (Microsoft Corporation) C:\Windows\system32\wuwebv.dll
      2018-08-11 13:49 - 2014-05-14 09:17 - 000033792 _____ (Microsoft Corporation) C:\Windows\system32\wuapp.exe
      2018-08-11 13:48 - 2018-08-12 08:13 - 000000000 ____D C:\Users\BECKO
      2018-08-11 13:48 - 2018-08-11 13:48 - 000000020 ___SH C:\Users\BECKO\ntuser.ini
      2018-08-11 13:48 - 2018-08-11 13:48 - 000000000 ____D C:\Users\BECKO\AppData\Local\VirtualStore
      2018-08-11 13:48 - 2010-11-21 03:46 - 000000000 ____D C:\Users\BECKO\AppData\Roaming\Media Center Programs
      2018-08-11 13:43 - 2018-08-11 13:43 - 000001345 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Media Center.lnk
      2018-08-11 13:42 - 2018-08-11 13:42 - 000001326 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Windows DVD Maker.lnk
      2018-08-11 13:41 - 2018-08-11 13:41 - 000000000 ____H C:\Windows\system32\Drivers\Msft_User_WpdFs_01_09_00.Wdf
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-08-12 07:58 - 2009-07-14 07:34 - 000026352 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-1.C7483456-A289-439d-8115-601632D005A0
      2018-08-12 07:58 - 2009-07-14 07:34 - 000026352 ____H C:\Windows\system32\7B296FB0-376B-497e-B012-9C450E1B7327-5P-0.C7483456-A289-439d-8115-601632D005A0
      2018-08-12 07:56 - 2010-11-21 00:01 - 000781298 _____ C:\Windows\system32\PerfStringBackup.INI
      2018-08-12 07:56 - 2009-07-14 05:37 - 000000000 ____D C:\Windows\inf
      2018-08-12 07:51 - 2009-07-14 07:53 - 000000006 ____H C:\Windows\Tasks\SA.DAT
      2018-08-12 00:38 - 2009-07-14 07:52 - 000028672 _____ C:\Windows\system32\config\BCD-Template
      2018-08-11 21:57 - 2009-07-14 07:52 - 000000000 ____D C:\Windows\system32\WinBioPlugIns
      2018-08-11 21:40 - 2009-07-14 01:09 - 004967424 _____ (Intel Corporation) C:\Windows\system32\igdumd32.dll
      2018-08-11 18:36 - 2009-07-14 07:33 - 000266808 _____ C:\Windows\system32\FNTCACHE.DAT
      2018-08-11 18:34 - 2009-07-14 05:37 - 000000000 ____D C:\Windows\PolicyDefinitions
      2018-08-11 17:30 - 2009-07-14 05:37 - 000000000 ____D C:\Windows\rescache
      2018-08-11 17:24 - 2010-11-21 03:38 - 000000000 ____D C:\Windows\system32\WCN
      2018-08-11 17:24 - 2009-07-14 05:37 - 000000000 ____D C:\Windows\system32\sysprep
      2018-08-11 17:24 - 2009-07-14 05:37 - 000000000 ____D C:\Windows\system32\oobe
      2018-08-11 17:24 - 2009-07-14 05:37 - 000000000 ____D C:\Windows\system32\migwiz
      2018-08-11 17:24 - 2009-07-14 05:37 - 000000000 ____D C:\Windows\servicing
      2018-08-11 17:23 - 2010-11-21 03:46 - 000000000 ____D C:\Program Files\Windows Journal
      2018-08-11 17:23 - 2009-07-14 07:52 - 000000000 ____D C:\Program Files\Windows Sidebar
      2018-08-11 17:23 - 2009-07-14 07:52 - 000000000 ____D C:\Program Files\Windows Photo Viewer
      2018-08-11 17:23 - 2009-07-14 07:52 - 000000000 ____D C:\Program Files\Windows Defender
      2018-08-11 17:23 - 2009-07-14 07:52 - 000000000 ____D C:\Program Files\DVD Maker
      2018-08-11 17:23 - 2009-07-14 05:37 - 000000000 ____D C:\Program Files\Common Files\System
      2018-08-11 14:05 - 2017-10-21 15:53 - 000000000 ____D C:\LFS
      2018-08-11 13:48 - 2009-07-14 05:37 - 000000000 __RHD C:\Users\Public\Libraries
      2018-08-11 13:43 - 2009-07-14 07:52 - 000000000 ___RD C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Games
      2018-08-11 13:39 - 2010-11-21 03:46 - 000000000 ____D C:\Windows\CSC
      ==================== Files in the root of some directories =======
      2018-08-11 18:54 - 2018-07-20 18:17 - 084469760 _____ (Microsoft Corporation) C:\Users\BECKO\AppData\Roaming\rasapi32.dll
      2018-08-12 00:53 - 2018-08-12 00:53 - 000000046 _____ () C:\Users\BECKO\AppData\Roaming\WB.CFG
      Some files in TEMP:
      2018-08-12 06:43 - 2018-08-11 18:28 - 001289096 _____ (Microsoft Corporation) C:\Users\BECKO\AppData\Local\Temp\dllnt_dump.dll
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\Windows\explorer.exe => File is digitally signed
      C:\Windows\system32\winlogon.exe => File is digitally signed
      C:\Windows\system32\wininit.exe => File is digitally signed
      C:\Windows\system32\svchost.exe => File is digitally signed
      C:\Windows\system32\services.exe => File is digitally signed
      C:\Windows\system32\User32.dll => File is digitally signed
      C:\Windows\system32\userinit.exe => File is digitally signed
      C:\Windows\system32\rpcss.dll => File is digitally signed
      C:\Windows\system32\dnsapi.dll => File is digitally signed
      C:\Windows\system32\Drivers\volsnap.sys => File is digitally signed
      LastRegBack: 2018-08-11 13:38
      ==================== End of FRST.txt ============================
      Additional scan result of Farbar Recovery Scan Tool (x86) Version: 02.08.2018
      Ran by BECKO (12-08-2018 08:47:38)
      Running from C:\Users\BECKO\Downloads
      Microsoft Windows 7 Ultimate  Service Pack 1 (X86) (2018-08-11 10:48:46)
      Boot Mode: Normal

      ==================== Accounts: =============================
      Administrator (S-1-5-21-4192057778-3853912004-1886924142-500 - Administrator - Disabled)
      BECKO (S-1-5-21-4192057778-3853912004-1886924142-1001 - Administrator - Enabled) => C:\Users\BECKO
      Guest (S-1-5-21-4192057778-3853912004-1886924142-501 - Limited - Disabled)
      HomeGroupUser$ (S-1-5-21-4192057778-3853912004-1886924142-1002 - Limited - Enabled)
      ==================== Security Center ========================
      (If an entry is included in the fixlist, it will be removed.)
      AV: Malwarebytes (Enabled - Up to date) {23007AD3-69FE-687C-2629-D584AFFAF72B}
      AS: Malwarebytes (Enabled - Up to date) {98619B37-4FC4-67F2-1C99-EEF6D47DBD96}
      AS: Windows Defender (Enabled - Up to date) {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
      ==================== Installed Programs ======================
      (Only the adware programs with "Hidden" flag could be added to the fixlist to unhide them. The adware programs should be uninstalled manually.)
      Adobe Flash Player 30 NPAPI (HKLM\...\Adobe Flash Player NPAPI) (Version: - Adobe Systems Incorporated)
      Adobe Flash Player 30 PPAPI (HKLM\...\Adobe Flash Player PPAPI) (Version: - Adobe Systems Incorporated)
      Driver Easy 5.6.4 (HKLM\...\DriverEasy_is1) (Version: 5.6.4 - Easeware)
      Google Chrome (HKLM\...\Google Chrome) (Version: 68.0.3440.106 - Google Inc.)
      Google Update Helper (HKLM\...\{60EC980A-BDA2-4CB6-A427-B07A5498B4CA}) (Version: - Google Inc.) Hidden
      K-Meleon 76.0 (x86 en-US) (HKLM\...\K-Meleon 76.0 (x86 en-US)) (Version: 76.0 - kmeleonbrowser.org)
      Malwarebytes, версия (HKLM\...\{35065F43-4BB2-439A-BFF7-0F1014F2E0CD}_is1) (Version: - Malwarebytes)
      Microsoft .NET Framework 4.6.2 (HKLM\...\{92FB6C44-E685-45AD-9B20-CADF4CABA132} - 1033) (Version: 4.6.01590 - Microsoft Corporation)
      RogueKiller version (HKLM\...\8B3D7924-ED89-486B-8322-E8594065D5CB_is1) (Version: - Adlice Software)
      Synaptics Pointing Device Driver (HKLM\...\SynTPDeinstKey) (Version: - Synaptics Incorporated)
      Zemana AntiMalware (HKLM\...\{8F0CD7D1-42F3-4195-95CD-833578D45057}_is1) (Version: - Zemana Ltd.)
      ==================== Custom CLSID (Whitelisted): ==========================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      CustomCLSID: HKU\S-1-5-21-4192057778-3853912004-1886924142-1001_Classes\CLSID\{d33c6260-dafc-4b90-bf39-8ad6a5f19b7d}\localserver32 -> "C:\Program Files\Avira\SoftwareUpdater\AviraSoftwareUpdaterToastNotificationsBridge.exe" -ToastActivated => No File
      ContextMenuHandlers1: [2.0 Zemana AntiMalware] -> {6ABB1C11-E261-4CEA-BBB5-3836225689DD} => C:\Program Files\Zemana AntiMalware\ZAMShellExt32.dll [2018-08-12] ()
      ContextMenuHandlers3: [MBAMShlExt] -> {57CE581A-0CB6-4266-9CA0-19364C90A0B3} => C:\Program Files\Malwarebytes\Anti-Malware\mbshlext.dll [2018-05-09] (Malwarebytes)
      ContextMenuHandlers5: [igfxcui] -> {3AB1675A-CCFF-11D2-8B20-00A0C93CB1F4} => C:\Windows\system32\igfxpph.dll [2018-08-11] (Intel Corporation)
      ContextMenuHandlers6: [2.0 Zemana AntiMalware] -> {6ABB1C11-E261-4CEA-BBB5-3836225689DD} => C:\Program Files\Zemana AntiMalware\ZAMShellExt32.dll [2018-08-12] ()
      ContextMenuHandlers6: [MBAMShlExt] -> {57CE581A-0CB6-4266-9CA0-19364C90A0B3} => C:\Program Files\Malwarebytes\Anti-Malware\mbshlext.dll [2018-05-09] (Malwarebytes)
      ==================== Scheduled Tasks (Whitelisted) =============
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      Task: {15D51586-5D78-42F1-9AC0-F11850F32BB2} - System32\Tasks\Adobe Flash Player PPAPI Notifier => C:\Windows\system32\Macromed\Flash\FlashUtil32_30_0_0_134_pepper.exe [2018-08-11] (Adobe Systems Incorporated)
      Task: {4311FBF7-FF23-4B96-8A7A-7C848E6879A9} - System32\Tasks\GoogleUpdateTaskMachineUA => C:\Program Files\Google\Update\GoogleUpdate.exe [2018-08-11] (Google Inc.)
      Task: {755ADDF9-F707-4126-9FD6-5EE5C09A6ED0} - System32\Tasks\GoogleUpdateTaskMachineCore => C:\Program Files\Google\Update\GoogleUpdate.exe [2018-08-11] (Google Inc.)
      Task: {87310821-94B6-4F2B-B233-805F8167F2AD} - System32\Tasks\Adobe Flash Player Updater => C:\Windows\system32\Macromed\Flash\FlashPlayerUpdateService.exe [2018-08-11] (Adobe Systems Incorporated)
      Task: {A663C5B5-F8F8-4769-83E9-A86545183E28} - System32\Tasks\Adobe Flash Player NPAPI Notifier => C:\Windows\system32\Macromed\Flash\FlashUtil32_30_0_0_134_Plugin.exe [2018-08-11] (Adobe Systems Incorporated)
      (If an entry is included in the fixlist, the task (.job) file will be moved. The file which is running by the task will not be moved.)

      ==================== Shortcuts & WMI ========================
      (The entries could be listed to be restored or removed.)

      ==================== Loaded Modules (Whitelisted) ==============
      2018-08-11 19:36 - 2018-07-03 12:59 - 002077904 _____ () C:\PROGRAM FILES\MALWAREBYTES\ANTI-MALWARE\MwacLib.dll
      2018-08-11 19:36 - 2018-06-18 13:32 - 002169040 _____ () C:\PROGRAM FILES\MALWAREBYTES\ANTI-MALWARE\SelfProtectionSdk.dll
      2018-08-11 14:04 - 2018-08-08 03:55 - 004076888 _____ () C:\Program Files\Google\Chrome\Application\68.0.3440.106\libglesv2.dll
      2018-08-11 14:04 - 2018-08-08 03:55 - 000096088 _____ () C:\Program Files\Google\Chrome\Application\68.0.3440.106\libegl.dll
      ==================== Alternate Data Streams (Whitelisted) =========
      (If an entry is included in the fixlist, only the ADS will be removed.)
      AlternateDataStreams: C:\Windows\system32\config\systemprofile:.repos [6121592]
      ==================== Safe Mode (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The "AlternateShell" value will be restored.)
      HKLM\SYSTEM\CurrentControlSet\Control\SafeBoot\Minimal\MBAMService => ""="Service"
      HKLM\SYSTEM\CurrentControlSet\Control\SafeBoot\Network\MBAMService => ""="Service"
      ==================== Association (Whitelisted) ===============
      (If an entry is included in the fixlist, the registry item will be restored to default or removed.)

      ==================== Internet Explorer trusted/restricted ===============
      (If an entry is included in the fixlist, it will be removed from the registry.)

      ==================== Hosts content: ===============================
      (If needed Hosts: directive could be included in the fixlist to reset Hosts.)
      2009-07-14 05:04 - 2009-06-11 00:39 - 000000824 _____ C:\Windows\system32\Drivers\etc\hosts

      ==================== Other Areas ============================
      (Currently there is no automatic fix for this section.)
      HKU\S-1-5-21-4192057778-3853912004-1886924142-1001\Control Panel\Desktop\\Wallpaper -> C:\Users\BECKO\AppData\Roaming\Microsoft\Windows\Themes\TranscodedWallpaper.jpg
      DNS Servers:
      HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System => (ConsentPromptBehaviorAdmin: 5) (ConsentPromptBehaviorUser: 3) (EnableLUA: 1)
      Windows Firewall is enabled.
      ==================== MSCONFIG/TASK MANAGER disabled items ==

      ==================== FirewallRules (Whitelisted) ===============
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      FirewallRules: [{38F020BD-9D8B-47A7-BA58-523640743E70}] => (Allow) C:\Program Files\Google\Chrome\Application\chrome.exe
      FirewallRules: [TCP Query User{73CDBD4B-E707-4433-90BB-0CA4D37853D5}D:\lfs\lfs.exe] => (Allow) D:\lfs\lfs.exe
      FirewallRules: [UDP Query User{43AE0B81-FBBA-40D9-9930-B10662946E5D}D:\lfs\lfs.exe] => (Allow) D:\lfs\lfs.exe
      FirewallRules: [{EB2B59E7-24DC-4376-8CA5-5C73EB6B45AC}] => (Allow) C:\Windows\Microsoft.NET\Framework\v4.0.30319\SMSvcHost.exe
      FirewallRules: [TCP Query User{3CA70832-11D6-43D6-996B-CE4FD0FFCA2F}C:\program files\avira\softwareupdater\avirasoftwareupdatertoastnotificationsbridge.exe] => (Allow) C:\program files\avira\softwareupdater\avirasoftwareupdatertoastnotificationsbridge.exe
      FirewallRules: [UDP Query User{A8FAE1F8-F48D-463D-9467-C469B6224C66}C:\program files\avira\softwareupdater\avirasoftwareupdatertoastnotificationsbridge.exe] => (Allow) C:\program files\avira\softwareupdater\avirasoftwareupdatertoastnotificationsbridge.exe
      FirewallRules: [{C20D9306-3310-4603-955A-D8750AB02ABC}] => (Allow) C:\Users\BECKO\AppData\Local\Chromium\Application\chrome.exe
      ==================== Restore Points =========================
      11-08-2018 13:48:58 Windows Update
      11-08-2018 14:19:49 Windows Update
      11-08-2018 16:16:29 Windows Backup
      11-08-2018 16:53:14 Language Pack Installation
      11-08-2018 18:23:09 Програма за инсталиране на модули за Windows
      11-08-2018 18:41:57 Windows Update
      11-08-2018 18:46:40 Removed Avira Software Updater
      11-08-2018 19:18:13 Точка на възстановяване на HitmanPro
      11-08-2018 19:29:58 Точка на възстановяване на HitmanPro
      ==================== Faulty Device Manager Devices =============
      Name: RICOH Bay8Controller
      Description: RICOH Bay8Controller
      Class Guid: 
      Problem: : The drivers for this device are not installed. (Code 28)
      Resolution: To install the drivers for this device, click "Update Driver", which starts the Hardware Update wizard.

      ==================== Event log errors: =========================
      Application errors:
      Error: (08/12/2018 07:53:07 AM) (Source: WinMgmt) (EventID: 10) (User: )
      Description: Event filter with query "SELECT * FROM __InstanceModificationEvent WITHIN 60 WHERE TargetInstance ISA "Win32_Processor" AND TargetInstance.LoadPercentage > 99" could not be reactivated in namespace "//./root/CIMV2" because of error 0x80041003. Events cannot be delivered through this filter until the problem is corrected.
      Error: (08/12/2018 07:48:58 AM) (Source: WinMgmt) (EventID: 10) (User: )
      Description: Event filter with query "SELECT * FROM __InstanceModificationEvent WITHIN 60 WHERE TargetInstance ISA "Win32_Processor" AND TargetInstance.LoadPercentage > 99" could not be reactivated in namespace "//./root/CIMV2" because of error 0x80041003. Events cannot be delivered through this filter until the problem is corrected.
      Error: (08/12/2018 07:16:25 AM) (Source: WinMgmt) (EventID: 10) (User: )
      Description: Event filter with query "SELECT * FROM __InstanceModificationEvent WITHIN 60 WHERE TargetInstance ISA "Win32_Processor" AND TargetInstance.LoadPercentage > 99" could not be reactivated in namespace "//./root/CIMV2" because of error 0x80041003. Events cannot be delivered through this filter until the problem is corrected.
      Error: (08/12/2018 07:12:39 AM) (Source: Application Error) (EventID: 1000) (User: )
      Description: Име на приложение с грешки: rundll32.exe_rasapi32.dll, версия: 6.1.7600.16385, времево клеймо: 0x4a5bc637
      Име на модул с грешки: rasapi32.dll_unloaded, версия:, времево клеймо: 0x5b51fcfc
      Код на изключение: 0xc0000005
      Отместване на грешка: 0x5d2300fb
      ИД на процес на грешка: 0xc58
      Начален час на приложението с грешки: 0x01d431b9f55ad649
      Път на приложението с грешки: C:\Windows\System32\rundll32.exe
      Път на модула с грешки: rasapi32.dll
      ИД на доклад: f345bb24-9de5-11e8-8c5b-002713343a56
      Error: (08/12/2018 12:27:39 AM) (Source: WinMgmt) (EventID: 10) (User: )
      Description: Event filter with query "SELECT * FROM __InstanceModificationEvent WITHIN 60 WHERE TargetInstance ISA "Win32_Processor" AND TargetInstance.LoadPercentage > 99" could not be reactivated in namespace "//./root/CIMV2" because of error 0x80041003. Events cannot be delivered through this filter until the problem is corrected.
      Error: (08/11/2018 10:30:43 PM) (Source: WinMgmt) (EventID: 10) (User: )
      Description: Event filter with query "SELECT * FROM __InstanceModificationEvent WITHIN 60 WHERE TargetInstance ISA "Win32_Processor" AND TargetInstance.LoadPercentage > 99" could not be reactivated in namespace "//./root/CIMV2" because of error 0x80041003. Events cannot be delivered through this filter until the problem is corrected.
      Error: (08/11/2018 08:31:45 PM) (Source: WinMgmt) (EventID: 10) (User: )
      Description: Event filter with query "SELECT * FROM __InstanceModificationEvent WITHIN 60 WHERE TargetInstance ISA "Win32_Processor" AND TargetInstance.LoadPercentage > 99" could not be reactivated in namespace "//./root/CIMV2" because of error 0x80041003. Events cannot be delivered through this filter until the problem is corrected.
      Error: (08/11/2018 07:56:18 PM) (Source: WinMgmt) (EventID: 10) (User: )
      Description: Event filter with query "SELECT * FROM __InstanceModificationEvent WITHIN 60 WHERE TargetInstance ISA "Win32_Processor" AND TargetInstance.LoadPercentage > 99" could not be reactivated in namespace "//./root/CIMV2" because of error 0x80041003. Events cannot be delivered through this filter until the problem is corrected.

      System errors:
      Error: (08/12/2018 07:50:21 AM) (Source: Service Control Manager) (EventID: 7031) (User: )
      Description: Услуга Software Protection беше прекъсната неочаквано. Това се е случвало с нея 1 път(и). След 120000 милисекунди ще бъде предприето следното коригиращо действие: Restart the service.
      Error: (08/12/2018 07:50:21 AM) (Source: Service Control Manager) (EventID: 7034) (User: )
      Description: Услуга HP Service беше прекъсната неочаквано. Това се е случвало с нея 1 път(и).
      Error: (08/12/2018 07:50:20 AM) (Source: Service Control Manager) (EventID: 7031) (User: )
      Description: Услуга Windows Media Player Network Sharing Service беше прекъсната неочаквано. Това се е случвало с нея 1 път(и). След 30000 милисекунди ще бъде предприето следното коригиращо действие: Restart the service.
      Error: (08/12/2018 07:50:20 AM) (Source: Service Control Manager) (EventID: 7034) (User: )
      Description: Услуга Bluetooth Driver Management Service беше прекъсната неочаквано. Това се е случвало с нея 1 път(и).
      Error: (08/12/2018 07:46:28 AM) (Source: Service Control Manager) (EventID: 7000) (User: )
      Description: Услуга Windows Media Player Network Sharing Service не може да бъде стартирана поради следната грешка: 
      Системата не може да намери указания път.
      Error: (08/12/2018 07:45:57 AM) (Source: Service Control Manager) (EventID: 7034) (User: )
      Description: Услуга HP Service беше прекъсната неочаквано. Това се е случвало с нея 1 път(и).
      Error: (08/12/2018 07:45:57 AM) (Source: Service Control Manager) (EventID: 7034) (User: )
      Description: Услуга Bluetooth Driver Management Service беше прекъсната неочаквано. Това се е случвало с нея 1 път(и).
      Error: (08/12/2018 07:45:56 AM) (Source: Service Control Manager) (EventID: 7031) (User: )
      Description: Услуга Windows Media Player Network Sharing Service беше прекъсната неочаквано. Това се е случвало с нея 1 път(и). След 30000 милисекунди ще бъде предприето следното коригиращо действие: Restart the service.

      Windows Defender:
      Date: 2018-08-11 18:49:37.775
      Windows Defender has detected spyware or other potentially unwanted software.
      For more information please see the following:
      Category:Software Bundler
      Path Found:file:C:\Program Files\KMSPico 10.2.1 Final\WindowsLoader.exe;process:pid:1664
      Detection Type:Concrete
      Detection Source:Real-Time Protection
      Process Name:
      Date: 2018-08-11 18:47:53.133
      Code Integrity is unable to verify the image integrity of the file \Device\HarddiskVolume2\Program Files\Avira\Antivirus\avirasecuritycenteragent.exe because the set of per-page image hashes could not be found on the system.
      Date: 2018-08-11 18:47:33.024
      Code Integrity is unable to verify the image integrity of the file \Device\HarddiskVolume2\Program Files\Avira\Antivirus\avirasecuritycenteragent.exe because the set of per-page image hashes could not be found on the system.
      Date: 2018-08-11 18:46:32.355
      Code Integrity is unable to verify the image integrity of the file \Device\HarddiskVolume2\Program Files\Avira\Antivirus\avirasecuritycenteragent.exe because the set of per-page image hashes could not be found on the system.
      Date: 2018-08-11 18:36:54.706
      Code Integrity is unable to verify the image integrity of the file \Device\HarddiskVolume2\Program Files\Avira\Antivirus\avirasecuritycenteragent.exe because the set of per-page image hashes could not be found on the system.
      Date: 2018-08-11 18:34:39.836
      Code Integrity is unable to verify the image integrity of the file \Device\HarddiskVolume2\Program Files\Avira\Antivirus\avirasecuritycenteragent.exe because the set of per-page image hashes could not be found on the system.
      Date: 2018-08-11 18:29:33.389
      Code Integrity is unable to verify the image integrity of the file \Device\HarddiskVolume2\Program Files\Avira\Antivirus\avirasecuritycenteragent.exe because the set of per-page image hashes could not be found on the system.
      Date: 2018-08-11 18:26:43.817
      Code Integrity is unable to verify the image integrity of the file \Device\HarddiskVolume2\Program Files\Avira\Antivirus\avirasecuritycenteragent.exe because the set of per-page image hashes could not be found on the system.
      Date: 2018-08-11 18:19:33.847
      Code Integrity is unable to verify the image integrity of the file \Device\HarddiskVolume2\Program Files\Avira\Antivirus\avirasecuritycenteragent.exe because the set of per-page image hashes could not be found on the system.
      ==================== Memory info =========================== 
      Processor: Intel(R) Core(TM)2 Duo CPU P8600 @ 2.40GHz
      Percentage of memory in use: 57%
      Total physical RAM: 3000.26 MB
      Available physical RAM: 1266.7 MB
      Total Virtual: 7094.55 MB
      Available Virtual: 5571.67 MB
      ==================== Drives ================================
      Drive c: () (Fixed) (Total:100.1 GB) (Free:34 GB) NTFS
      Drive d: () (Fixed) (Total:365.12 GB) (Free:278.48 GB) NTFS
      \\?\Volume{b6af5893-9d52-11e8-b3b1-806e6f6e6963}\ (Резервирана за системата) (Fixed) (Total:0.1 GB) (Free:0.06 GB) NTFS
      \\?\Volume{b6af5896-9d52-11e8-b3b1-806e6f6e6963}\ () (Fixed) (Total:0.44 GB) (Free:0.16 GB) NTFS
      ==================== MBR & Partition Table ==================
      Disk: 0 (MBR Code: Windows 7/8/10) (Size: 465.8 GB) (Disk ID: 0FD73A73)
      Partition 1: (Active) - (Size=100 MB) - (Type=07 NTFS)
      Partition 2: (Not Active) - (Size=100.1 GB) - (Type=07 NTFS)
      Partition 3: (Not Active) - (Size=365.1 GB) - (Type=07 NTFS)
      Partition 4: (Not Active) - (Size=450 MB) - (Type=27)
      ==================== End of Addition.txt ============================
      това беше открито снощи 
      -Детайли за регистъра-
      Дата на сканиране: 11.08.18 г.
      Час на сканиране: 19:39
      Файл на регистъра: 1355b5a2-9d85-11e8-97c9-002713343a56.json
      Администратор: Да
      -Информация за софтуера-
      Версия на компонентите: 1.0.391
      Актуализирай версията на пакета: 1.0.6301
      Лиценз: Пробен период
      -Системна информация-
      OS: Windows 7 Service Pack 1
      CPU: x86
      Файлова система: NTFS
      Потребител: BECKO-PC\BECKO
      -Резюме на сканирането-
      Тип сканиране: Threat Scan
      Сканирането е стартирано от: Ръчно
      Резултат: Завършено
      Сканирани обекти: 158748
      Открити заплахи: 85
      Заплахи под карантина: 85
      Изтекло време: 3 мин, 55 сек
      -Опции за сканиране-
      Памет: Разрешено
      Стартиране: Разрешено
      Файлова система: Разрешено
      Архиви: Разрешено
      руткитове: Разрешено
      Евристика: Разрешено
      PUP: Открий
      PUM: Открий
      -Детайли за сканирането-
      Процес: 0
      (Не бяха открити зловредни елементи)
      Модул: 0
      (Не бяха открити зловредни елементи)
      Ключ на регистъра: 16
      PUP.Optional.WinYahoo.Generic, HKLM\SOFTWARE\MICROSOFT\WINDOWS NT\CURRENTVERSION\SCHEDULE\TASKCACHE\TREE\Chromium tatec, Под карантина, [3754], [483380],1.0.6301
      PUP.Optional.WinYahoo.Generic, HKLM\SOFTWARE\MICROSOFT\WINDOWS NT\CURRENTVERSION\SCHEDULE\TASKCACHE\TASKS\{BE6502A1-73F7-4D69-A62B-FDC3122C8BAB}, Под карантина, [3754], [483380],1.0.6301
      PUP.Optional.WinYahoo.Generic, HKLM\SOFTWARE\MICROSOFT\WINDOWS NT\CURRENTVERSION\SCHEDULE\TASKCACHE\PLAIN\{BE6502A1-73F7-4D69-A62B-FDC3122C8BAB}, Под карантина, [3754], [483380],1.0.6301
      Adware.Agent, HKLM\SOFTWARE\MICROSOFT\WINDOWS NT\CURRENTVERSION\SCHEDULE\TASKCACHE\TASKS\{5A62AD84-CD2D-4C9B-AB06-213D0315B69D}, Под карантина, [103], [535908],1.0.6301
      Adware.Agent, HKLM\SOFTWARE\MICROSOFT\WINDOWS NT\CURRENTVERSION\SCHEDULE\TASKCACHE\PLAIN\{5A62AD84-CD2D-4C9B-AB06-213D0315B69D}, Под карантина, [103], [535908],1.0.6301
      Adware.Tuto4PC, HKLM\SOFTWARE\MICROSOFT\WINDOWS\CURRENTVERSION\UNINSTALL\Multitimer_is1, Под карантина, [2764], [474048],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion\Schedule\TaskCache\Tree\Chromium tatec, Под карантина, [3725], [-1],0.0.0
      PUP.Optional.WinYahoo.TskLnk, HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion\Schedule\TaskCache\Tasks\{BE6502A1-73F7-4D69-A62B-FDC3122C8BAB}, Под карантина, [3725], [-1],0.0.0
      PUP.Optional.WinYahoo.TskLnk, HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion\Schedule\TaskCache\Plain\{BE6502A1-73F7-4D69-A62B-FDC3122C8BAB}, Под карантина, [3725], [-1],0.0.0
      Adware.FastDataX, HKU\S-1-5-21-4192057778-3853912004-1886924142-1001\SOFTWARE\FastDataX, Под карантина, [3932], [484533],1.0.6301
      Adware.ICLoader, HKLM\SOFTWARE\MICROSOFT\campaign9961, Под карантина, [417], [518478],1.0.6301
      Adware.ICLoader, HKLM\SOFTWARE\MICROSOFT\multitimercampaign84170, Под карантина, [417], [518476],1.0.6301
      Adware.ICLoader, HKLM\SOFTWARE\MICROSOFT\Speedycar, Под карантина, [417], [518473],1.0.6301
      Adware.ICLoader, HKLM\SOFTWARE\MICROSOFT\TechnologyDesktopnew, Под карантина, [417], [518479],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, HKLM\SOFTWARE\MICROSOFT\WINDOWS\CURRENTVERSION\UNINSTALL\{D2A33A63-8223-EBE3-33A3-9B63E32348E3}, Под карантина, [3725], [542290],1.0.6301
      Стойност на регистъра: 6
      Adware.Tuto4PC, HKLM\SOFTWARE\MICROSOFT\WINDOWS\CURRENTVERSION\RUN|Multitimer, Под карантина, [2764], [474048],1.0.6301
      PUP.Optional.NotChromeRun, HKU\S-1-5-21-4192057778-3853912004-1886924142-1001\SOFTWARE\MICROSOFT\WINDOWS\CURRENTVERSION\RUN|GOOGLECHROMEAUTOLAUNCH_A26881468A4EFB18BAF645F9B1FB72E9, Под карантина, [6940], [241243],1.0.6301
      Adware.Tuto4PC.Generic, HKLM\SOFTWARE\MICROSOFT\WINDOWS\CURRENTVERSION\RUNONCE|QWTD433SW12, Под карантина, [3704], [522751],1.0.6301
      Adware.NeoBar, HKU\S-1-5-21-4192057778-3853912004-1886924142-1001\SOFTWARE\MICROSOFT\WINDOWS\CURRENTVERSION\RUNONCE|AwRWNQQxQn, Под карантина, [1236], [431477],1.0.6301
      Adware.Agent, HKLM\SOFTWARE\MICROSOFT\WINDOWS NT\CURRENTVERSION\SCHEDULE\TASKCACHE\TASKS\{5A62AD84-CD2D-4C9B-AB06-213D0315B69D}|PATH, Под карантина, [103], [535907],1.0.6301
      PUP.Optional.WinYahoo.Generic, HKLM\SOFTWARE\MICROSOFT\WINDOWS NT\CURRENTVERSION\SCHEDULE\TASKCACHE\TASKS\{BE6502A1-73F7-4D69-A62B-FDC3122C8BAB}|PATH, Под карантина, [3754], [483378],1.0.6301
      Данни на регистъра: 0
      (Не бяха открити зловредни елементи)
      Поток данни: 0
      (Не бяха открити зловредни елементи)
      Папка: 8
      PUP.Optional.BundleInstaller, C:\USERS\BECKO\APPDATA\LOCAL\TEMP\845712, Под карантина, [407], [463480],1.0.6301
      Adware.Tuto4PC, C:\PROGRAM FILES\MULTITIMER, Под карантина, [2764], [474048],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\PROGRAMDATA\{5AE19F82-D0A3-1544-5665-8B06CC2700C8}, Под карантина, [3725], [484243],1.0.6301
      PUP.Optional.BitsInstall.BITSRST, C:\PROGRAMDATA\5b2ec796-04d1-0, Под карантина, [679], [407181],1.0.6301
      PUP.Optional.BitsInstall.BITSRST, C:\PROGRAMDATA\5b2ec796-56c1-1, Под карантина, [679], [407181],1.0.6301
      Adware.NeoBar, C:\USERS\BECKO\APPDATA\LOCAL\CYPJMERAKY, Под карантина, [1236], [431477],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HowToRemove, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\USERS\BECKO\APPDATA\LOCAL\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}, Под карантина, [3725], [542290],1.0.6301
      Файл: 55
      PUP.Optional.Amonetize.Gen, C:\PROGRAMDATA\5b2ec796-04d1-0\BITAC33.tmp, Под карантина, [3742], [257931],1.0.6301
      PUP.Optional.Amonetize.Gen, C:\PROGRAMDATA\5b2ec796-56c1-1\BIT96A0.tmp, Под карантина, [3742], [257931],1.0.6301
      PUP.Optional.BundleInstaller, C:\USERS\BECKO\APPDATA\LOCAL\TEMP\845712\ic-0.9290ec7e4e043.exe, Под карантина, [407], [463480],1.0.6301
      PUP.Optional.BundleInstaller, C:\Users\BECKO\AppData\Local\Temp\845712\ic-0.ab640b600fd5f8.exe, Под карантина, [407], [463480],1.0.6301
      PUP.Optional.WinYahoo.Generic, C:\WINDOWS\SYSTEM32\TASKS\Chromium tatec, Под карантина, [3754], [483380],1.0.6301
      Adware.Agent, C:\WINDOWS\SYSTEM32\TASKS\OPERA SCHEDULED AUTOUPDATE 4086469641, Под карантина, [103], [535908],1.0.6301
      Adware.Agent, C:\USERS\BECKO\APPDATA\LOCAL\TEMP\allradio_4.27_portable.exe, Под карантина, [103], [536191],1.0.6301
      Adware.Tuto4PC, C:\PROGRAM FILES\MULTITIMER\UNINS000.DAT, Под карантина, [2764], [474048],1.0.6301
      Adware.Tuto4PC, C:\Program Files\Multitimer\Multitimer.exe, Под карантина, [2764], [474048],1.0.6301
      Adware.Tuto4PC, C:\Program Files\Multitimer\unins000.exe, Под карантина, [2764], [474048],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\PROGRAMDATA\{5AE19F82-D0A3-1544-5665-8B06CC2700C8}\fado, Под карантина, [3725], [484243],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\ProgramData\{5AE19F82-D0A3-1544-5665-8B06CC2700C8}\hdat1, Под карантина, [3725], [484243],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\ProgramData\{5AE19F82-D0A3-1544-5665-8B06CC2700C8}\hdat2, Под карантина, [3725], [484243],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\WINDOWS\SYSTEM32\TASKS\Chromium tatec, Под карантина, [3725], [-1],0.0.0
      Adware.Tuto4PC.Generic, C:\PROGRAM FILES\YUYFG\5138832.EXE, Под карантина, [3704], [522751],1.0.6301
      PUP.Optional.BitsInstall.BITSRST, C:\PROGRAMDATA\MICROSOFT\NETWORK\DOWNLOADER\QMGR0.DAT, Под карантина, [679], [-1],0.0.0
      PUP.Optional.BitsInstall.BITSRST, C:\PROGRAMDATA\MICROSOFT\NETWORK\DOWNLOADER\QMGR1.DAT, Под карантина, [679], [-1],0.0.0
      Adware.NeoBar, C:\Users\BECKO\AppData\Local\cypjMERAky\activation.exe, Под карантина, [1236], [431477],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\PROGRAMDATA\Microsoft\Windows\Start Menu\Programs\HowToRemove.lnk, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\USERS\BECKO\APPDATA\LOCAL\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HOWTOREMOVE\HOWTOREMOVE.HTML, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HowToRemove\chromium-min.jpg, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HowToRemove\control panel-min-min.JPG, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HowToRemove\down.png, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HowToRemove\ff menu.JPG, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HowToRemove\ff search engine-min.png, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HowToRemove\hp-min ff.png, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HowToRemove\hp-min ie.png, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HowToRemove\search engine.gif, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HowToRemove\setup pages.gif, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HowToRemove\sp-min.png, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HowToRemove\start-min.jpg, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\HowToRemove\up.png, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\lilacisa, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\lonadel, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\uninst.exe, Под карантина, [3725], [542290],1.0.6301
      PUP.Optional.WinYahoo.TskLnk, C:\Users\BECKO\AppData\Local\{0BF43DA8-2F5C-5110-42C4-74F866AC8860}\uninstp.dat, Под карантина, [3725], [542290],1.0.6301
      Ransom.Crysis, C:\USERS\BECKO\APPDATA\ROAMING\MICROSOFT\WINDOWS\REACSRHG\UIFBACFE.EXE, Под карантина, [7210], [551188],1.0.6301
      Generic.Malware/Suspicious, C:\USERS\BECKO\APPDATA\ROAMING\MICROSOFT\WINDOWS\START MENU\PROGRAMS\STARTUP\Sound Volume Control.lnk, Под карантина, [0], [392686],1.0.6301
      Generic.Malware/Suspicious, C:\USERS\BECKO\APPDATA\ROAMING\SOUND VOLUME CONTROL\SNDVOL.EXE, Под карантина, [0], [392686],1.0.6301
      PUP.Optional.BundleInstaller, C:\PROGRAM FILES\KMSPICO 10.2.1 FINAL\REGISTRY_ACTIVATION_2751393056.EXE, Под карантина, [407], [505351],1.0.6301
      Trojan.MalPack, C:\PROGRAM FILES\KMSPICO 10.2.1 FINAL\WINDOWSLOADER.EXE, Под карантина, [4152], [500527],1.0.6301
      Backdoor.Bot, C:\PROGRAM FILES\KMSPICO 10.2.1 FINAL\ACTIVATION.EXE, Под карантина, [806], [419768],1.0.6301
      Adware.Agent, C:\USERS\BECKO\APPDATA\LOCAL\TEMP\IS-AT1Q7.TMP\ZRGVBV.DLL, Под карантина, [103], [539849],1.0.6301
      Generic.Malware/Suspicious, C:\USERS\BECKO\APPDATA\LOCAL\TEMP\TEMP2_WINDOWS LOADER 3.1.ZIP\WINDOWS LOADER 3.1.EXE, Под карантина, [0], [392686],1.0.6301
      Generic.Malware/Suspicious, C:\USERS\BECKO\APPDATA\LOCAL\TEMP\TEMP3_WINDOWS LOADER 3.1.ZIP\WINDOWS LOADER 3.1.EXE, Под карантина, [0], [392686],1.0.6301
      Generic.Malware/Suspicious, C:\USERS\BECKO\APPDATA\LOCAL\TEMP\TEMP4_WINDOWS LOADER 3.1.ZIP\WINDOWS LOADER 3.1.EXE, Под карантина, [0], [392686],1.0.6301
      Adware.Tuto4PC, C:\USERS\BECKO\APPDATA\LOCAL\TEMP\EYEKAZXXJYM.EXE, Под карантина, [2764], [474076],1.0.6301
      Generic.Malware/Suspicious, C:\USERS\BECKO\APPDATA\LOCAL\TEMP\REFSUTIL.EXE, Под карантина, [0], [392686],1.0.6301
      Generic.Malware/Suspicious, C:\USERS\BECKO\APPDATA\LOCAL\TEMP\BEAD.TMP.EXE, Под карантина, [0], [392686],1.0.6301
      Физически сектор: 0
      (Не бяха открити зловредни елементи)
      WMI: 0
      (Не бяха открити зловредни елементи)

    • от Антон Ангелов
      Имам съмнения, че системата ми е заразена работи, бавно и първият път, като отворя нов таб във файрфокс се отварят още два прозореца с реклами.
      Scan result of Farbar Recovery Scan Tool (FRST) (x64) Version: 02.08.2018
      Ran by Anton (administrator) on DESKTOP-IRI1MIH (04-08-2018 17:20:24)
      Running from C:\Users\Anton\Desktop
      Loaded Profiles: Anton (Available Profiles: Anton)
      Platform: Windows 10 Enterprise Version 1709 16299.431 (X64) Language: Български (България)
      Internet Explorer Version 11 (Default browser: FF)
      Boot Mode: Normal
      Tutorial for Farbar Recovery Scan Tool: http://www.geekstogo.com/forum/topic/335081-frst-tutorial-how-to-use-farbar-recovery-scan-tool/
      ==================== Processes (Whitelisted) =================
      (If an entry is included in the fixlist, the process will be closed. The file will not be moved.)
      (AMD) C:\Windows\System32\atiesrxx.exe
      (AMD) C:\Windows\System32\atieclxx.exe
      (Intel Corporation) C:\Windows\System32\igfxCUIService.exe
      (AVAST Software) C:\Program Files\AVAST Software\Avast\AvastSvc.exe
      (Microsoft Corporation) C:\Windows\System32\CompatTelRunner.exe
      (Adobe Systems Incorporated) C:\Program Files (x86)\Common Files\Adobe\Adobe Desktop Common\ElevationManager\AdobeUpdateService.exe
      (Adobe Systems, Incorporated) C:\Program Files (x86)\Common Files\Adobe\AdobeGCClient\AGMService.exe
      (Adobe Systems, Incorporated) C:\Program Files (x86)\Common Files\Adobe\AdobeGCClient\AGSService.exe
      (Broadcom Corporation.) C:\Windows\System32\BtwRSupportService.exe
      (Nero AG) C:\Program Files (x86)\HTC\HTC Sync Manager\HSMServiceEntry.exe
      () C:\Program Files (x86)\HTC\Internet Pass-Through\PassThruSvr.exe
      (Synaptics Incorporated) C:\Program Files\Synaptics\SynTP\SynTPEnhService.exe
      (TeamViewer GmbH) C:\Program Files (x86)\TeamViewer\TeamViewer_Service.exe
      (Conexant Systems Inc.) C:\Windows\System32\CxAudMsg64.exe
      (Synaptics Incorporated) C:\Program Files\Synaptics\SynTP\SynTPEnh.exe
      (Microsoft Corporation) C:\Windows\Microsoft.NET\Framework64\v3.0\WPF\PresentationFontCache.exe
      (Intel Corporation) C:\Windows\System32\igfxEM.exe
      (Intel Corporation) C:\Windows\System32\igfxHK.exe
      () C:\Windows\System32\igfxTray.exe
      (Synaptics Incorporated) C:\Program Files\Synaptics\SynTP\SynTPHelper.exe
      (AVAST Software) C:\Program Files\AVAST Software\Avast\x64\aswidsagenta.exe
      () C:\Program Files (x86)\HTC\HTC Sync Manager\HTC Sync\adb.exe
      (Microsoft Corporation) C:\Program Files\Windows Defender\MSASCuiL.exe
      (Realtek semiconductor) C:\Windows\RTFTrack.exe
      (Conexant Systems, Inc.) C:\Program Files\CONEXANT\cAudioFilterAgent\CAudioFilterAgent64.exe
      (BitTorrent Inc.) C:\Users\Anton\AppData\Roaming\uTorrent\uTorrent.exe
      (Disc Soft Ltd) C:\Program Files\DAEMON Tools Lite\DTAgent.exe
      (AVAST Software) C:\Program Files\AVAST Software\Avast\AvastUI.exe
      (BitTorrent Inc.) C:\Users\Anton\AppData\Roaming\uTorrent\updates\3.5.3_44494\utorrentie.exe
      (BitTorrent Inc.) C:\Users\Anton\AppData\Roaming\uTorrent\updates\3.5.3_44494\utorrentie.exe
      () C:\Program Files\WindowsApps\60145ScottBrogden.ditto-cp_3.21.223.0_x86__n6b029mg40na2\Ditto.exe
      (Disc Soft Ltd) C:\Program Files\DAEMON Tools Lite\DiscSoftBusServiceLite.exe
      (Microsoft Corporation) C:\Windows\System32\CompatTelRunner.exe
      (Lenovo Group Limited) C:\Users\Anton\AppData\Local\Programs\Lenovo\Lenovo Service Bridge\LSBUpdater.exe
      (AVAST Software) C:\Program Files\Common Files\Avast Software\Overseer\overseer.exe
      (Mozilla Corporation) C:\Program Files\Mozilla Firefox\firefox.exe
      (Adobe Systems, Incorporated) C:\Program Files (x86)\Common Files\Adobe\AdobeGCClient\AdobeGCClient.exe
      (Mozilla Corporation) C:\Program Files\Mozilla Firefox\firefox.exe
      (Mozilla Corporation) C:\Program Files\Mozilla Firefox\firefox.exe
      (Mozilla Corporation) C:\Program Files\Mozilla Firefox\firefox.exe
      (Mozilla Corporation) C:\Program Files\Mozilla Firefox\firefox.exe
      (Mozilla Corporation) C:\Program Files\Mozilla Firefox\firefox.exe
      (Mozilla Corporation) C:\Program Files\Mozilla Firefox\firefox.exe
      () C:\Program Files\WindowsApps\Microsoft.SkypeApp_12.1815.210.0_x64__kzf8qxf38zg5c\SkypeHost.exe
      (Microsoft Corporation) C:\Windows\System32\dllhost.exe
      () C:\Program Files (x86)\Lavasoft\Web Companion\Application\Lavasoft.WCAssistant.WinService.exe
      (Microsoft Corporation) C:\Windows\System32\CompatTelRunner.exe
      (Lavasoft) C:\Program Files (x86)\Lavasoft\Web Companion\Application\WebCompanion.exe
      ==================== Registry (Whitelisted) ===========================
      (If an entry is included in the fixlist, the registry item will be restored to default or removed. The file will not be moved.)
      HKLM\...\Run: [SecurityHealth] => C:\Program Files\Windows Defender\MSASCuiL.exe [630168 2017-09-29] (Microsoft Corporation)
      HKLM\...\Run: [RtsFT] => C:\WINDOWS\RTFTrack.exe [5052120 2015-06-01] (Realtek semiconductor)
      HKLM\...\Run: [cAudioFilterAgent] => C:\Program Files\Conexant\cAudioFilterAgent\cAudioFilterAgent64.exe [935104 2014-11-25] (Conexant Systems, Inc.)
      HKLM\...\Run: [AvastUI.exe] => C:\Program Files\AVAST Software\Avast\AvLaunch.exe [242904 2018-06-22] (AVAST Software)
      HKLM\...\Run: [AdobeAAMUpdater-1.0] => C:\Program Files (x86)\Common Files\Adobe\OOBE\PDApp\UWA\UpdaterStartupUtility.exe [508128 2016-07-01] (Adobe Systems Incorporated)
      HKLM\...\Run: [SynTPEnh] => C:\Program Files\Synaptics\SynTP\SynTPEnh.exe [3944136 2015-06-03] (Synaptics Incorporated)
      HKLM\...\Run: [SmartAudio] => C:\Program Files\CONEXANT\SAII\SACpl.exe [1830616 2014-04-10] (Conexant Systems, Inc.)
      HKLM\...\Run: [AdobeGCInvoker-1.0] => C:\Program Files (x86)\Common Files\Adobe\AdobeGCClient\AGCInvokerUtility.exe [316392 2018-05-11] (Adobe Systems, Incorporated)
      HKLM-x32\...\Run: [StartCCC] => C:\Program Files (x86)\AMD\ATI.ACE\Core-Static\amd64\CLIStart.exe [767176 2015-06-22] (Advanced Micro Devices, Inc.)
      HKLM-x32\...\Run: [Adobe Creative Cloud] => C:\Program Files (x86)\Adobe\Adobe Creative Cloud\ACC\Creative Cloud.exe [2383040 2016-10-25] (Adobe Systems Incorporated)
      HKLM Group Policy restriction on software: %systemroot%\system32\mrt.exe <==== ATTENTION
      HKU\S-1-5-21-1747955922-307037692-2103265143-1001\...\Run: [uTorrent] => C:\Users\Anton\AppData\Roaming\uTorrent\uTorrent.exe [1984184 2018-06-22] (BitTorrent Inc.)
      HKU\S-1-5-21-1747955922-307037692-2103265143-1001\...\Run: [Viber] => C:\Users\Anton\AppData\Local\Viber\Viber.exe [37338696 2018-04-24] (Viber Media S.à r.l.)
      HKU\S-1-5-21-1747955922-307037692-2103265143-1001\...\Run: [DAEMON Tools Lite Automount] => C:\Program Files\DAEMON Tools Lite\DTAgent.exe [5263040 2018-01-30] (Disc Soft Ltd)
      HKU\S-1-5-21-1747955922-307037692-2103265143-1001\...\Run: [Web Companion] => C:\Program Files (x86)\Lavasoft\Web Companion\Application\WebCompanion.exe [7368480 2018-08-04] (Lavasoft)
      HKU\S-1-5-21-1747955922-307037692-2103265143-1001\...\MountPoints2: {a097669a-1fdb-11e8-8817-f8a963267c4d} - "I:\startme.exe"
      HKU\S-1-5-21-1747955922-307037692-2103265143-1001\...\MountPoints2: {a09767e5-1fdb-11e8-8817-f8a963267c4d} - "H:\SETUP.EXE"
      HKU\S-1-5-21-1747955922-307037692-2103265143-1001\...\MountPoints2: {a0976fa4-1fdb-11e8-8817-f8a963267c4d} - "I:\Setup.exe"
      GroupPolicy: Restriction ? <==== ATTENTION
      ==================== Internet (Whitelisted) ====================
      (If an item is included in the fixlist, if it is a registry item it will be removed or restored to default.)
      Tcpip\Parameters: [DhcpNameServer]
      Tcpip\..\Interfaces\{3dad8f67-5fb2-42f7-8404-142ac9dfe4b7}: [DhcpNameServer]
      Tcpip\..\Interfaces\{7fd9a328-bcce-42f4-bd1c-45a1f2ee1e6c}: [DhcpNameServer]
      Internet Explorer:
      HKU\S-1-5-21-1747955922-307037692-2103265143-1001\Software\Microsoft\Internet Explorer\Main,Start Page = hxxps://search.yahoo.com/yhs/web?hspart=lvs&hsimp=yhs-awc&type=lvs__webcompa__1_0__ya__hp_WCYID10420__180523__yaie
      SearchScopes: HKU\S-1-5-21-1747955922-307037692-2103265143-1001 -> {C0C3A6C6-03BC-4195-8FCB-AEA091301353} URL = hxxps://search.yahoo.com/yhs/search?hspart=lvs&hsimp=yhs-awc&type=lvs__webcompa__1_0__ya__ch_WCYID10420__180523__yaie&p={searchTerms}
      BHO: Skype for Business Browser Helper -> {31D09BA0-12F5-4CCE-BE8A-2923E76605DA} -> C:\Program Files\Microsoft Office\Office15\OCHelper.dll [2018-04-10] (Microsoft Corporation)
      BHO: Microsoft OneDrive for Business Browser Helper -> {D0498E0A-45B7-42AE-A9AA-ABA463DBD3BF} -> C:\Program Files\Microsoft Office\Office16\GROOVEEX.DLL [2018-05-15] (Microsoft Corporation)
      BHO-x32: Skype for Business Browser Helper -> {31D09BA0-12F5-4CCE-BE8A-2923E76605DA} -> C:\Program Files (x86)\Microsoft Office\Office15\OCHelper.dll [2017-09-12] (Microsoft Corporation)
      BHO-x32: Microsoft OneDrive for Business Browser Helper -> {D0498E0A-45B7-42AE-A9AA-ABA463DBD3BF} -> C:\Program Files (x86)\Microsoft Office\Office16\GROOVEEX.DLL [2018-05-15] (Microsoft Corporation)
      Handler: mso-minsb.16 - {3459B272-CC19-4448-86C9-DDC3B4B2FAD3} - C:\Program Files\Microsoft Office\Office16\MSOSB.DLL [2018-04-10] (Microsoft Corporation)
      Handler-x32: mso-minsb.16 - {3459B272-CC19-4448-86C9-DDC3B4B2FAD3} - C:\Program Files (x86)\Microsoft Office\Office16\MSOSB.DLL [2018-04-10] (Microsoft Corporation)
      Handler: osf.16 - {5504BE45-A83B-4808-900A-3A5C36E7F77A} - C:\Program Files\Microsoft Office\Office16\MSOSB.DLL [2018-04-10] (Microsoft Corporation)
      Handler-x32: osf.16 - {5504BE45-A83B-4808-900A-3A5C36E7F77A} - C:\Program Files (x86)\Microsoft Office\Office16\MSOSB.DLL [2018-04-10] (Microsoft Corporation)
      FF DefaultProfile: 6l09fpov.default-1519148072560
      FF ProfilePath: C:\Users\Anton\AppData\Roaming\Mozilla\Firefox\Profiles\6l09fpov.default-1519148072560 [2018-08-04]
      FF Homepage: Mozilla\Firefox\Profiles\6l09fpov.default-1519148072560 -> about:home
      FF NewTab: Mozilla\Firefox\Profiles\6l09fpov.default-1519148072560 -> hxxps://search.yahoo.com/yhs/web?hspart=lvs&hsimp=yhs-awc&type=lvs__webcompa__1_0__ya__hp_WCYID10420__180523__yaff
      FF Extension: (Easy YouTube mp3) - C:\Users\Anton\AppData\Roaming\Mozilla\Firefox\Profiles\6l09fpov.default-1519148072560\Extensions\d.lehr@chello.at.xpi [2018-07-07]
      FF Extension: (Avast Online Security) - C:\Users\Anton\AppData\Roaming\Mozilla\Firefox\Profiles\6l09fpov.default-1519148072560\Extensions\wrc@avast.com.xpi [2018-06-01]
      FF Extension: (Adblock Plus) - C:\Users\Anton\AppData\Roaming\Mozilla\Firefox\Profiles\6l09fpov.default-1519148072560\Extensions\{d10d0bf8-f5b5-c8b4-a8b2-2b9879e08c5d}.xpi [2018-07-18]
      FF SearchPlugin: C:\Users\Anton\AppData\Roaming\Mozilla\Firefox\Profiles\6l09fpov.default-1519148072560\searchplugins\yahoo-lavasoft-ff59.xml [2018-05-23]
      FF Plugin: @adobe.com/FlashPlayer -> C:\WINDOWS\system32\Macromed\Flash\NPSWF64_30_0_0_134.dll [2018-07-14] ()
      FF Plugin: @microsoft.com/SharePoint,version=14.0 -> C:\Program Files\MICROS~1\Office16\NPSPWRAP.DLL [2015-07-31] (Microsoft Corporation)
      FF Plugin: adobe.com/AdobeAAMDetect -> C:\Program Files (x86)\Adobe\Adobe Creative Cloud\Utils\npAdobeAAMDetect64.dll [2016-10-25] (Adobe Systems)
      FF Plugin-x32: @adobe.com/FlashPlayer -> C:\WINDOWS\SysWOW64\Macromed\Flash\NPSWF32_30_0_0_134.dll [2018-07-14] ()
      FF Plugin-x32: @microsoft.com/Lync,version=15.0 -> C:\Program Files (x86)\Mozilla Firefox\plugins\npmeetingjoinpluginoc.dll [2018-04-10] (Microsoft Corporation)
      FF Plugin-x32: @microsoft.com/SharePoint,version=14.0 -> C:\PROGRA~2\MICROS~1\Office15\NPSPWRAP.DLL [2014-01-23] (Microsoft Corporation)
      FF Plugin-x32: @tools.google.com/Google Update;version=3 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [2018-05-16] (Google Inc.)
      FF Plugin-x32: @tools.google.com/Google Update;version=9 -> C:\Program Files (x86)\Google\Update\\npGoogleUpdate3.dll [2018-05-16] (Google Inc.)
      FF Plugin-x32: @videolan.org/vlc,version=2.2.6 -> C:\Program Files (x86)\VideoLAN\VLC\npvlc.dll [2017-05-24] (VideoLAN)
      FF Plugin-x32: Adobe Reader -> C:\Program Files (x86)\Adobe\Acrobat Reader DC\Reader\AIR\nppdf32.dll [2018-06-29] (Adobe Systems Inc.)
      FF Plugin-x32: adobe.com/AdobeAAMDetect -> C:\Program Files (x86)\Adobe\Adobe Creative Cloud\Utils\npAdobeAAMDetect32.dll [2016-10-25] (Adobe Systems)
      FF Plugin HKU\S-1-5-21-1747955922-307037692-2103265143-1001: @unity3d.com/UnityPlayer,version=1.0 -> C:\Users\Anton\AppData\LocalLow\Unity\WebPlayer\loader\npUnity3D32.dll [2017-05-18] (Unity Technologies ApS)
      CHR HomePage: Default -> hxxp://www.google.com
      CHR Profile: C:\Users\Anton\AppData\Local\Google\Chrome\User Data\Default [2018-07-25]
      CHR Extension: (YouTube) - C:\Users\Anton\AppData\Local\Google\Chrome\User Data\Default\Extensions\blpcfgokakmgnkcojhhkbfbldkacnbeo [2017-10-26]
      CHR Extension: (Adobe Acrobat) - C:\Users\Anton\AppData\Local\Google\Chrome\User Data\Default\Extensions\efaidnbmnnnibpcajpcglclefindmkaj [2017-10-26]
      CHR Extension: (Avast SafePrice) - C:\Users\Anton\AppData\Local\Google\Chrome\User Data\Default\Extensions\eofcbnmajmjmplflapaojjnihcjkigck [2018-02-18]
      CHR Extension: (Avast Online Security) - C:\Users\Anton\AppData\Local\Google\Chrome\User Data\Default\Extensions\gomekmidlodglbbmalcneegieacbdmki [2017-10-26]
      CHR Extension: (Плащания в уеб магазина на Chrome) - C:\Users\Anton\AppData\Local\Google\Chrome\User Data\Default\Extensions\nmmhkkegccagdldgiimedpiccmgmieda [2017-10-26]
      CHR Extension: (Chrome Media Router) - C:\Users\Anton\AppData\Local\Google\Chrome\User Data\Default\Extensions\pkedcjkdefgpdelpbcmbmeomcjbeemfm [2018-01-23]
      CHR HKLM-x32\...\Chrome\Extension: [efaidnbmnnnibpcajpcglclefindmkaj] - hxxps://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [eofcbnmajmjmplflapaojjnihcjkigck] - hxxps://clients2.google.com/service/update2/crx
      CHR HKLM-x32\...\Chrome\Extension: [gomekmidlodglbbmalcneegieacbdmki] - hxxps://clients2.google.com/service/update2/crx
      ==================== Services (Whitelisted) ====================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R2 AdobeUpdateService; C:\Program Files (x86)\Common Files\Adobe\Adobe Desktop Common\ElevationManager\AdobeUpdateService.exe [744640 2016-10-25] (Adobe Systems Incorporated)
      R2 AGMService; C:\Program Files (x86)\Common Files\Adobe\AdobeGCClient\AGMService.exe [2321384 2018-05-11] (Adobe Systems, Incorporated)
      R2 AGSService; C:\Program Files (x86)\Common Files\Adobe\AdobeGCClient\AGSService.exe [2128872 2018-05-11] (Adobe Systems, Incorporated)
      R3 aswbIDSAgent; C:\Program Files\AVAST Software\Avast\x64\aswidsagenta.exe [7780400 2018-06-22] (AVAST Software)
      R2 avast! Antivirus; C:\Program Files\AVAST Software\Avast\AvastSvc.exe [322464 2018-06-22] (AVAST Software)
      R3 Disc Soft Lite Bus Service; C:\Program Files\DAEMON Tools Lite\DiscSoftBusServiceLite.exe [3480768 2018-01-30] (Disc Soft Ltd)
      R2 HTCMonitorService; C:\Program Files (x86)\HTC\HTC Sync Manager\HSMServiceEntry.exe [87368 2016-09-20] (Nero AG)
      R2 igfxCUIService2.0.0.0; C:\WINDOWS\system32\igfxCUIService.exe [365040 2017-10-20] (Intel Corporation)
      R2 PassThru Service; C:\Program Files (x86)\HTC\Internet Pass-Through\PassThruSvr.exe [166912 2013-10-17] () [File not signed]
      S3 Sense; C:\Program Files\Windows Defender Advanced Threat Protection\MsSense.exe [4329952 2017-12-31] (Microsoft Corporation)
      R2 SynTPEnhService; C:\Program Files\Synaptics\SynTP\SynTPEnhService.exe [249032 2015-06-03] (Synaptics Incorporated)
      R2 TeamViewer; C:\Program Files (x86)\TeamViewer\TeamViewer_Service.exe [11294448 2018-03-09] (TeamViewer GmbH)
      R2 WCAssistantService; C:\Program Files (x86)\Lavasoft\Web Companion\Application\Lavasoft.WCAssistant.WinService.exe [25888 2018-08-04] ()
      S3 WdNisSvc; C:\Program Files\Windows Defender\NisSrv.exe [355304 2017-09-29] (Microsoft Corporation)
      S3 WinDefend; C:\Program Files\Windows Defender\MsMpEng.exe [105944 2017-09-29] (Microsoft Corporation)
      ===================== Drivers (Whitelisted) ======================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)
      R0 amdkmpfd; C:\WINDOWS\System32\drivers\amdkmpfd.sys [65248 2015-04-24] (Advanced Micro Devices, Inc.)
      R1 aswArPot; C:\WINDOWS\System32\drivers\aswArPot.sys [197160 2018-06-22] (AVAST Software)
      R1 aswbidsdriver; C:\WINDOWS\System32\drivers\aswbidsdrivera.sys [229392 2018-06-22] (AVAST Software)
      R0 aswbidsh; C:\WINDOWS\System32\drivers\aswbidsha.sys [201328 2018-06-22] (AVAST Software)
      R0 aswblog; C:\WINDOWS\System32\drivers\aswbloga.sys [346664 2018-06-22] (AVAST Software)
      R0 aswbuniv; C:\WINDOWS\System32\drivers\aswbuniva.sys [59592 2018-06-22] (AVAST Software)
      S3 aswElam; C:\WINDOWS\System32\drivers\aswElam.sys [15360 2018-06-22] (AVAST Software)
      R1 aswHdsKe; C:\WINDOWS\System32\drivers\aswHdsKe.sys [239680 2018-06-22] (AVAST Software)
      S3 aswHwid; C:\WINDOWS\System32\drivers\aswHwid.sys [46976 2018-06-22] (AVAST Software)
      R2 aswMonFlt; C:\WINDOWS\System32\drivers\aswMonFlt.sys [159640 2018-06-22] (AVAST Software)
      R1 aswRdr; C:\WINDOWS\System32\drivers\aswRdr2.sys [111872 2018-06-22] (AVAST Software)
      R0 aswRvrt; C:\WINDOWS\System32\drivers\aswRvrt.sys [85968 2018-06-22] (AVAST Software)
      R1 aswSnx; C:\WINDOWS\System32\drivers\aswSnx.sys [1027728 2018-06-22] (AVAST Software)
      R1 aswSP; C:\WINDOWS\System32\drivers\aswSP.sys [467064 2018-07-25] (AVAST Software)
      R2 aswStm; C:\WINDOWS\System32\drivers\aswStm.sys [211160 2018-06-22] (AVAST Software)
      R0 aswVmm; C:\WINDOWS\System32\drivers\aswVmm.sys [381584 2018-06-22] (AVAST Software)
      R3 dtlitescsibus; C:\WINDOWS\System32\drivers\dtlitescsibus.sys [30264 2018-03-04] (Disc Soft Ltd)
      R3 dtliteusbbus; C:\WINDOWS\System32\drivers\dtliteusbbus.sys [47672 2018-03-04] (Disc Soft Ltd)
      R1 ISODrive; C:\Program Files (x86)\UltraISO\drivers\ISODrv64.sys [115448 2013-11-21] (EZB Systems, Inc.)
      S3 RTSUER; C:\WINDOWS\system32\Drivers\RtsUer.sys [410880 2015-07-03] (Realsil Semiconductor Corporation)
      R3 rtsuvc; C:\WINDOWS\system32\DRIVERS\rtsuvc.sys [3059416 2015-06-11] (Realtek Semiconductor Corp.)
      R3 SmbDrvI; C:\WINDOWS\system32\DRIVERS\Smb_driver_Intel.sys [42696 2015-06-03] (Synaptics Incorporated)
      S3 WdBoot; C:\WINDOWS\system32\drivers\WdBoot.sys [44608 2017-09-29] (Microsoft Corporation)
      S3 WdFilter; C:\WINDOWS\system32\drivers\WdFilter.sys [309144 2017-09-29] (Microsoft Corporation)
      S3 WdNisDrv; C:\WINDOWS\System32\Drivers\WdNisDrv.sys [119192 2017-09-29] (Microsoft Corporation)
      ==================== NetSvcs (Whitelisted) ===================
      (If an entry is included in the fixlist, it will be removed from the registry. The file will not be moved unless listed separately.)

      ==================== One Month Created files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-08-04 17:19 - 2018-08-04 17:20 - 000040238 _____ C:\Users\Anton\Desktop\Addition.txt
      2018-08-04 17:16 - 2018-08-04 17:23 - 000018696 _____ C:\Users\Anton\Desktop\FRST.txt
      2018-08-04 17:16 - 2018-08-04 17:20 - 000000000 ____D C:\FRST
      2018-08-04 17:14 - 2018-08-04 17:15 - 002412544 _____ (Farbar) C:\Users\Anton\Desktop\FRST64.exe
      2018-08-04 17:09 - 2018-08-04 17:09 - 000000000 ___HD C:\Users\Public\Documents\AdobeGC
      2018-07-25 15:13 - 2018-07-25 15:13 - 000000000 ____D C:\Users\Anton\AppData\Local\PlaceholderTileLogoFolder
      2018-07-25 15:11 - 2018-07-25 15:11 - 000107310 _____ C:\Users\Anton\Desktop\FileZilla.xml
      2018-07-25 15:10 - 2018-07-25 15:11 - 007791072 _____ (Tim Kosse) C:\Users\Anton\Downloads\FileZilla_3.35.1_win64-setup.exe
      2018-07-19 13:01 - 2018-07-19 13:01 - 000000711 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Tanki Online.lnk
      2018-07-19 12:59 - 2018-07-19 12:59 - 009644712 _____ (AlternativaGame Ltd ) C:\Users\Anton\Downloads\tankionline_eu.exe
      2018-07-19 09:44 - 2018-08-04 17:06 - 000000000 ____D C:\Users\Anton\AppData\LocalLow\uTorrent
      ==================== One Month Modified files and folders ========
      (If an entry is included in the fixlist, the file/folder will be moved.)
      2018-08-04 17:22 - 2017-09-29 16:46 - 000000000 ____D C:\WINDOWS\DeliveryOptimization
      2018-08-04 17:22 - 2017-09-26 18:50 - 000000000 ____D C:\Users\Anton\AppData\Roaming\uTorrent
      2018-08-04 17:21 - 2017-09-29 16:46 - 000000000 ____D C:\WINDOWS\AppReadiness
      2018-08-04 17:09 - 2017-09-26 00:28 - 000000000 ____D C:\Users\Anton\AppData\LocalLow\Mozilla
      2018-08-04 17:08 - 2018-06-23 10:14 - 000000000 ____D C:\Users\Anton\AppData\Local\AVAST Software
      2018-08-04 17:06 - 2017-10-12 22:48 - 000000000 ____D C:\Users\Anton\AppData\Local\HTC MediaHub
      2018-08-04 17:05 - 2017-12-31 07:35 - 000000006 ____H C:\WINDOWS\Tasks\SA.DAT
      2018-08-04 17:05 - 2017-10-23 19:45 - 000000000 ____D C:\Program Files (x86)\TeamViewer
      2018-08-04 17:05 - 2017-10-21 12:50 - 000000180 _____ C:\WINDOWS\system32\{A6D608F0-0BDE-491A-97AE-5C4B05D86E01}.bat
      2018-08-04 17:05 - 2017-09-26 00:39 - 000000000 __SHD C:\Users\Anton\IntelGraphicsProfiles
      2018-07-25 20:17 - 2017-09-29 11:45 - 000524288 _____ C:\WINDOWS\system32\config\BBI
      2018-07-25 20:00 - 2017-09-29 16:46 - 000000000 ____D C:\WINDOWS\system32\NDF
      2018-07-25 19:52 - 2017-12-31 07:14 - 000000000 ____D C:\WINDOWS\system32\SleepStudy
      2018-07-25 17:10 - 2017-12-31 07:18 - 000000000 ____D C:\Users\Anton
      2018-07-25 16:53 - 2017-09-26 19:10 - 000000000 ____D C:\Users\Anton\AppData\Roaming\vlc
      2018-07-25 16:51 - 2018-06-03 23:14 - 000000000 ____D C:\Users\Anton\AppData\Roaming\FileZilla
      2018-07-25 15:48 - 2018-06-03 23:14 - 000000000 ____D C:\Users\Anton\AppData\Local\FileZilla
      2018-07-25 15:13 - 2017-12-31 07:19 - 000000000 ____D C:\Users\Anton\AppData\Local\Packages
      2018-07-25 15:13 - 2017-09-29 16:46 - 000000000 ___HD C:\Program Files\WindowsApps
      2018-07-25 15:12 - 2018-06-03 23:12 - 000000000 ____D C:\Users\Anton\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\FileZilla FTP Client
      2018-07-25 15:12 - 2018-06-03 23:12 - 000000000 ____D C:\Program Files\FileZilla FTP Client
      2018-07-25 14:51 - 2017-09-26 18:43 - 000467064 _____ (AVAST Software) C:\WINDOWS\system32\Drivers\aswSP.sys
      2018-07-24 21:36 - 2017-12-31 07:35 - 000004264 _____ C:\WINDOWS\System32\Tasks\Avast Emergency Update
      2018-07-22 16:34 - 2017-10-08 22:55 - 000000875 _____ C:\Users\Anton\Desktop\Книги.txt
      2018-07-22 15:44 - 2017-09-29 16:37 - 000000000 ____D C:\WINDOWS\CbsTemp
      2018-07-18 23:21 - 2018-06-26 23:00 - 000000000 ____D C:\Users\Anton\AppData\Local\CrashDumps
      2018-07-18 23:19 - 2018-04-21 10:07 - 000000000 ___RD C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Microsoft Office 2013
      2018-07-18 23:18 - 2015-10-30 10:24 - 000000167 _____ C:\WINDOWS\win.ini
      2018-07-15 13:29 - 2017-09-27 00:48 - 000000000 ____D C:\WINDOWS\system32\MRT
      2018-07-15 13:24 - 2017-09-27 00:48 - 134675576 ____C (Microsoft Corporation) C:\WINDOWS\system32\MRT.exe
      2018-07-15 13:17 - 2017-09-29 16:46 - 000000000 ____D C:\Program Files\Common Files\microsoft shared
      2018-07-15 12:58 - 2017-12-23 17:33 - 000000000 ___DC C:\WINDOWS\Panther
      2018-07-15 12:16 - 2017-12-31 07:34 - 000065683 _____ C:\WINDOWS\diagwrn.xml
      2018-07-15 12:16 - 2017-12-31 07:34 - 000062868 _____ C:\WINDOWS\diagerr.xml
      2018-07-15 10:45 - 2017-10-21 13:22 - 000000000 ____H C:\$WINRE_BACKUP_PARTITION.MARKER
      2018-07-15 10:43 - 2017-09-29 11:45 - 000032768 _____ C:\WINDOWS\system32\config\ELAM
      2018-07-15 10:07 - 2017-09-29 16:46 - 000000000 ____D C:\WINDOWS\Registration
      2018-07-15 10:06 - 2018-04-12 20:30 - 000000000 ___HD C:\$WINDOWS.~BT
      2018-07-14 11:11 - 2017-10-15 22:30 - 000000000 ____D C:\Users\Anton\AppData\Local\LenovoServiceBridge
      2018-07-14 11:05 - 2018-03-15 00:41 - 000004588 _____ C:\WINDOWS\System32\Tasks\Adobe Flash Player NPAPI Notifier
      2018-07-14 11:05 - 2017-12-31 07:35 - 000004422 _____ C:\WINDOWS\System32\Tasks\Adobe Flash Player Updater
      2018-07-14 11:05 - 2017-09-29 16:46 - 000000000 ____D C:\WINDOWS\SysWOW64\Macromed
      2018-07-14 11:05 - 2017-09-29 16:46 - 000000000 ____D C:\WINDOWS\system32\Macromed
      2018-07-10 23:51 - 2017-09-29 00:46 - 000000187 _____ C:\Users\Anton\Desktop\Angliski.txt
      2018-07-10 20:48 - 2017-12-31 07:35 - 000004562 _____ C:\WINDOWS\System32\Tasks\Adobe Acrobat Update Task
      2018-07-10 20:47 - 2017-09-26 18:59 - 000002457 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Acrobat Reader DC.lnk
      2018-07-10 08:13 - 2017-12-31 07:35 - 000003376 _____ C:\WINDOWS\System32\Tasks\OneDrive Standalone Update Task-S-1-5-21-1747955922-307037692-2103265143-1001
      2018-07-10 08:13 - 2017-09-26 00:26 - 000002391 _____ C:\Users\Anton\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\OneDrive.lnk
      2018-07-10 08:13 - 2017-09-26 00:26 - 000000000 ___RD C:\Users\Anton\OneDrive
      2018-07-08 23:05 - 2018-02-20 20:34 - 000000000 ____D C:\Program Files\Mozilla Firefox
      2018-07-08 23:05 - 2018-02-20 20:34 - 000000000 ____D C:\Program Files (x86)\Mozilla Maintenance Service
      2018-07-07 15:25 - 2018-02-20 20:34 - 000001005 _____ C:\ProgramData\Microsoft\Windows\Start Menu\Programs\Firefox.lnk
      ==================== Files in the root of some directories =======
      2018-06-03 22:57 - 2018-06-03 23:09 - 000000600 _____ () C:\Users\Anton\AppData\Roaming\winscp.rnd
      2018-02-25 19:38 - 2018-02-25 19:38 - 000001456 _____ () C:\Users\Anton\AppData\Local\Adobe Save for Web 13.0 Prefs
      2018-06-10 00:20 - 2018-06-10 00:20 - 000002031 _____ () C:\Users\Anton\AppData\Local\recently-used.xbel
      Some files in TEMP:
      2018-07-10 08:14 - 2018-08-04 17:09 - 000391024 _____ (adaware) C:\Users\Anton\AppData\Local\Temp\wcupdater.exe
      ==================== Bamital & volsnap ======================
      (There is no automatic fix for files that do not pass verification.)
      C:\WINDOWS\system32\winlogon.exe => File is digitally signed
      C:\WINDOWS\system32\wininit.exe => File is digitally signed
      C:\WINDOWS\explorer.exe => File is digitally signed
      C:\WINDOWS\SysWOW64\explorer.exe => File is digitally signed
      C:\WINDOWS\system32\svchost.exe => File is digitally signed
      C:\WINDOWS\SysWOW64\svchost.exe => File is digitally signed
      C:\WINDOWS\system32\services.exe => File is digitally signed
      C:\WINDOWS\system32\User32.dll => File is digitally signed
      C:\WINDOWS\SysWOW64\User32.dll => File is digitally signed
      C:\WINDOWS\system32\userinit.exe => File is digitally signed
      C:\WINDOWS\SysWOW64\userinit.exe => File is digitally signed
      C:\WINDOWS\system32\rpcss.dll => File is digitally signed
      C:\WINDOWS\system32\dnsapi.dll => File is digitally signed
      C:\WINDOWS\SysWOW64\dnsapi.dll => File is digitally signed
      C:\WINDOWS\system32\Drivers\volsnap.sys => File is digitally signed
      LastRegBack: 2018-07-22 16:44
      ==================== End of FRST.txt ============================
  • Дарение



Поставихме бисквитки на устройството ви за най-добро потребителско изживяване. Можете да промените настройките си за бисквитки, или в противен случай приемаме, че сте съгласни с нашите условия за ползване.